Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001842 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001842
Unique NameTCONS_00001842
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1864

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001842 ID=TCONS_00001842|Name=TCONS_00001842|organism=Clytia hemisphaerica|type=transcript|length=1864bp
AATCGATGTACGGTACGCTGTTTGAATCTAGAAACTCATCATTGGACAGC
TCCTCTAATTAGCTTGAGataaaaatgaATAACATGGATCAAGATACAGA
CCAATTGATGGAAGAGCCAGAAACAAAAGTTTCTTCGAGGCTCAAGTATT
TTCTCCTGGCATTTTCTATGTTCTTTTGGCTACTGGGAGCATTGTTTGCT
GCTATTGGTGGTTATGTTGTTTCTCAGAAGACTGGGTATGAAGAGTTGTC
AGATTTTGCAACCGACCCTGGAATCATTCTTGCAACTTTGGGTTGCTTTA
TCTTCGTTGTCTCCTCTTTTGGTGTTTTGGGATCCCTTCGAGAAAATGTT
TGTCTTCTCAACACatacaaatattttcttttggtAACTTTGGTTTTTGA
ATTGATCTGTGGCCTTATTGCTTTTGCTTTTTGGCCTGAAGTTAAGAAAA
TGGTTGACCGAAATCTCTCACTGGCTATTGAGAAATACACATCCAATGTT
GATCTCCGAAACATGATGGATAAATTGCAAAGAGAGCTTGAATGCTGTGG
AAGTTTGACCATTGATGACTGGGATAGTAACCCGTATTTCAgttgcaaaa
atgttgaaagTTACCGTTCATGTGGTGTCCCATGGTCATGTTGCTTGaga
aaatatgaaagaaatcGACAATGTGGTTATGGTGTCCGAAAGAATCGTGT
CCACGTCAAAATGTCCAACGAAATATACACCATTGGCTGTCTGGATAAAG
GTTTTGAGTTCTTTAGGAATAACATGATGCTGGTTGCTGCCATGGCTGTT
GCTTTTACACTCCCTCTTGTCATTGGTATTTTCAGCATCCATATCTTTGT
CGGCCAAATCTTGTCACAGCTTGTCAAAGTAAACAGAGAGAAAATTTATT
TgtaagtgaaaaataaaaatgaagtaaCCAGGACCAGGAACATTCAcata
atgaaaacaaaacaatgcaaCTTTATTCTTGTTTTCAGCAGATAACCATG
TTTTATGAAAACTTAAGGATTGGTATTAGAACCGTTTGATAACAATTTCA
ACACCGTcagttttgaaattcaacattaaaaatttcattttgaggGACAG
ATTCTGTATGTTATAAAACAAACATtaatgtatttttctttttttttttt
gcatccaTTTTATAATATTactatttataagaatgtctgATTTTTTAATT
AATGTGGTTAaggttttttaagtttttgtatGTAGCTTTTATTTGGataa
ttgattgaaattttgttgCATGTTTTAAACCTTTAAATAATGTGCAGCAT
TGATAACGAATATCTCAAAATTATAGAGTGACCCTTCCACGAGACTGTCA
GTTAACTTTTGCCAGAGAtggactttgatttcatttctGTTTTAAATAGT
AAACTGAAATAAGAGATTCCCTTCTTTTGTGTAGGGTCAAATCGATGTCG
TCCTCTGGCATGTTTTGTTCTTTCTTTATAGATATTATAAAGAATACGGT
TTTAGGTCCTCTCTAATATCACTTTTGATATCATTTtacatttattttta
tcaattttgacaCACAAAATGGTTTACTTTGCTATTTGAATCTTTAGAAA
TCCATTGATTGTAATGATGTGTCTAGTATCTTGACTTCAACCAACTATCA
ACTATCTTATTTTTACCTAGTATCCCTAAGAAATATTCGTATCCTCATAA
AACTTGAGCACTAAGAAGGAACCAAACTATTTTTTATTATATTCTAAAAA
ACATCataaatttgtaatttttattCACTCATTTGTAAGATCTTTATTCT
ATTCTATATTCTTTATAAACTAACTACTTCTCCATTAAATTGTTCTTTCA
TTGCCTATTTATTT
Run BLAST on NCBI

transcript from alignment at sc0000012:836643..921927+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001842 ID=TCONS_00001842|Name=TCONS_00001842|organism=Clytia hemisphaerica|type=transcript|length=85285bp|location=Sequence derived from alignment at sc0000012:836643..921927+ (Clytia hemisphaerica)
AATCGATGTACGGTACGCTGTTTGAATCTAGAAACTCATCATTGGACAGC TCCTCTAATTAGCTTGAGGTGAGAAATTTTGTATGAAGATTTTATAGGTT TTTATATAATTTCTGATACTTGACATTTCTGCTTTAATAAACATGACAAT GGATATACATGTTTTGAATGTGGGTGGGGTTTCATGTCCGACAGCCCCAG GTGGGATAATAACAgcacaaaattgaaaataagtttCTCATAGAGTACTT TTTGTtgctaaaaatgagaaaaaataggGAAATTAGAAGAAAATTTAGGG ATTTTCATTCCCCACCTTTTAGTCACCTTTTATATGTTTACAAGAAAAGG CATAAATAAGGGAGGGGTACCTCGTCAGGAATACCTACTTAACCCTCCCT TCGCTCCTGTGTTTCATAGAATTTGCCATGTAGGGAAGATTCCAATGGCG AAATATCCATTCTTTTCAGGTAAATTTGGAAAGTTTATTTCACACTTTAT TCTCAATGGGGTGGGGCTGTCTAGGAATTGTTCAGTGAAAATGACATTTA ATCTTTAAATTTTCCAGTTGGGAATAGGGAAACGGCTCAGGTATCTGTCT GGTAATTAACTATACATTGGGTATAAAAAAGTAAAGATGCCATTAACTTT TTaaccattttgattgaataCTGATGTGAGAAATGGCTTGGGTTTTCTCT ACAGAGCCTAATGGAGTTGttattaaaaaatatacaatttcatTTCCGGT CTAGAATCTCGTATTGAATGGgttgtttttcatttgtcaattgCACAATG GAAATATCAATTACTTTCAATTTATATTGAGGTTTTGTCGCTGTAATTAA AATTTATACTGGTAATGTTAATGATCATTGAAGGTCATTAATATGGTTAA TTTGAGATGTAAACTTTGGGAACGGGGGAGGGAAACCTTGAACTACGTAT TAGTTtggtttttgtgacgtcatcaagataGTAAAGATTTGTTGGTTGAA TAAGGAAAGAGTGGGAAAAACTTCTTTGTTTACTTTACATGTAGTTTTTC ATGAGTAATAATTATTTGACCGTCTTGATAGATTGTAGATGAGGTAAAAT TATAGAATTCGAGGGACATATAAGATATGACATTCCAGCTTTTGTTTAGC GGGGGGAGGGGGCTTGTTCGGCTCTCTCCCCCGCTCTCTCATCTGCGGAA TAATAAAATCATTCACTCTTCTTATCTTCACTCTCTTATGTTGGTGTTTT TTACATTTCTGGCAAAAacgtgaagtttttttaaacagattttaaaataa atacaaaatgcaCCTTTTCTTAATATGATATCAGGGGGATCGGCAAATGA TTGAAGATTTCATTCCATTTTTCCCGAGCCTTCTAGAGAAATTAAACCAG TACTTATAACCTCCTAAAGCTAGGAGCACGTTAGGATTAAACGATTCCAT AATGAAAATGGATTATGGATTCCATGagtaataacttttgatctaatggg gCTTTAGAATTGAAATTTGGCAGGATGGAGCATTTATGTATTTTCTAttc ctaaataaaaaatcttccaacTGGGAGCAGTTTGGGATCACTTATtcgta atttttctttgagttcAAGCCTTTTTAAACTGAGGattgtttgttgttta tttgATATTAAGTAGTTCAAATTTAACTATTTGGAAGGTTCAGGCTCTTA AGaacaagaaaataagattttccacTAGAATAGAGCATCTAAGGATTATC AAATCCTTCATTGAAAGTAACATACTTTGCCTTATCCGAAATGAGCGTCT TAATCTGGAATGAAATATCCTACAAGGCTCTAAACTGATTTTTTACGTTA TGCATGATATGTCGTTACGTTAATGACCTAAAATAAGCTCAGATAGAGCC CCGAAGGATTAATAATTCCATTTTGCGACAAGTTGGGGTTGGGGTAGGTT CACCACTTGTTCACCgcacaaaatgaaatttttaatcccGAAACGCTCGC GAAACCGCACTTTTTGGTATCtaagaatgttttaaaattaaGTGGAAGTg acttttgattaattttagatTGTGATCAGTccattttaacgatgaaatgc atCTTTTATAATTGTTCAAGTTCAGAGATGTTTTTCGGANNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNGTAACAAGTTCAGACCATCAGAAT CAATCCAAGAGCCACTTAACTCTCATAattccaaaattcttaaaatctaa tattttggaatattggATCCTTCTTCACTCCTGGAACCAAAACCAAAAGT TCTAAGCTCGTGTGTTACACTTTTTTGGAAGATTTCATCCCAAAATGcta tttcaaattcattttattcaagaaaaaccattttttagaaaatttaatgt cacgtttttgccaaaagtgtaaaaaacaccgacttATCCTCTATCATAAG TTTAAAATGCAAGGCTTTATGTCAAAATCTGTTCTTTTCTGCTATGATGA AAGCTTCTTTCTCAAACTTTCCAATTCAAATCTGGTAATTATGTGGAATC TTTCCTCATCATCTTATTCTGGTCAGTAATCAGTAATCAGCTATTCATCC TGGTCCAAGGATTTGCTCTTTCACATCTCGAAGGAAGTAATAtctttaag gctttgcagactctagaacacccgatttcttaggacaaaaatactccaaa atggcgaaaataagaacaagcttaagaacatattttttaggcttaaacct caaaaaattaagaacatccgccCTTATTTTCGACTTTTACAGTACAGTAT AGTACATATTTACGTTGCCTGACAAACCTAGTAcacggtttttttataag aatggtgtttttcttttgaatcaTATATTCTTAAGCTTTTTGAGataatc atcctaaaatattcttaagatgATTAGGATCATCTTGGTTAGGATCCAAG TTCAACTGATAATACATTCCtcaatggaaaatatttttgtgaaagctTTG ATGCTTGGAGATAATTTCCAATTTACAGGTAAAAGTGCTCTCGAAATTCA ATCATAGGTCCTAGGTTCAGTTGCAAGATCAAAAAAGGGGCATAtactta gcatattcttaatttttggccatAATATAgataacattttttataagata aatTTACAGAGAATAAGGTTACAGAGTAATCCCATGCGCTTATAATTTGT TTTTCCAGAGAAGTGCAGATAACTGGCTCAGGCACACTAAGTGaatttta ttagatttttacATCAAGATCTCTATCGAACTTTTTATCTGATATATACC TTCGACGCCATCTCATAACCGTACTAATACAATGTTATGACTCTAATATC ACTATGGCAACTATCGTTCTCCCTCGTTCTCTAGCAATATTCAATAAAAG GGCTCTTTGTACAATCTGCTCCTAAGCTAGTTTTCTCTCCCGAATGATGT ATTAATTTTTATGATTATGCTGCAAAATTtgtgtaaaattttgaaatcca tGGGGTGCGTAACTGAAATTAAATTTGAACAAATAGTTATCtcattttaa acaatcttaGGTTAAATAAATAtacaattataaaaaaaaaNaaatatttt tgtgaaagctTTGATGCTTGGAGATAATTTCCAATTTACAGGTAAAAGTG CTCTCGAAATTCAATCATAGGTCCTAGGTTCAGTTGCAAGATCAAAAAAG GGGCATAtacttagcatattcttaatttttggccatAATATAgataacat tttttataagataaatTTACAGAGAATAAGGTTACAGAGTAATCCCATGC GCTTATAATTTGTTTTTCCAGAGAAGTGCAGATAACTGGCTCAGGCACAC TAAGTGaattttattagatttttacATCAAGATCTCTATCGAACTTTTTA TCTGATATATACCTTCGACGCCATCTCATAACCGTACTAATACAATGTTA TGACGCCAATATCACTATGGTGATTATCGTTCTCCCTCGTTCTCTAGCAA TATTCAATAAAAGGGCTCTTTGTACAATCTGCTCCTAAGCTAGTTTTCTC TCCCGAATGATGTATTAATTTTTATGATTATGCTGCAAAATTtgtgtaaa attttgaaatccatGGGGTGCGTAACTGAAATTAAATTTGAACAAATAGT TATCtcattttaaacaatcttaGGTTAAATAAATAtacaattataaaaaa aaaatgaataaaatcaaGTTCGATTTTAATTATAAAAAGAATATtgtaat tttaaaattatttacaaattgTCAAGCATAAATTAGCCATACTGGCTTGC GTTTTATAATAATATGATATTAAGATATCCCCAGAAGTCAAAGCAACCTA ATTTAGATTTTGTAGACCCTAAGATCTCTTAAGCTCTACAAATTTAACTA AAAACCTCTGTAATTTGATCGACATTCGAGAGATTCAATCTGATCCCATT ATGAAAATGGTTCCCATTGCAAACGGATAAATTAATAATTAATCCCTCAC TTATTGGCATACTGAAATCAACAACGGTGTTAATTTCCGCTTTTAAATAC CTTATCCCAAGGTCACCATCGACCCCTATGTCATATGtgtcatctttgat cggagcttTAGAGCTTTGGTACCCTAATAATAGCACTTCTTAAGGTGGAT ATTACTCTTttatacaccccttctcacagacccactgggaacccttccca ctggaaaaattcgccaaaatattgtccccggtggaaaattatcctctatT TTTTGTCCCCaccgaaaaaaatcaaataaaccaaaccTCGCTGCGAAATA TTTATTATCTTTCCCATCTCCACTGAATTTTATTAACTTAAAAactaaag aattgaaatcctcattcataaaaaatatgagaatacCAATCCCCACTGAG TTTTAGTCCgctattttcatccccactggcggaaaaaatcctaccgggtc tgtgagaagggggtgtttttatAACAGTATCCCATTAAGAAAAGCAGTAC TTACATTATATTAGTACTACACCGGTAGGCTACCAAATTTCTAAATTCCA AATATTTTGTTAATCGGTAACCAGTATTTATAATGATCAGTGCTATTCAC TCATCATACTTTAACACCTTTTCCAAGTTCTACTTTTTCAATCAGAGTAT CCTGTTCACATGACTCAGACGGCTTCTTTTCATTATCATTATGGTCTGAT AAGTTAGCTGATTGTCTTTGAGAAGCCGGTTCACCTACAACTAGACTGTT CCGATCGTTAATCACGAACGACATACTTGTTAAGTCGCCTTCCCGTTTGA TGAGCGACTGTGTTagttttttacataattttgatCTGGACAGTAATACC AGCGAACTCTTCCTCAGAGATCGAGTGAACATTAAATAAGTCAATGGATT TAAACATGAAATTACGAACGGTACGAAAGGGATTAACCAATTTTGAAAAC CGGTAATATCCTTGCCAGCTACAATTTCATAAGTATTACACGTCATGAAA TAACCCCATCCGCAAACAAAAGGAACTGTCATTATTGCCACGTTAAAAGC GATCTTGATTTCTCGAAACCTTGCTGGTCTCATTGATGCAACTTTTTCCA GATTCTCTTGATCCATTGTGGATATAACGACAATAACTTTGCtgattttc ttttccattttcatATTCTTTAACGCTGATACCAGAATAAAACCATAGGA GACAAGTACTAATATACAAGGGATGAAAAAGCTCAATGTAGCAGCGATGA AGAAAAACACTGAATTGTAGACGTCGCTGACAACCGGTATCCGTAATAAA CCCATTACGAGGAGCACCAAACAATAAACCCAGATTCCAATAATAGTACG GTTTGCTGTCCGATCATTAAGGTACCTTGGATATCTCAAAGGCATTGATA CAGCTATGCCTCTTTCCATAGTTACTGCTGTTACATGTAGCAAAGACGCT GAACCAATAACGACATCGATTGTTGGAAAGAAGAAGCTTTGAACTCGGGG ACTTGCATCTGACATTGCACCAGACGTATACATGGTCACAAATAGTAACA TCTGAAAGATAACCAGAAGATCAGAAACTGCTAGATTGCAAATGAAGTAA CCAGTGGTATTGCGAAGATGTTTGATTTTGTATACGGTCATTAGAATCAA AACGTTAGCAAAGAAACCGATCGGTGTCAACACAGAGAGGATAATGAATG TAAGTAAGCGCCAGGCTGGATTCAAAACACCTGCTGCGTGATGATTAGCT GACAAACAAACATCTCTGTATAATTGCTCTTCCTGTGGGCTTCTATTATC TTTCATATAATTGCAAACATCCCTAATGAGTATATCAGGATGAGTCTCAT TGTTAGGGTTCACAGTCTTGTTCAGGATCATGAACGGTATCGGGTCACAG CAATGATCGTAAAAAATTCTCTCTTCAAATGTCACCATTGATGCATTGAT ACTTTCAATTATACCACAAATGTTCGGCAAAATAACATAGATTAGCTCAG AAACACTTCCTGTCGGCTGCATCATCTGCATAATATCATTGCAAGATGTA ACATTCATCTTTATTCGCTTTTTACTTCGCCACGTTGATTATGGTCACTC TAGTTTTTTTGCCTAACAGAATCAGTAGcattgaaacttatctcatcATC TAAAAAGAACAGTTAGAATTACTTTACACATCATTATAGTCAATCAAGCG ATAAAGATTTACGAAGAAACATGTAGATAGAGGAAATATCTTAATACCAA GGCATCACGCCTTAAATCAATTAGGAAGACTTTTAAGCGGAGGAGAATCC CCTGATAAAAGTTCTCTATTATACAGATAATTgcaaaaagtatttttcag TTCTATTGTTATCGTGTATGGTTGAAAGAAATTTCCCATTTTTaagtaaa caaacaaacaaacacacaaATTAAACTTTGACAGCAAACTTTAATTTATT CCTCATCAGCATCATAACGATCATCATCAGCACATTGTTCACTTGACAAA AAACAAATTGCATCTGACAACTAGATGAGAAAagtaccaaaaatattttt caatgatcaGCTTGTAATTAGATCTAATTTGATTAGAATGTGAGGCATTT ATCATAACTTTGTGACTATTAGAGACCTCTTTAAAATATTGTTACTGCTA GCTCAATGATAGCCATACCTTTTGTCATTTGGATCGAGCCAACAAATAAT TAGAAAGGAAGGCAAATATTGGATATATAGGTCCTTCTTTGTTCCTTCTA TAGGGGAGGGGTTCTTCGTTTTGCAATTTCTAAATTGCATgataaacaaa taaataaaaaggagtTCCATCGTTGACACGGaatcaaattgaaaaatcgT TTGAATAATTTCTCAAGGTAGCCGATTAATTTTGTGTTTCTCAAAAAAGG AAGTACGTCATTGCAGGGACTGATCACCAAGAACAGACCCAGGTTGTGTT AGTTTAGACAACATAGTGACTATACCGAATGAGTCCGTTGCCTTAAGTGC TCCCCCTTGGAGAAACAACATAATAACAAAATCatcagaataaaaacaaa attatgaGCATAAATGCAAATTCATCAACATAAAGGCATAAAATATTCAG CATAAAacacaaaatattcaaaatattcaacGCCTAGTAGTGAGTGGTCA TCGTTTTTTACTTTCGTGCTGAaggtcagggttcgattcccactcggtgc taCGGTTCACTtagcaagtgaatgtaccttggccCGAGTCAGCctatacc atgtgaggggaatagggtaccatcactctgatacaagagtatggggagcT ATGCCGGGCATTGAATGTGGTGTGATGTTGGTACTAATATGTTCAGTACC TGCGAGAACGCAAGGTTCTCACGTACTGTGCGAGTATCATCATCAATACA GCACGGCTCTAATGTGTCGCAAGCACATAGTATaatgtctggtaagcgct gtgatttccctatcaaggggtaggaaactatcccgggatagggcccggtc cgatgatatcggagggtcTGCTTCTCTTCTCTTCTCTCATTCAACgtgaa agcaaaaatattaacataaaaacaaaatcatcaatgtaaaaacaaaatca tcaacATAAAAGCAAAATCATAAACATGAAAGCAAAATCATTaatgtaaa agcaaaatcatCAACATAAAAGCAAAATCATCAACATGAAAGTAAGCTGA TAACAGATAGTCATGATTTTCTTATTCACTATAAACCTCTGAAGgtgctt gaaaattaaccatctgaaGAGCCACCTTCATAACTTGTTAAGTGCCGTGA TGTCAAAAGGATCTTTTTCTGATGGATACAGTGCTCTTACGCGACGACGT AGTGTAAAAGTCGATGTAAAAGGACCTTGTGTAAAACGGGCCGCAAAGgc tttcaaccgttacgtcagatcgcgccaatggaattgctttatttttcttt tgaccaaaagcgtggaagctttgttcgaaaaagtgcgatcgcagcgcgtg cAAGTGGACACCGGCCTTTAGATTACTCTGTAGACTtcagaaatgactaa aattacTCCAAACCAAAAAGGGTGCAAGCTGACAAATTGGGGTCTTGAGT GCTCCCAAAGATTTGGGAATACCAGGAAATGGAATTAACTCTCCTACACA ACTGATTCTACAGCTTCAGTTGAACTCGTAATCAACACCGATAAATCGAA TGTGTCACCATGAACTGTACTGTTAAGCAACATCTTATGGTTAGTTCTAA AGCAGCTGAAAAGAGTTTACAATTTCTGGTACTTGCGGATCCATGGTTGC AAATAGTCACAAAGACTTCCAAAGTAGGTTTGCGTTCAGTAAACTTGAAA AGATTTTACGCTAAAGCTCCTTCCTATTTTACAGTTGTGAAATTTGGACC ATCTACGAAGAAATATGTTTGGAATCAAAAGTTTGATAGAGTTCCAAATT AAAAGATCTAAAACATCTCCAATGATAACTGTTAGATTGAACCAACCAGA ATCAACTGAAGTTTCTTGGTCACAACTTGTCATTGGACAACAATGAGATG ACAAAAAATCTGTGTGCTCTATCTTCACGGAAAATGGAGAAGCTGTCaat ctttattattattataatgtaaAAAAGTTCTAGACGCACGAGGGCCTCTG GAACTGATCGCGATTATacgtattttacaattgtcttgtgttGAATCTTT TCGGATGTTTACTCCATGCAGTgttgagtctttctttgaagactttgact GTCTTTGCCTCAGCGACATCTTTTGGCAATTTATTCCAGGTTGGtatagt tcgataaaagaagGAATTCGTTTGTACACCACGGATCTTGATTTAGATTA TAAAATAAATCGGCCCAACTGATATTTCTGTGGTTCAAGGCTGAACTGAC TCACCCGCTCTGCTCGGCTTAGgggccactcacatatcgatgtttccaac gactaacgtcaaatcgACGCAAGGGGGTGGGGGATCAGAGGCATTGACGC TAAGAAGCTGATTGAATACTCATTTTTCTAACAGATATGccagatatttt ttttattttgttaactACTCTCGCTACTCATAGTTTACACAAAATATTGG TGTCAAGACGAGACGAGACGAGACGAGACGAGCCAAtcgattttctaaat tttcaagtttGGTTGGTTcgtgtaaaaaaaataatagattacgattttat cgattttcggtgGCTGATGCTGATGCTGAGGGTAGGGGTGGGGGTCTTGG ACGAGGGCCGAGTCTCAGTTATCTTCTTTTTGGACTATGGAAGGCTTTTC CCGTCAAAAGGTGGactttttgaaatcaaatcaaaatgaaaaatcaaatc tttCGAAAGGTTGAAGTTTTACGAAACAGAAGGTTTAAAAGTTCTGTATT CCGCCCTAAAcgatattattttttctttcgtCGTCGGCTTTCGACTGTAG AGCAGATGAGTCAGTTCAGTCTTGAGCCACGGAAATATCAGTTTTATTTT ATAATCTAAATCAAGATTGACAGCTTCTCCATTTTCCGTGAAGATAGAGC GCGTATATTTTTGTAATCTCATTTTTGCCCAGTGAGACATTCAGTTGATG CAATCTGACAGTTATCATGTGAGATGAGATGTAGCTTCAAAGATTTGTTA ATTTGGAGTTCTATCAAGCTTTTGATTCCAAAcataattacacccctgtg tcacagacccactgggacccaagccccactgggaaatttggccgaaattt gtccccggtgggaaaataccttgaAATTCCAGCCCCATTGGgatattaat tttgatttcatccccattagaaattcaaagtttaaaaattgcactccaaa accatccccactggattttttaaccttgaaacaatagaatttctctcccc attgagattttgaTAAgagtttttatccccgctgaggaaaaaagttccac cggggctgtgagacaggggcgtATAATTCATTTTTGTATGAAATGTGTTA ATCTTTGAAGTCATTTCTTCGTAGATAGTCCAAATTTCACAACTGTAAAA TAAGACGGAGCTTTAGCGCAAAATCATTTCCAATTTTTGGAACACAGACC TACTTTGGAAGTCCTTGTGACTATTTGTAACCATGGATCCCAAGTACCAG AAGTTATCGACTCTTTTCAGCTGCCTTAGAACTGACCACAAGATGTTGCT TAACAGTAAGGTTTATGGTGACACATTCGATTTTTCGATGTTGATTACAA GTTCAACTGAAGCTTTAGAATCAGTTGTGGCAGAAGAGTTGTTAAAAGTC CACATCTGTCAGACTCTATTCGTTTTTGTTTTGGAGTAatttcagtaatt tctgaaGTTTGCAAAGTAATGTAAAGTTGAAGATCCACATCTCTTTGAAA TCTCAATATTATTCACTGTTCGTCTTTATGTGAAGTCAACTCAATTTCTC TTAATCTTAATCTTCATAATGATTTTCGAATAACGACCTTGAATCCCGAA TAACAgggaaaaatttatattttatacataggaaatgttgaaaattcaaa ttaaagGCAGTGGGTACCGTGAGTATCAGATTGTATGAATCTTATATAAT GTAACGACATTTTGCGATTTTAATCAGCGAGAACCAGAACAAGAGTGACC ATGGTTGCCATCCCAGATCTTGGATGAAGGCCAGTCAATCGAATCACAAG AAACAAGGGCAAAAAAGCATAGTACAGAGTAACATCTCAGAATATAGCAT GCAGACCTCTCTACTATTACGAGTCAAATAAACTACAAGTGCCTAAtaaa aatcccccccccccccgctggTTAATTTTTCGAGTGTGATTGAGACGTAA AAGTCTTACCGTAGCTCTTCCCACAGGTTAAATTTTAGAGAAAGCTAATC TGTAGTGTTCGCGGTATTTATTGATTGCATCTTTTAATGCTATTGctttg agccaaaaaaatcAGACCAGATTCTAAAAATCGCAGTGTTATTTTCTAAT CGGAAAGAGAGTTATGGGTATTTCTGAAACCATGCTCGCACGTGACGGTT CTGTTACGCTCACTGActtttatataccctggacgaATTTTCTCAATcct ggccaagcaaaatctttgatcggagttttttgtaagtggtaccctaatgg tagcacttctcaatagcggtgaaaatgAATCGAGAGCGCTAGCtctactt ttcctcgaatactttttatgatgaagcgccgcgttagacgttaattttta acattgtaatggcttcttctcgggtaccaattctaaaaaactccaaacaa agatggcggatataatatagctttgtccagggtatataaaggtcagtggt ttcgctacgaaacgaaatgaagccattctattagttagaagtgacgtaaa acttgaatgtAAGCAATAGAATATGGCTTCAAACAAAGACGGCGAAACGG AATCGTAACGTCTGAACAATCTGAGTATCTGCAAAATTAGTAAACGAGAA CGTTGGCGATTTTTGATAGGTTGTTTgtaaagtctgttccaaaaaatttg acactACGCACTATTTTAAATATCACAGGGAAAAAAACATAACTAAAAGT AGTatttcgttggaaagataattttgagcagTTTGATGTAAACTTTGCAG ATttttggtccagcgcgcagcagaatggacctttaaaaagcaactgattg aaaagattttgtctttgtcggggcctgtgcgcgcaataaattaacaagtc caggctaaaccaaccaccgatctagaattttttgttttggaatgaattgg tagtagagtcaaatttcccggttagattattaaagggttgtttcaggtag ggttagggctagggttggggatgggagttaacccctggttagggttttag cccccgggtagagtttggagtaaataccatgtttataaggaaATTTGAAC TCCTGAATacagttgtgactcgatggccgagtggttaaggcgctggcgtt ctaatcataggtgctttgtatatagtgTGTTCGAATCCGACCAtcggcaa aagtttcgaaatttcgggaaatgcttcaaaaatttaaaaacttagcaata caaagaaagtgtcaaagaatagaagctcagagtggaggatgggaaggaaa gttttttgcgtcacttaaggaacccggtacgaacgacattcggttattgc cacgtcagctggaccttcacgccgctccggcttcttgttccttatcaaaa agctttaatattattcttataaaattttaaaccCGCTAAAAAGttgagat attttacaaatttccctttACTATAATTAATTTACGTTGCGAGGTTGTTG GTTTGATCCCAagtcgggtcataccaaagattctcgaAATGGTACCtggt gcctctctgcttgattgTCAGCAACTACAGAGGCGAATCGAGGGTAAGTA GAGAAATCCAGAGAAAGGAATGGAGCACTGAAATACCTTCGGTTGGGCTT CGACTGtagtcgcaaacttacttatgTATCTCGTTTTCTGGAAACTAAAT ACTCGTCGAAAAACGAGTTGATTGATTCAAAAACAATATGGGTGTTTTAA CAGGCTTAACACTCGAAACTGGAAAAAAAATGATGGAAACCATTTTAAGT ATATTCCTCTTTTTATGGATAAACGTAGAAGATTAAATATGTTTTAGTAC CTATACAAGTATTATATACAATTGTCACACGAAATgcaacaaaaaaatac aaatgaaaacaaattttcgattttgaacTTAAAAATATTAACTTCTAAAT ATATACATTTTAGATATGTAGGTTACAATAAAAACGAACGATGCAAGGTG AATATACCTGCCGGTATGTCGAAAAACAGAACAATATGGAGAATTTCCTC TCTGCATTTCaatttgtcaatatattttaaggaagttaaaaagaaaatta ctcGCGATCGTAGATAAAGTAATGACTATAATTCTTAGAGGTAATAATAG AAGTAAATTCGTAAGATTTTAATCTCACGCCCTACAAGTTTTTCAACTCA CCAAAGTTTACCCTTCAGAATCAGAGAGTAGTATATTAGAATTATTggaa ttgaaataaaatctacGTGCATTATACATTAACGCCTTTATCTAAATCTT CACGTTCAATTAAAGTTTGTTTCTCTGGAGATTCATTCGTGGTCTCCTTT TTGCCATCACCGTCTAATAGATTTTCAGAATGTCTTCTCGAAGCTGTCTC GACCATACTGTTGCTTGACCGATCGTTTATCACGAAAGACATACTCGTTA ATTCACTCTCGCGTCTAATAAAAGACTGCGTCagttttttacataatttt gatCTTGAAAGTAGCATTAATGAACTCTTCCTCAAGGATCGAGTGAACAT TAAATAAGTCAATGGATTTAAACATGAAATTACGAACGGTACGAAAGGGA TTAACCAATTTTGAAAACCGGTAATATCCTTGCCAGCTACAATTTCATAA GTATTACACGTCATGAAATAACCCCATCCGCAAACAAAAGGAACTGTCAT TATTGCCACGTTAAAAGCGATCTTGATTTCTCGAAACCTTGCTGGTCTCA TTGATGCAACTTTTTCCAGATTCTCTTGATCCATTGTGGATATAACGACA ATAACTTTGCtgattttcttttccattttcatATTCTTTAACGCTGATAC CAGAATAAAACCATAGGAGACAAGTACTAATATACAAGGGATGAAAAAGC TCAATGTAGCAGCGATGAAGAAAAACACTGAATTGTAGACGTCGCTGACA ACCGGTATCCGTAATAAACCCATTACGAGGAGCACCAAACAATAAACCCA GATTCCAATAATAGTACGGTTTGCTGTCCGATCATTAAGGTACCTTGGAT ATCTCAAAGGCATTGATACAGCTATGCCTCTTTCCATAGTTACTGCTGTT ACATGTNCATAGATATGACAACGATAACTTTGCtgattttcttttccatt ttcatATTCTTTAACGCGGATACCAGTATAAAACCGTAAGAGACAAGCAC TAATATACAAGGGATGAAAAAGCTCAATGTAGCAGCGATGAAGAAAAACA CTGAATTGTAGACGTCGCTGACAATCGGTATTCGTAATAAACCCATGACG AGGAGCACCAAACAATAAATCCAGATTCCAACAATGGTACGATTCGCTGT TCGTTCATTAAGGTACCTTGGATATCTCAAAGGCATTGATACAGCTATGC CTCTTTCCATAGTCACTGCTGTTACATGTAGCAACGAAGCTGAACCAATA ACGACATCGATTGTTGGAAAGAAAAAGCTTTGAACTCGTGGGCTCGCCTC TGACATTGCACCAGACGTATACATGGTCACAAATAGTAGCATCTGAAAGA TAACCAGAAGATCAGAAACAGCCAGATTGCAGATGAAGTAACCAGTGGTA TTGCGAAGATGTTTGATTTTGTATACGGTCATAAGGATCAAAACGTTAGC AAAGAAGCCGATCGGTGAAAGCAAGGATAGAATGATGAATGTCAATAGTC GCCATGCTGGATTTAAAACGGAAGAATTATTTGTTGAAGAATTTAAACAG ATCTCTTGGTAGAGAGCTTCTTCTTGTTGGTTTCGATTATGGTGCATATA ATTACACACGTCACTAATCAATTGTTCTGGGTGCGTCTCATTATTTATAT TTACAGTCTTATTGAGGATCATAAAGGGTATCGGGTCACAGCAATGATCG TAAAAGATTCTCTCCTCGAATGTCACCATAGATGCATTAATACTGTCAAT TATACCACAAATATTTGGCAAGATGACATGAATCAAATCTGCAGACACTG TTCCGGAAGGTTGTACCATTTTCATGATATCATTACATGAAGTCACGTTC ATTTTAACAATAGTTGGGATGTAAGGCTTCCCAATGCCCTTCTTGTTCTA CTGATGTCGATCGAATGAATGTACTCGCAGTAGATCAcgtctttttgttc aatttgtcTTATCTTCGCTCACACCACTCAACTTTTCGTTAACGTTGATA GTGGACTTTCTGTTGTCTTTGATATCTGATGTCCCTTTGAAGATGACTAT CTATATGCCTTGCTTTTCTGTTTTTCCTACAACGAAAGTACGATAACGGT ACATtagagaaaaaggaaaaagttaGGGAGCTAGATAACAAGTATAAAAT TCATCCTATTTCGTCTCTTTGAAGGCTGATCGTGTATCTTTCTGTATTGT AGGTATGGATTAGTCAATTAACCGTCCCACAGGGAATATATGCGACCATT TTATattgatttggaaaaaatatactGAAGTGTCGTTACTATACAGCCAA GCTGTTCTGATGATGCTTTTCCAGTAAGTATTTTCCATACCCTCAGAATT AAGATTTAAGATTGTTGCGGTCATTTCATTGCAAAAGAATCAGTGGAGCT AAAATTTCTGTTTCTATTGTGATAACGGAGGTTTAACCGTGGCTAAAATT GTTAGTTGGGATAAAACATCCCTCGTCTCAAGATTTAAGTTCGATAATTC TTTATCTGGTGTTTTTGAAGGTGTTTTATTAAAAATGAAGCATCTATGCA CAGAGAAGACTTTATTCATCAAGCATTTAATCTTCAACCGAATTTTTCGA tgtctattttcaaaaaagaattctttAGCTTGGATTATCATGTTTCCATA GAAACTTTCTTAAAATAGTAACTTCTTTGTCTGATAACCTCTAAATAGGT CGTCAGCTAGTCAGTGAGTGTGGGATCTTTATTAAATTAGATTTGCGGAA AAGTGATAAATCGTTTCTATTCATTGGAGAACTATGATGAGTATATATTA AGTAAAAGCGAAGGTTGTCCAAGATTAAAAAATCAATCTGTTTTGATTTA TCGTTTACGTAATATTTAATTCAGTTAGGTGATCTCAGTTATTTCTAGAA CCATGAAAATTCTTCTGTCATAGCAAATTGATCAAAAATCTATTGAAAAT TAACTATAACCAACCTGACAACCTTTGCGAACAGCACTATACTAATACCA GCTATACTCATGTAAGTGATTAACTCGCTGCTGATCTTTTACAATTAACA TTTTTGcacacaaaaatatattttcaagaaCAAACTAGATATCCTAACAA ATCATTTAAATGAAGCTCACGAATGTTTTGGTGGGGCTATTGATGTCGAC CCATAAATTACTTCCCGTAAATTgcatatattttgattttgtggtCTCTT TAGCTACGGGAAattgctttttgttttgaaaaagaaacaattaaatatgG AAGAGTTCTGATTGTTAGCTGACAATGCAAGGAAGTCCAAACGACTTTTG AGTGGAAAAAGGTGGTGCTTACAGTTACAATCAGGCTTTAAAATGAGGTC CTCATCAATTTGCAAAACTCTATGGTCAACCACTAAACGGACCGTTAAAT TATCGATTCAAAGgtctttttaaagctattgttAACTTATGAAATTCTTT TGGAATTTTCTTATGATCTCGAGCTTATGATTGAAAACAAACTTTCATCC TTCTTCACACGGAAGTAGTTATCCCTCAAAACCACTAATTATCTTCGAAA ACATGGCCCGTATTTCGACTCTCTTGTAGTTGGAGGCTCATTCTGTTTTT GTTGACGagtcaaattgaaattaaagGCTTGCAAAAAACTGACAGTCCGT AATCTTATCAAACGCAATGCGAAAGGCAATTGTGAATTCCAGAAATGTTA TTTCCTCCTTTTCCAAAGTAATTAATCTTGTTCGGATTTTGAGCGTaact tctatttttcaaaaagaagacATGCAGAACACAAAAGTATATAAATATGT GTTTTCCCTTTgtgaaacaatagaaattctaATTAATATAAGAGTAAAAT ACTTTTGTTTGACTTCTCGCcgaattgaaaacatttttgagacCTGGAAT TGATAAGTTCTCTTTCAAGGCAATAAAATTGTCGCCTAAAGCGTTTATTA TTTAGTTTGAGTTGTCCGAAGATAAGTAGCTCAATGTTTGACTCGTGTCC TTTGACCCACTGCATTATTTTACGCGTTCCAAGCATTAAATGGATTAAAA ACTGATCAATTAAAGCAgcttttcttgttgttttcttttaattctcaaat aaatatgatatttttctatacTATCAGCCAAAAATTTACACGGATAATAA TATTTTACAAAGATAAATGGtcgttttaaacatgttttCTATTTACATCT CCCGTAGCTATATTGCTCTAAATCTTTTTATATacgttgaaaaaaaatat tttacattctAAATTTTGGTTCGTGTTCCTATTTCAAATTTACGTCCCTT TGGATTTGAAAtatttgtcatttttaattcCGTTTTAATGTGTTTGTTCC ATTACTTCTGAATGTTTACAAgaattataattgtttttattatctACTTA ATTAGTGTCCCTGCTATGACCTGTTGCTTCTTCTTTTGTCAATACACTCA ATACAATCCCTCCTACCATCGGATAAAGCTTTAGTAGTCAAAAGCTTAAT CGTTATGATGGGATCTAGCTTAAGCTTAGACCTCCCTTTGCATCATACGA GCGTCGGACGAGTCTGAGTGTCTGCTACTATTACGTGAGGTAAAAATGAG CGATGTCGATGAGAAGCGTCGATGGTGTAGTGAGCGGAACTTACTGAATG GTTTCAGTACCAATTTAATAGCTTCCTTTCGTAAAGTCTTTGTGAATAGT AGATATGTGATTGGGTTTAAACATGAGATAAGATAAGGTAACATGTTGAG GAACCAATTTTTTAATCCATCCAATGTAGTCTTTGTTACTTCCTCATAAA CATTACAGATCATGAAATATCCCCAACCGAAAACAAACGGTGCTGTCATA ATGGTCAAATTGAGAGCCAGCTTTAATTCGCGTATCTGATGATGATATCT CGGCGCTCTCCTTTGAGTATCATTCAGCATGGAAACAATAATTAATGATC GTTCAATTCTTTTCTCCATCTGTAAATTCCGTAAGGCTCTGATTGAGATG TTCAGATAAGAAATTAATACCAATATGCACGGTACACCGAAGCTTAAACA AACTGCTATGTAAAATATGATTGAATTGTAGATAATTGGTTTAACGAATA CTCTAGCAACACAAGCNAGCTAGCTTTAATTCGCGTATCTGATGATGATA TCTCGGCGCTCTCCTTTGAGTATCATTCAGCATGGAAACAATAATTAATG ATCGTTCAATTCTTTTCTCCATCTGTAAATTCCGTAAGGCTCTGATTGAG ATGTTCAGATAAGAAATTAATACCAATATGCACGGTACACCGAAGCTTAA ACAAACTGCTATGTAAAATATGATTGAATTGTAGATAATTGGTTTGACGA ATACTCTAGCAACACAAGCGATAAATAAAACGATGCAATAAACCCATATA AGTAGAATCACCTTCTTGGCTCGTTCTTTGCACAATATCAACGGGTACAC CATGGGTTTTGCAACAGCTATGGCTCTTTCCACACTAGCAGCTGTCACGT GTAGCAATGAAGCTGAACCGATAAAAACATCTAATGATGAGAATatcatc aaaatattaaaattttgtttcagTTCAATTTGTGAATGGGCTATCACGTA TGCCATCATAGATAAGATACATAACAGATCGGCGATGGCGAGGTGACAAA TGAAGAACCCAGTAGTTGTTCTGAGTTTCTTAGCTCGCAACACTGTCATT ATAATCAATAAGTTTGCCATTAAACCAATCGGTGTCAGAAGTGACATTAT TACATACGTTGCTGGTGTTATCGTAAACGGTTCCGGGGGCATGTAATATG GTTCAAATTCTCTACAAATGTTATTTTCAACATCCACTGTCAAATTCTGT GAATGACAAATCATGTATAGCGTTTTACGCATAGAGCTATCGTCCTGAAC CGAAACTGGCGTGCGATCAACACAACAAACTTGTTCGAAAAATTCCAATG TTGTATCGTTTTGTGTTTGAGTAGTGTCTGTTGTAACGGAGCAGAAATAA TCAAATACGTCTGGTGTAAAGTCTGGGAACATCTCTTCACATGTCATGTC ATGAGGGAATGTAAAGTTGCCGTCCACGTTGTCTAACATTTCTGTAGTAA AATCTGTCACGACTCTTCAGTACTCCTTTTACCTAATAATGACACCAGCA ATAacctagaaagaaaaaaagaagttatTTTTAACATTCATGTTTAAGGG TCTATAAGTTGAAAGGCAAGGGTAATATAAacctaaaatatttgtttagc tCTATTTAAATCACACAAGTTTTGTTTTCCTGAGTGATGAGTTCCCACTA AATTTGGTCTCTTTTGTGTTGTAATGATTGATGATTGCCCTCGCTCAATA TCTAAGTTTTCCTACTATGAGATCCTAAATAAGTTGAGTAAACTTAGTTA GGGTAAACAAGAAAGaaggagaaaaacaacaaactgGATCATGAAATAAA GTACGTTTTTTAATTCAAGTCCCTTCCCTATTTCGTCATTACTTCATTAT TTGAATCTCAATGTTGAATTTGAAGATTAAGTTTAAGTATTCGCTGCTAA ATGAAGGGAAAAAATCTAAAGTGTTGGTCTCTCTTGAACATTTTGTAGAC AGAAGTACTAACTGAGTCGTTtacaaataaacaaaatgtttttgctcTAT CAATAAAACGGAGTCTCCGTCTATAAATtacatttttggactttttattC AGAATTATAAATTGGCTTGATAGAAATAATTTAGAACCTTGAAATAAGTA TATTAGAATTGTGTATGTATAAAAGGAACTGAAGGGCGAGCTTGGGCAAT CAATAAAATCGTTTTACtttaatataaaaaatcttcatttttcggTAAAA ACTCATCATTCAGGAAAAGAAAATGCTTTATCTAAGAAGAATAAATGACT TTCGGAAGATGTAGGATTAAGGTTGAAGAAGAACATGAGGAACTTACCTT GNGTTTTACCTAATAATGACACCAGCAATAacctagaaagaaaaaaagaa gttatTTTTAACATTCATGTTTAAGGATCTATAAGTTGAAAGGCAAGGGT AATATAAacctaaaatatttgtttagctCTATTTAAATCACACAAGTTTT GTTTTCCTGAGTGATGAGTTCCCACTAAATTTGGTCTCTTTTGTGTTGTA ATGATTGATGATTGCCCTCGCTCAATATCTAAGTTTTCCTACTATGAGAT CCTAAATAAGTTGAGTAAACTTAGTTAGGGTAAACAAGAAAGaaggagaa aaacaacaaactgGATCATGAAATAAAGTACGTTTTTTAATTCAAGTCCC TTCCCTATTTCGTCATTACTTCATTATTTGAATCTCAATGTTGAATTTGA AGATTAAGTTTAAGTATTCGCTGCTAAATGAAGGGAAAAAATCTAAAGTG TTGGTCTCTCTTGAACATTTTGTAGACAGAAGTACTAACTGAGTCGTTta caaataaacaaaatgtttttgctcTATCAATAAAACGGAGTCTCCGTCTA TAAATtacatttttggactttttattCAGAATTATAAATTGGCTTGATAG AAATAATTTAGAACCTTGAAATAAGTATATTAGAATTGTGTATGTATAAA AGGAACTGAAGGGCGAGCTTGGGCAATCAATAAAATCGTTTTACtttaat ataaaaaatcttcatttttcggTAAAAACTCATCATTCAGGAAAAGAAAA TGCTTTATCTAAGAAGAATAAATGACTTTCGGAAGATGTAGGATTAAGGT TGAAGAAGAACATGAGGAACTTACCTTGTAGTAGTAGTGGAATCTTCTTG TTGAGAGCAGGAAAGCACAATATCATTCAAAAATGCTCCTATAATCGCGC TCAAAGTCTTCACGCGTCGCATTTTTTAACATTTACATTTCCTTACGGAC TTTCAAAATCCGTCCTGTTCATATGGCAGTATTTAAAAAGTGCTGTATGT CCCTTAATCAGTAAATTGTTTGGGACCCTCatacaacaaaaaaaaagttt atccatttattgtaaaaagaaatattattttagtTATAATTCATTAGAGC AATTAGTAAAGAAAAAGTTCAGCTCATTCAATTATTCTTGCGTCAATACA AAAgataataaaaagtaattagAAGCGGATTACAGCCATTCTATTTGTCT CCTTCTAATTAAGAAAGAGAATCAACCAGCCAATCAGCAACCTTGAAATG ATGTAGGCAGGTTAAGAGATacttgttctttttttgtttctaaagCATCG TCGTAAAGacttctttttattttccttaAACTTGAAATTCAGGTTGCCTA GCGTAACAATTTTCAACCGGATTAAGCGAAAAATGTGATCAATTTTCACG TTGTGACGTTGTTCTTNAGGTTGCCTAGCGTAACAATTTTCAACCGGATT AAGCGAAAAATGTGATTAATTTTCACGTTGTGACGTTGTTCTTTATTCAA GTAGACTTTAAACTTTATGTGCAAGATATTTGAAGACTAAATCAACTAAC TTGCAGATATTACgaaagaaaatcatttaattcttataaaaagttgtACA TAAAAAATGTTGCGTTTTGAACAAGGTAGTAATAACGTGATATTCCAAGA TAACTGATCAAAACAAAAGACCAATTAAAGATATGCTATTTTTGtacacg aaaaaaaaaacattttaaagacttCCTTTGATCTTGTGGAGTTCTTGACT ACTTTAAGCACTGAAATGATAGATTGATTCATTTGAAACGAATTAGCAAG TCTTTGAATAAAGTGTGAAATTCTAATCCGTTCATATTCATGGTATTTTA GTTTGATGCTTTATTTATCCCAAACCTAAGGTTTTAGTGGAACTTTAAAA TCAGGGGTgattaaaattttctcattgtGGCATTTCTATTCTAattattt ctttgtttctaGCACTTCTGTTGTAACTTTTGAACACTCATTTCTATTCT GTTGTGATCAAGTAATTGTAAGAGGCTATTATGCATTTcctgtttttcaa tttcttttgttcttagAGTTTCCGACTTACTTAGATTCTATGGTAACATt tactatttttaaaaatagttgAAATGATAAAATCTGCTATTTTCAACTTT ACAGCAAAAAAGAAACACTTGTCAATTATTTCCATTGAAATTACTAGTGT TGTGTATTACAAACACATCACAAAGACTCGATGACTAACAAATAGCTTAC ATTTGAATACAAATATGAGTTACTTCAAATTAGTGTCACACTTACGAAAC CGTTTCTGAGTAAAGCCATAATCTTCAATTTCAGATATAAAACAATCACC AGACGATTGAAAAATTCCAAATATTCCTATtgtaaatcaaaaagaaaatt tctttcttttacaATTGACTGTCATTTCTATTTCAAGACATATCCAATAA AGTTGAGGTGCGAATTACAAATAGCATGTTTTATTATGACTTCCCAAGGG TCGATGAGAGAGAAGGTGAGAAGAGTTGTAAACTCGAGTTATTTGCTGAT CCCTTCCGATTGGAAATTCTATCTCAAATAATGATAAAGTAAATAGATTT ATTGGTCTACAACTGCTGACTCGTAAAAACTTTTGAACACTGAGATTTAG ATATTTATCACACTGATGTCAAAATACTACTAATGGTCAAGACATTATCT TACAGCCCTATGAAGAAGATAAAAAGCTCTCAAAGACAAAAGTATCGGTA CCCTCTTTAGTCATATAATTTTAGTATAATACTGTAACTTTATTGTGACA AACACGATAATTATAACAAGCCCTTGTTGAgacaaatatatcttttatat tcTAATTATAGTACAACAGATGATTGCCATTTCCCAAAATAATATCAGTC cttttttaatttagaaattGATCTTCATTTAATAGCATACAGTGTCATCG AAATTTCAGTATTAATCCTTTGAAATTGTCTCTGCCTGTCAAATTAAACT ACAATTCAATCACATCATTCAAGAAGAAACTTCAATAATTAAAacatcat taaaatgaagaaaacaagAGTGAAATCAAAAGAATATACCATGAAACATT ATAGCAGAAAATGTTTCATCTTATAGGAAATCTAATATTTCCGATAAAAG TATGATAACAATGAAAGAATAATGCCAAGCTTTCTTAAAAACTGTGAAAA AGATTTAGTAATATtatcacagaaaaaaagaaatcacaataCTTTTAACT TGGAAATCTTCAAAAACGTCATAATTCCGAAGACGGCAACTTTACAAATG ATTCTGAAATGTATCATCAATTGATCAACATTTTATCTTTCctcaaaaat gaagatttacctgATGAAAAGTGCACTTACTTGCCAAAAACTTAATGAAA AACtcaaactttaaaagaaaaacatattcaaaCGGCCATCCGTTCCACTC CAcaacaaacagaaaaattaagaaactgttccaaaacctttttttttcac GTAATTGCTCTGTAATTATTGTCCATTTTTAATTGCAAGTATTAATTACA CCATTAAAATTTCAGTTAACAATAGAAATGTAGCTTTAATGACATGCGTT AATTACCAGTGTATCCAAAAATAATAGATTTTTTTCAGTCTTTCAAAACA TGAAGGTCATTTATTCATCACACCACATTCTTCAAAATCTTCTGAAATTT TCTAATCATCTGAAATATTTACATTTATACACTAATTATGGTATACTTAT TACTGCTGTTCCTATATGCTTTTGTTCTTTTTAAACTGtgattttcctta tatttcttcCTTTGTTGGTACGTGCCCCAAATCATTTCCAacgtttttct aatttttgctCAAAGTGGCTATATGTTCctgtttttttgataaattcgTT TTTCACTACcccattttgaaaaacttaaaacttgaaagaatcgacaacaa aagaagtatttataaaattttacaaattattcAAAGTTCTACTCCACTTT TAACGAGTGATGAAGTTTACCATTTGCGCATTAAAACGAGGTAAAATGAA AACTCTACTCTTTTGTTTTACAGGATGCACCTGATTAGAAATGATTAACA TTATACAAAAAAGGATATCGTTAAcaatgtgacgtcataaaagtcaaTAT CAGTTTTCGTAGCACTTTTTGCAATGCTACGGCTGTGATACCCTAAGAAA TATATTAGTACTTTCACTTGGTACCAGAGCTTCGATAATTTAATGGTATT GGAATGATACTTCCTCTAAAACCCTCAAACCATATTCCCTTTTACTTGTt ttgaattctgaaaatgatttatcGTGACTTTAATTTGGACAATATGCCAA TTTGTCCACAATTTTGATCTTAATCTATTATAAGAACCAAAGACCATAAG AATCGAAAATAGCATAAGTNAGAATCAAAAATGAAGAGCAAAGATTACCT TATTGTAATGTCAGActgtggctgcgtttagaccagcctggcatttgtaa ttgcttgcagtattcttttgaattctattgttccgcgtaATTGTTCGGTT tatcaaatgcctaatgatgccagcgtgttggcatttcgttggcatttgaa atgccattttgagcaaaggaatccccttttctggcattNCTTACAAGAGA TGTGTCcaaatttctcgaaaattagcttgacgtcaaaaattttttagTTT CCTTAACTTCAACCTAGAGAAGAATTTGAGCATGTAATCAAAGGAagatt aataacaaaaaaatgacCGGTAAATAAAAGGAGGTCGGTACCTGTAAGGC TTAATGAACTTATGCCTCAACACTATCAACTGCAGGAAAATCAGTGTAGG CGTTGAAGGAATTAGAAATATTTCTAATCTTAtaccaaaatatcaaaaat catatTTGCGGTGCAAAGGAAGCATGGAGTTATAAATCTAATTTTTAAAT TGAGGACAATTTACTTTCATAATTTTCCGCACCTCACAAAGGCTTATAAA GAGGGCAATATATTAATCTTCCTCCAAACTAGAACTtttataccctgagt atcagaggtcaagttttcaaagaatatattgacctctgaagaccaataat agaaattttatcgcgaaAGTGCCAACCTAAtcactgtacacgtttttttt ttataagaacaaactatataagaacatgaggcttcgagcctaaaaattta agaacattctaagaacatactaaggctttggagacttaaaaacatgcaat ttcttaagaaattagatcaaaatgctcaaaaaatgctgaaNgtaaagacg attccttaaatgccatgacagaaaatacaatgggaaagctattaaaatcg aatccctcatgagcaaatgccaaattacaaatgccagttggtctaaacgc agcctgtatcagtatgcagtttactatttacgaattacccagaaacctcc aagtgtaattgaagtaagtttctttcgaaagaaatcttttacatgatccc caaatgtataacagtaattactaaactattaattatggaaatgtcacttt aattgaatcgaaataatagacagactttatgttgtgattctctatcactg actttttttaaaaagcattgatgtattttttagttgtgttttcaacgacg ggaataaaaatatcaactttgaacttcatccaagatcttggatggtcgtc atggttacttttgtcttcgttgattgcgcgctgaatagaatctcgatttg tcggcacagcgtcaacgGTAGAACTTTTAACAACTTAAAAATCTGGATTA TTTTTAACCATATTCTAACTTCATACTCGTATCAATCACTCATATTTCTG TATTTGACCAAAGATAAACTCTCTCTAATACTCCTTCATACTGCACTAGT AGAAAAAtccaaattattaaaaatttcaacATAACAAGAACCGGCAAGAA CCGTTCAAACGTTGATGCTAAAAAATTGCAAAGACATCTAGTCAAGCTTT CAAGATCCACGGTTATATAGCTGCAAAAATTAGTCTAAGTCATGTACTTT AAAGTAAACATTTATTTGAATTTGTTTATTGCATTGACATTTCGAATTAG ATTGACAAATTTACACACGAGTATTAAAGACAAAATGACACGCAGACATT TACTATCAAAATACTATATTTTAGCACTCAATGGTTCTCTTTCAATACTA CTCTTAGGTCCTGAATAAATGTCCCCATCCATTTATTAATTttagaaatt ctttttgtattgctctaaatagcctattCTTAGCTTAcaattaccttatt ttggggtttttgAAGGTACAATTTTGAACCCCCTTTTATTCGGACCCCGT ACTATTCGAGACCTTAGAGTACCTAGCTAAACTTTCTTCATTTATAAACG ATTCTTTCGGCTACCTATAATTTCACTGGACCGAAAAAATAAATTGCATT TGAAGTTGAATTTCAGTTTCCCACAGTACTAAACGAGTTAAACCAACAGC TAAATCTTTCTcggtaaatttcaaaataaccaACATACCACATGAGAACA GGTAGTAACAAACTCTTCCATGCCATGCATGTGCAGGGCGTGACAAAGAC TACACAACACTGTTGACACATTGTGCGGCGCGAAAATACGACTTTAAAGC AAATATACTGAAGTCGTTAAAAATTCTTGATGACCATGTCAAGAAGGATG CACTGTATTCAATATTACCTATTACCTTTTGTTCGTTATAATTATAAAGA TATTCTAAATATTTACTCGCCGCAATCTAAACTTTTTGTCAATCTActct aaaaaagacaaaattacacattttcctttgtttttcaCGCAATATGCTTT GATGACGGAAATAATTAATACAGTTcggtttcttttgaaaaatcaacttt cGAGTCAACCTTCATTATCATTAAGGAATTGATAGAATTCCCCTCTTTCT TTGTTATTGCCTCAAGTacctttatttcttcttttctttatcATTTTGTT GGATTAAGACTCATTTTAAACTTCTgtatcagtttacttgaaactaatga aaatgtacaaaaaattgGTTTCTATCAGACAAATTCTGACCATGACCCGC AAGGGCAAATCGATCCCCTGGACATGAACATGTTTatcacaattttttaa ataatgtaaCCTTGGAAAATATACGTacggtttttcctggaaaagccCAC TCCACGGAGGAAAATTTCTTGGAAACAGATGGAAAGTTTTAGATATATCA ACCTtgataaatctttaaaactttctaaaaGTTATACGTCTGGAGAGATA TTTATGGAAATCTTTCCTAAAGATTGCCAAGATACTGTTTTTAAACAACT TCCGAATAAATTTCCCACGTGATGTCTGACTTCTTATCTGTATTAAAATA TCCAATTTCGTGTTGAAATATCCAATCTCAAGAAAAGTCACTTTACCATA GGCTacttcacagtcgcaaagcgtaatgggtaatcaggaccactgcgcgc caataacgacttactattggtcgaatgttttgaagaattttgaagatttt tgcccCTAAACAACGGGAAACCGTTATCGGGgtgcaatcagtcctgatta cccatgatccatttcgactgtgaaatagcCTATTGAACACAAATTCGTGC TAAATACAAAATGGCACCCCTTTACGGGCCCTTATTTACTCAACGAATAG TTTTGCCCTGTTTGAGAAATCCCCATAGATATCAATAATCATGCAATCGA TTTTGGgccctaaatgacgtcatcgaaaggtcAATAAATTGCttacttca ctgaaatcaatttgtcatttacccaaaagattctctcgatgatttccgat ccaatgaggggtcaaccattgctTAATTCTTTCTCAAACTCAAGATATCg aatttttcaggttttgatgacgtcatcggacccaaaatgcctcaatttga atatatttatttttgaaaatttctatatACCCACTGTTacccctcccatc ttattccccatagtattctcgatccaatgaggggtcaacgacctcccaac tccttctcaaactcgagatatcgcattttgaagtttttcccaaatctgta ACGTCATtcggtccctttacccctaattttgtcaacggtcaattcgcgaa ttttggaatttttgcggtcaacaggtaccttgTAAAATAAAACGAATTAC CTTGATTACCTTGTGCCCCAAGGGTaccaaaattccaaaaaacgtcaatt atttccacgggaaagtggatttttaaatttgcgaaagtgaTAGACGGAGA TAATCTCTTAATGCTTGGCTAGCGTTACAGAAATTCTATAAATATAAGAT AAACATGCAATCGATTCTTTTCCCACttggaaaaaatactaaaaacttcc aaaatgttCTGGGTTCGTGCTCATACCTCAATTATAGCTCCTTTATTAAC CATATTATATCACCACTGAATAAAAATCGTACGCATCGGGACAGGGGTCT TTATTCCTTCGTACAGAAGTCAAACTTCCATGTTGTCACTATCATCAAAG AGCCTCTCTATCTGAGGGTATACACCTTTTCGGCCGTAGTCGCGCAGTCA AGCGcttgccactttattatttaattatccccctaaactcgatccaatcc tttttacacctttttctattgtctctATGTGAAAAAAAGAGctcgcgcgg caattggcggctacggccgaaaaggtgtattgccatCGTAGGAGTGACAA AACTTCAAGTGAGTACAGATATATGTACTAAACGAATGCAATATGTCGCT TATATATGCGGACTCAGATGGCAagacaaaaatcttgaaaagacTCTTTG AAAGAGAGAATAACaacaatagatttttttttcggacagaGGATGACGGT TTTTCTGCAtgaatgataaaatttgaaaaacaaagaaataactATTTCTT CTTTATTTGTCGAATTTTTCTCGATTCTAATTTTCTTGgtctatattttt ttattgtataacTTAAggttttttaaagtattttacccctttttttcctt tttagttACCTCCTCCTAGAAACTGTCAATGTGTTACTTTGAATTAAATA CGTTTCTCTGATAATGCAACTAAGAATTTGATTAAggcaaattagttttc aagtaATGGTCTCTGAAAGGTACAAActtgcaatttttcaatttattctg TTTGAAAATATTAACCTTGAAATGCTTAAATAAAGCTTGAAGAAAGCCAA AAATcaatttataaatcataataTATATTATTAAGATATTCTCTTAATCT TTGCCCAACAATTTCCCAACGAACATTCTTATATgggtgtttcttataaa aaaNTTGCCCAACAATTTCCAACATTCTTATATgggtgtttcttataaaa aaacgtgcagcagTTTTCGATTACACCTATTTTTCGAAACATATGaccaa tacacttttttttattaagaacaaccaaaatttttgaagctttcgaatgt tcttagctttttcagtttcaagcctaaacatgttcttaacatgttcttat tttctccacttttatgtatttttgtccattttcctaagaaattagctGTG TTTTCGAGTctacgaagccttaaaatgttcttaacttgttcttaatgttT TGGCCATGGAAGCATTATGTTAGTTAtgccttatatagtttgttcttact aaaaaaagtgtaatgccgAGGAGGGCaaataaatctgttttttttattat tgctattattatttttttattacgCGCTTTTTTcacaagaacaattttat aagaacatgaggctagCCAGCCAAAAtctaagaacaatctgagcttTAGA TTTAAAAATTATTAAGTACTGGATTTAACAGATTTTAAcccattttcagt ttttaaatcaAGACACCATATGACTACTTAATAGTTATAAGAAAATCGTA AGAACATATAAGCCTGAAAATTTAGGAGTTTGAAagttaagaacagccca gcctcagccaaaatttacttgTTCTAATAAAATAGCTTGTATTTTAAAAT CATAACGACATAGTCCTATCTGTTTGAAGTGAATAACATTCCGTCAACTG TTTACAACGTATTACCATGGTAACGGCCTTCATTTATTCTGTTTTGGTGG TTTCTAATTTGTGGTAATGAACGAACAATATAGCATCGTTAAGTTAAAAA ACTATTCAAAATGTTTTGCTTAATGACCCTTGATACCAGTCCCTTTAAAC TTGTCATTATTTATGTCGATAATTACACGAGGTATTGGGTTGAGGGAAAA CATCCTTATAAATAAGTCTTCTCGTAATAACATCAAAGTAGGCTAGGAGA CAGAAAGTGTAACACTAGGACAAACTTAGAAAAATGTTACGTTTGTAGAT CACAAAACGTGGAAATGGATATTGAGAATGGCATCATTTTCAGCCTATAG TTTGATTTTATTCAGGTTCAGGACAATACATGATCTTAGTATCTTAATAT GTACCTCGTTTGTAGCCACAGACCTTGTAGGGGTTTCTGGAAAAGTTAAT CATGCAAAATATTTTCCCCGCGGTGAGCAAAAATCCTTTTgggaaactaa actaaactctcatCCCCTATGGAAAAGACACTAAAGCTCTGAAACCTCCA ATGAATTTTATTAAACATAAAAGGTTGGAATCTCCATCCATAACAAACAA GCGATTTTCCGTtccccattttgatttttagctttttcattGAATATACA CTAGCTATTTGCAAAATTTACTTAAATTAGCTGGAAAAAACTTCAACTAC TGGTACAGCTGGTCATTGAAAAGTAGTAGTTTACAGCCCGCGCAATATTA GAacattttgctgaaatttcgtccccgtttggaaaataccctacaattat cccattcgaaatttaatgaaagaaaattaattcaaaaccATTCTCACTGG ATTTTTTTAGCTGGGAActataaaatttatatttctaTTGGGATTTTTGT TACAAATCTTCATTCACTGAGGGAAAAATGTCCACCAGGcctttgagaca ggggtgtagccTTCTGCTTTCATTGCAAGGttcttaattttactttttcc tgcctaaaataaatatttattgaGTAGACAAAACTATTTTACACCCGCCG CAAATTAAATCCGATAGGAAAAAAGTTTTATCTTTTAATTCGATTACCTG GTTATCATTAACtttgaatgcaatttttaacgatgaaattaATCTgatag gaaaaatatttttccattgtCATAcctcttgtatgtaaggtaacTTTAAA TAGAAAATGATTCTTTACGAAAACACGTGCCATATCCTGAAGTCCTAAAA CGATTTCTTCCTATAGCTTTAagctgattttcaaattctaaattattcgt aattttgaaaaagtccacCCATATTTACCCTATAAtggacaaaaaaataa agatttaccttaaaggaagaaattttggcgagaatttaatttggcggatg gaggaaaaaataaatttcggcgggaacttaatttggcggattttggctaa atccgccaaatccgccaaattttctttccgccaaaatttcttcctttaag gtataccATTGGGTCGGTTTTTTGTCCcaatttgctcaaattttgctgct tttttACCCAGGGTTAAAATAAAGTTCAAATTGATTTTACAGTAAAATAT TGTAGGCTCTTGAAACAAGAAATAATATGTTCGAAACATTTTCTTCAGCA AAGAACTCAACATATACAGCTTGTGTAATCACAGGTGGCTTGTCCAATTT CAaaagaatgttttaattttgttaAATAATAGAAATCGAAAGAAATGACG AAAGGTGAATCAAGCAACCAGTGAATTAATGGATCAGTAATAGGTATTAT TATAAAAATGCATCATTAATGATAGTTCCAACTGCATTATCAATTAAGTG GGCTGATTTTAACGAACATGTAATTTGATTTATTTGCTAAAAGTCTTCAC CTTGCTACATagttatttcaaaattaacaatcctttatctttttattcgc atttcgcgatttttgcgaattcgcgaaacttaagggctctgaccatagtc ggaaaattgattttagtatttgaacataaaagttatgttttaggttcttt aacactttcaacaaagaattacctttataaattgctttttaatcaaatcc cttcagagtatttaagaatttaattgcagaaatgacgttatgaactttaa aaagacgttaataatatgttgcatcgccttcttttataaaaagtgctaag ttttaatgggtaattaacctttttgtttcaaaatgtcTTTATACTGTcca caaagaattgaactattttaaattttgcggaaaatttttctaaaaagaag tgtcaaaagttatgactgtttttttaagcaaaatccagttaaaaattgat gaaaaaccactatttcgaagatttcgagacaaagaagtatttacaaaatt tttccgcaaaaatttttattgttcggtaaaaaatacaccatctactgcaa aaaaatgttcaaaatgttttttcttcgccgaaactaagctcttcaaagtt gaaatactcttcctcgcaaaagtcttcattttcttcttcatcaaaatttt tNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNCATTTTTTACCACCAGAGGGACG AAATTTTAGGGCGGCGGTCCCATCGGGTATGTGACCCAGGGTTGTAAAAG GTTACCCAATTTAGTAGAAATTGAAAAGGAAATTCTTTTGTAAGTTAGCA GAGTTAAACTTTTACCCAAATTCACCCAAAAAAACTTACAACAGAGAAGA TTTGAACATTTATCCAAATGGTTTGATGCTAGGTAACAGTAACTCCAAAA GGAAAAGCCTGACAATCGTCAACGGAAATCCCAATGTTTAATTGTattga aaacaagaaagaaaTCGACCGAGCATCATGTACACATCTTTCCTTGTTAT TCTAGAAACCCTGACACCTGAGTTCCTACAGACATATCTATCATAGGTTC TAGAGACCTAATATAATTgtagattttttgaaagaacgCATTCGATACCT TTTATTGATAATCATGAATAAAATCACCCATTTTATCagtaataaatttt gatttattggaaagtgataaaaaaatacCTTATTTAGGTTGTTCAAAACT ATATTTAAATATGTAAAACGTTTTAGATCTTTGGAATTGATAGGACGATT AATTTTGTCAACCGTTTCTTTCCGCCGCTAAGCGCCAACTTTGCCAAGAA TTGCTTTGATGACATTGTGCTTTCCTGCTCTCCAAGCCctaattgttttg aaaagtctgaagaaaataaatgagtaaataaataaaattttatctaACCT GGAGCTAATGTCTTTTGAGAAGTTGCTGCAAAATCAAGATTCCAGTCCAA TTTCCCTCAAAAAAGCAAAATGTCGACGTTGTGTAAAACGGAAAAATCAG ACAGCCACAAAATGCCGACAGTCTGCTGCcattaatgaaaaatgaaaatc aaagtcaGTTTGTTTGTTGCAAGAGGTAAAAAATTAGCACTGTCTTTTAT AATGTCATCATTGAATGATTAATGACCTGTCCTTGCCCTTTCTCGAAAGT TGTTATTGTGTCTCTATTCTCTCTCCTTTTCAAATGAAGGCGCAtacatt agaaaaaaaaaaagaaaatttgccaaactttttgattcttttcaGTTCCA TCTATTATCATCATTAAGTTTTTAATTTCTATAATTAATTACAAGGTATT ACTGTATCCGTTGTCCTTGCTAATCAATGTGGTCAATTTCTAATAGCTAT ACCTCTGCCTTTTTCtaattatgcaaaaaaaaaactggtATGTTGGATTT TGCAacgttaattttcaattttggacgCATTTTTGTACGCAGTGATTTTA AAAGTGGTATGGTATTTTAGAAATTAGAGAAAATTTAACATAATTGCATA CCAACCAGCCTCTTGAAAatcaactgtcaatcatttatacatattcatta tctaatTCGTTAAAATTTTGCGTACCGTTAATTttgcgattttaatttgc agaTCCACCTTCTTTTTTGTGAGTTTCAACCTCTTCATCGGAGACAGAAA TAGTGTATGAAATATCTCCTAGACCTTACCTTCAAAAAACTTCATTTAAT TGAAACTACCTTTactgtttctttatttaaaGTCCGTAATTTTAAACCAA GTAAACAATTGCAATAGTCTCGGTCATATTAGTATTACGTATGATAGGTT AAATACATAGTTAACAGGAAGCTTTACCCATGAATCTAGACCTCGAATTT ATTCAAGTTTGAACTACAAAtgatatatgaaaaaaatacttgaccgtaaa ttttgaaaaagtggaaGATTTGAAGATGAGGTAATTAGATATGTCATGAC TGTAAATGACATGGATTTTGATAATCTCCTCCCACATAAAGGCGAAATCA TGAAGAACGATTGATTACTGGGAAACACCCCCAATAACGAGTTTGATTAG TGTATTTAGTGCTAACGTTTGGAACTGAAACGTTCAAATTTGTTCCAAAC TTTGATCAGAAAGTTCAAGTTTCGTGCTTTTGTAGAGGGGTTATTATTAC ACCATTTTGTCACTTTCCTATGGTGGAAAACTTTCCCCGCTAGAAAGTCT ATCCAAAAACATTTCACGGTGAACAGATACTTTTAAGCTTTTATCTTATT GGATTTTGTGAGCTGAAAATGTTGTATCTCgtaatttaaattttgatggc aATATTAATCGCTATTtcgtgaaaaagtgaaaaatacacTAAAGTAGGAG TCTAATATTTTGGGtttcgttttcattttcacCCCTTTTCACTAAACAAG ACGGAATGTGagttaaaataaataaaatcaactAAAATCCTGATATTTCA ACatctgtaattttttttggctCTTTTCCAAAATCATTGGAATGCTTAGA CAGCCATAATAGTTCTATCCTAATCCTTGTCGCCTGTCACAAATATTCAA CATCGATTCTAAATTTTGAAGGCCCAAAATAACCCTAAAAGGATTAAATC CTAAAGAGAATAAAGCNGTGTCGCctgtcaaaaatattcaacatcgattc taaattttaaagacCCAAAATAACCCTAAAAGGATTAAATCCTAAAGAGA ATAAAGCTTAAAATTTGCAGGATTTGCGGGAATTTTTTCGCTTTCAGAAC ATGAAACGTCTTAAACGaatgtgaaaatatttttttgtttttaagaaaat gaaaatgtcttACGAATCTGCACTATTTATAGTGCAAACCGCACCAGTGA TTAAGATAAAAACCAATACGTGAGCGAATGAGTGATGTATAGGTAACATC AAAAGAATTGCTAACCAACCAATAACTAATAGTTCAACAAACCACCAAAA ATGACCAATACAATCAACTTTTGAACCTCTTTCATCAACAGCTTCGTTCT TTCACAAGGAACTAGAATCccgttaaatattttcaaatacagCTTGACTA AAATTAAACCTAAACTATTAAGGTAAGGCTTGACCGTTGTCACGGCCTGT TGTTGGGAGCCCATACCAATGAAAAATGTGTTATATTGCTCCTATAgaga aaaaataaacttaatGTTAATGTCATCCCGATTGTTAAAACTACATTGGG TTGATATTTTCAACTACATTAGCAAACAAAGTTCATCTAAAGAATGAAAT CCGAATTTCGGACTACAAAAATCAAGAGAATAAATTCCATCCTAATTGGT ACTAGACTCATGCAAGCCACTACTCTGATGCCACAAGACAAAGATGTACC TTCGTTTTTAAGCACAGCGTTGGACCAAAAAAACTGCTAGAGATGTACCA CTAGAACACGATAGAAATAATGATATTCAATTCGTTGTTGCGCAAAATGA AACGTAAAACTTAAGGTTTTCAAGTTTCACGCCTGTAACTTTCACTCTAC TCTTTCTCAATGGGATACATATAGTAACTTGAGGAAGCTTGATTAAAGAA TACCTGATTGCCCATAATATTGCTGTTgtaaattctttgaaaattgaaaa ttattcttCTTCTCTTTCTCCATATCTCCATGCCATGCACGTTAGAAGCG AACTAATAGAAAAACAAGTATCTATTTTCCTTTTTGATGTGTTTGCGATG TCTCGTCAGTAGGTTTGTCGCCATCTAACCTTCGACATGGTGCCCCGGAA GGAAAAAGGGGGTGAAAGATATTTATAATGATATTAGACTCTTTCTGTTT TGTGCACGCTCATCACCATAAAACAGGAATTGCAATATCTCATTATTGtt gtgaaaaacaaaattttcccccTTAAAAACATCATTAGGGTCATTAGGGC TTATTTGTTACTTTCGTATACTGTATCAATAAAAAAACTGAAGCTGTCAA TATCAAAGATTTaggaaatgaaaacaaatataTTGCTTTTACAAAAAGGT GTTAGTTGCCTTTTTTTTCCGATGataatttgttttccttttagGACTGG GTTGTTTTTTTGGTATAAGAACTTGTTATAGGAAACTCAAACATTTTTGC TCCCTTCTACCTTTCTAGCAGTTTCAAATcggtaaattttgaaaaatact ttaatgTTTATCGATGCCTGCACTCCTATTCGACGTAGAGATtgttaaat tttaattaattcgaATACAGTAAAACTGCTGACTTCTTTTACCATTCCTA CTTCCTAAATACCTTAAAGATATccttttctaataaagaaatgaaatttg aaaaatataattatattGGAGATGATGATATTGAAATTGTGTCATTGGAA TTTTTTCGATACACCCTCATAGCGGTGTTTTTGATGTCGTGAAGATTACC CTATTAAACATATTGGAGCCTTTCTCTTAATGAGGAGTTCTTGGAGCGAA ACTAATTTGTAGGTCATTAAAGAAATTATGGGTCAGAAAAGTGTTAATCC AACGTTCAGAACATCCGAAGAAAGTTATTCAATATTCTAACGTAACtaaa tccaaaaagaaaaatgcttATATAAGGTAAAAAGGATTCTGTTTATTATT TTAAACACTAGCATGCAAGCAGCTGTCGCATTCATAATCGAGAATCAACA TTTAAAGGCCACATTCCACCAGACCGTTTTTATTGGAGCGACATCCAAAA AGCGCACAGCTAGAGATTTCTATTCGCTGAGCGCTTGTTTCGCTCCTTTC AAACCAATGCGAGAAGCacaatatcaaaaatatttttacgcAAGATAAAA CAttacaaacagaaaaatcaaatgtttttcttctctctgattggctgata aGTAAGAAACGAGGTGTACAGCTTAGCGCACACAGTAAAATATCTTGata tcccttgtttactttgtaggaactaattaccgaaagaaaTATGgcctgtc tatcaagagttattgacttgattctcataaagtagatgcttatgagaaaa ataaacatgctcatattgtgcactgtctcttgtttactttgtaagaacta attaccgaaaggtttatcaccgtctatcaagagttattgaattgattctt ataaagtatatgcttataagaaNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGGAAGCCTT TTTGTAGACTAAGGTTTGTGCCCTCAAATCAATCTTTTTCCATCTACCCA ACTACCCAAATTATGTTGAAAATGAGACACACAGTGATTGAATTGCGCTC AAATTTGGCACATTCACTTCTCAGGGACAGAAATAAagtatataaaaaca tttatttgCAGGGAAAAAGAGGAAGGCTTGACTATAAAGGCGAGAAAACA TTCTTTCCTGCATAAATTTGGCCCATTACCTCTTCGGGTGAAGATTTGTC AGTGTAAATTgtgaaatcttaaattttttatttttcctacttAGAGGGAG TGACTTGTCCTAAATATATGAAAACTTGACAACCTTTTTTTTCTGTGTTC TTGAACAACagaaaatccatcaaaatttatgtttgtgAATTGTAAGCACT TCTTTTATATCTGAAATAATGTAAATTCTTGTAGAACTGCCGACAATTTT TGCTCTATGTGATAAAAACACTTTCCTTAATTTAGCACTACCTCAGTGAA GTCATAAGACGTAAAAAGGGATCTGAAAGcggaaaattgaaacttttaca tGAATTTTGACTCTGAAAGGCTTCAAAACTGTTCTTGGATCAAGaatacc aatttttagagggaatttcaATTGAATTACACGATTTATGAATGAGGCCT AGCCCGTCtatatttcccctttttttacGGACATTGAAACAATTATTTAC GAAATAATGAATTTACTTTGGGAAATATTCTCAGGATTCGTCAAGATAGA TAACTGAGGGTAAGTATGCAAAACTTTAGggcaaaaatataattccaaag ttTTCTAGAGCTACCCAAtcctttttgccctttttgacgCCCTAAAACGT ccgataatgaaaatttttaaataatactgacaaaatgttattattgttat tcaAGGAGGACTTGTACCAAATTGCAGCaaaattgaatgatttttaagGT TTCCAGGTCAAATTGGGGATTTTTTTGTCTTACTTTATATGAGCCTAATA GGGGGCCAGAAAAGGGGCTcccacattttttatatttaaaatatctcaaa aattctttttgatccTGCCTAGATATGCCATACGGAGctaaagaaaattt agtttgacatgatttgacgaaaaaaatgaaagtgaccTTGTATAGCCCAC TCCTATGTAAGAACTAAAAATCAATACAAGTCgcaacaaaatagataaaa caTCTAGACTAACTATCGTCTACACattatcactaaaaaagggaataatt caggcgggataaatttgaaagcGGAGTTCAGTTCGGGGCGGAGAAaacag tggcggaggtgttaagagtgttccaaaactcaaCCGCCactatttttgat atttgacgACCTGACTCTGCACATATATACTTTCCTgcgtttactgaccc tctaaacGGACAATAGCGTCGTCTACGACaacatcatgaatatttttttg gcaagcaagtccgctacgtgaaaCAACAAAAGCCCATGCGGGGCAATTAG TGATAATCTAGTGTTGGCTAAAAAAATAGTGAACctaggaaaaaaaattt gagctggtCTGTAACATTACAATCTagaaataagcattttaaaaaagatg tttaaagaaaatgttaagaatgcATCAGAACCTCGAAGTACGTCTTTATT TATTCAAATTGGAtaaaaaatttaccaaatttttcgttggaaaaaattaa ttttgtgtGTTTTCATTATTAATGTGAATTTTATCCTGATCTTTTTCAAT TACATAGGGAATGGATCCATCTTCTTGGATGCAAAGAACTTTGAACATGT TGATATTACTGTTCAGCTACAAATATCGTCAATGAAAAAATACATAATAT TTTAAAACAGGAAAATTTTGACCCCACGCGATGACCAGATGGGAGACATC GGTTAGAATAAAGGATACTAGGAAttctctaaaaactttacaGTTTTGCA ATAACACCACCTTTTCAATACCAAATTTCGTGCAAtatcaatcaaaaata tatatatagtgaagatatgtaatatctgtcattttagaaaaagaaaagta ttgatatataaataactcaaactgataaaaacgaaaaaagttaagaNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGGCTTCTTTCTGAATTGTGC TATTCCACTTTGTATCCATACAGAGGGTGGACGAACAATCCAGGGGGGTA Ttccgagaagaatttccaggaaagtaaagttttcttttatttcaaggggg aaaaattatttaaaaaatttcagggGGTAAATGACTAATTTGAGTTCGTC CACACTCAATTTAAGACATGAAGAAAAATGTTTCCAATGGTTTTTAgcaa attttccattttccagggggcataagcatattttgaagaatttttatttc ggtttgaaaaggttcgtccaccccttcTTCTGTATGGATATTAAATACAA CAGTCCATTCTGTACTAGTTTTGAAAAACTGGTCAGGAATTCAACCAGCG TCTCCCCAAAAGTGGACCTGACCCAACTTTTCATTAGAGAGTTGTCCTAA AGAGTGGTAAATAACCCAATTACATCATACCTCTTACTGCTAACTTCTTG TTGATGAATTTTATATGTGGAAacttcattttataatatctcaACTTTAT TTAACTCTTATACCATGCTatcttcaaaaaacatttcaaactaTAACAAT GGGCATATCCTCACATTTGCAATACATTGGACAAAAATCGTTGTCTCTGT ACATcttcacaggaaaaaatgaattgaaaatgttctaaatttgtattttt atttcatcaatTATCATTTACTTCTTGTTCAAGGAGAAGTCATTATTTTT CCTATCCATAAATGCAGGTCAGGAAATCCCTCTGGAAATCTCTCCTCAAC TCATCAAATATGCAGCAAAGCTTCCAACGGATCCTTAGGATTTGTGGAAA ATTGCTGTGTCATATTCTGGATACTATTGTTAAGAATATTATAATATTTT AGTTGAAGTTTGTTGTTTAATCTTTAAAATTCATTAACAAGATAAATcgg aaaaattgttaaaaacttAAATACTTCTATGGTTTAACTGACCATATACT aagtataaatttttttatttatcaaacattttaaaaataagaccaaaaag aatatattaagaatcatattcttataattatatGCCTACGAacagaatga ttttattttgattgaaagattGGACACTTTTTTACaacaattttcatttt acatAACCATGGATATTAAAAAAACGCCCTTGCTAGCAGGATGTTTCGAA TTCAAAGGCGAGTGGAAATAAGTATTAAAGTGAAGAATTCCAAACATTTT CAACCTCGTTTTCAATTTATTTGTCGATTCCTTTGTGAAgttcattaaaa taataacatttCCATTGCTCCTTATCTCAAATTTTCAGTCTCAACTGAAC GAAATATTAAACTTATGCTTGGAAATTGTTTCATAACAAAATACGTGTTT ATAGCATTTCAGATTGCTCGGAGAGATTGCTGAAAATTCATGAATGATCA GGAAGGTCAATGGAAATTTCTAGTATAGTATCTAATCCCTTCGGAGTGAT ATTCTTGCAGTTgaaaatgtatttttgaaacttgaaagtatttttgaaac ttcaaagGTACctccaaataaaaaaacaaaaaaaaaacaaataaatttct tttaagaaaagACACTCATTTCCAAGAGGGAAGTATGTATTTTAAACAAA TCATGAAGAAATTCAGTTGCTTTACTCTAATTATCAAAAAGAGAATATTA GGTATCAGAACCCCCTGATATTACTACTAAGGTTCTACTGATTTTATCAA CTAATGATATAGACCAAGAGTGGTCTGAAAAGTAGTATAAATGGTTTTTA CTTCATTTTCTCGTTATATGGGATTTACGTGGGActttaaaattagtttt tgccaaATGGGAACACTTTTTATTAAAGGTATACTGTAATGTTTAAGCCT cagaatatttttctttcttcttgttcttattttcagcattttgtaAGTAG CTTTGTGCAATTTACtaggaaattttttggtgttCTATCAATCTCCGAGT AGATTCTGATACTCCACACATGGCACGTATTCACTTTGAAGACCATGACT Ctgtaagagaatctgcccaggttggcgcaccgctttgatctttttcatcc agaaTTGGGAAGATATTAATTGTGCTTTTAAGCACGGTGATTGGCTAAAG CCAAACAATCGCAACAAAATCAACTGTCAATCATATTCATAAACAATACA CAGACATAGACCCAGTTGCTTtggctttcgttttcaagcaaaaggtAACG CGGTTTTCAATGTTAACCGGTCAGATCGTCACATTCGTTTGAGCAGGTCG TGGGTAGATTGTAAATGACTCTCCaggattttttctactttctctATTTC CTATCTCCCATTCTATCTCCTcgtcttttctattttctgactttctgaga cttgttttctgatgatttctactaacttttctatatttcaaaatttctcc aaatatcgacccgaccggggttcgaacccaccaaatgaaagaatctctga tcagaaacccagcgcgctatccgtgagccacactcgcatagcagaataca aaatttgtaaatacttatagaatgacaaaaaagacggggtaatgttattg taatatgggtaaaagtaccccttttttaacctgactgaaattcgagccgt tactagcaaccctgcggggcccaaggcgccgagtatgaatccggcacagt gacaagccgttactagcaaccctgaccctacctaactgataataacagaA CCCCCGTCTAAATGGAACCACCATACCCCCGTCTAAACGTTTCCGCagac tgaaaaaattttcgccttGGTAGTCATTTACAATATACCCGACACCGTTT GAGCAGAGCATGGTATGTggagaatggatgatctgttatgaaattagtgt tttagagtctgcaaaacTTATTATTTTGGCCATCGCAGCCTTGTTTACTC TTATGAAAAACAAGTACTGTAgacactttttcaaaaattaggaaGAAGCT GTTCGAGTATCTGATTCAATAAGTAGTCATTTAGCTATCTTCTGAAAGTC AAAGAGTGTTCTAGCTAGccattttaagattttgatttgaaataacTCAA CCATTTGATGATTGAAGTCTAATtctaaatttataaattttgtgGCCCTT CTTGGAAACAATTCCCCAGCTGCCTAAAAGCTGTTGAATTTTTCGAAGCA TCCCAGgtaaaatatttgttatttttattagaattttgaAGGCAGAAGAA GCTTCTGATGGtagatttttttgcatttttcaggaATTTACTCTCCTAGC GAAAGTTTTTTATCTTTACCTCACTTCCCTGAAACTTTCTAACGCCATGT ACTGtacctttttattcaaaatttaaaagtgcaATTATCTTGGCGTTTGA CGTCAATGGGTCAAGTATGTATTTGGGTCATTAGATGACCAATATATAAG ACTTAATCCTTTGATTAGACATTAATTAAAGGCACTATTACTTATATTAA CAGGCAATTTAGTCCAAACATATAGAATTTCACTTTCTCTCACAGAATCA AAGGAACAATTAACCACTTACTAAAAACTGTCATTCTGCCGATGCAATAA CTGGGAGATGTAAGCTTTTTCATCTATGAACGCAACAGCTTTATCAAAAC ATCGAATTAAGCTCAGTGgcaagttaagaacaaattgaagatttaaggag cgatggccaagtggtcaaaggcgtcatcGTCTTAAATCAGGGGTTCGCGG TTCGAATttccgctccttccaatgttctgttcagttcatagatagccgac cCGGCTTACCGTGAACCCCgtgaaaaaaatcgaaagactgcctaaaagtc ctagattactgggctatccacgtaaaatatcgattcTATCTAATTGAGAc ttcagatttcagaaatgacTGGAAATTGTTTTCGCTTTTTAGGCGAATAT cggtcaaaatttaaaaattagcACCAACACTTcaaataaaatttagaaat aatacTTGTAAGTTAATTTTTCCCCTACTCcagtgaaaattgaattgaaa tttctCACCTAAGTGAGTTTTTGAGATCTTAAATTTACACCCGGTGTTTT TTATAGCCACCCCGGTGGAATTAAAAACTTCACCGGGTCATCGAGACAGT CGTATCCAAGGGGATGATGAAGAGTAAAACTTTTAATGATACATTATTGG TATGTAAATGTTGGTTCCTCATCTCAGATCCTCTCTGAAGTATTCTTTCG TCACAAACTGTTTGTTATTGCTTACAGACAGCGCGAaaaattctcattct atttAAGCTCACAGTTTGTATTCCTTATATtagaccgtagtacagtggta gagcatccggctacggttcgcaaggttgtgggttcaacccccagccgggt cataccaaagattcccaaaatggtacttgatNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNccagggagaaagagtggcgccctcccctaccttcgggtag atagctatcgaaagaggagccttcgggtcgcctccgactgcggtcgcaga cttacttatatTAGACGGAGGATCAAGGTCTATgtgtgtatgtatgtatg tatgtatgtacaTAGCCCAAGATGCGACACTCACGGCAGTTACTCCAAAT GCCGATTTTTGACCAAAAGAACCAAGTTTTCTAAAAGTgtgtttttatct gaaaatatgaaataaaaaatgaaaaactccaAAAACGCAAAGGAAACAGA TTCAAACTTAAAAATATGTTAACTCTAATCAACTTTCTGATGAATTAGTC CAAGAAGGACACCTGTTTTTGAAATCGGACCTTCACAGTGCAGCTTAAAA TCGGCACTTCAGTCGTTTAGAATgctacttacttacttacttactttgaC CAATTACACTCCtcctcttttattttattttttttattttctgatttatt tAACGTTGGTGTTACATAGTTATAATTAAATACTAATTTATACCAACTCA TCAATCAACTGATCAACTAAATTCGCTGTCTCAAAATGATTTGcatctga gacaaaaatggttgtaacttttgatagaattcaaatcatgttgcgatttt gtgcacgttgaaaagatatttgcgagtgaaatattatcaagcaaaaaaaa atgaaaaaagaaagaaaatgagaaatgagaaatgaagaagaaaaaaatca acttcttgtagaaatgtagTATGACTATGATTACCATTTTCAGAGCAGTG ATTCTGCAATCTTAGCTCATCATCACtgtaaaaaaagtttcaaaaatatt cattcaatcaaaggatatcaaacaaagtttgttgctggttgatcgacaaa aggctgttttttttttcgttttttactactttatagagtcaatatatctt ttcaatgagcacaaaatcacaacttgattcgaattctatcaaaagctaCG TaaccatttttgtctcagctgcaaattattttgagacgcGCAGACTTTAT TTACAAATTGAATATAAAGAATCTTGATGACGAATGTTTTGTCTTCCACC AATAGAAACTTAACCACTATCAACAAAACTATCCTACATTTGAAAGCTAA TCAAAttcttaaaaacataaaatgaagtcCAACCCTTATGAAAGCCGAAA GACCGAATGTAATTATCTGGTTTGgacattttaaatgtttttgttttgat gaagtTGGAGATGATAGAAGATTCTGACCAACGGAAACTCTTTTCTAATA AACCGGCGCTGAAAATCTTTTGAGACAACAAAAAGATAGATTAACTTAAG ACGaagccaaaaaactttttcactgTGTCTCGATATCCAGCCAATGATTT TGCCCGTTTCCATAGCAATAAAATACTAAAAACCACAAAATAGAAGCGCG TTGGGTGGGAAAAAGAATATCAGAGAGAGCGGAGAGGAAGTAGTTTTTCA CAGTTTTTACTGCTAGAAATCGATTAGAAAGGCTACTCAATTATTATCAA ACTAACTACCGGCTTAAATTTATCAgctcttttttaaaaatctgctCTTC ACTTGTGGCTTTGATGAACAAAATTACTAACTCTAAGTATATATGGCCCT TGAAATATTACGCAAAAGACCCTATATCGATTCTAGAATCCCAAACGGCG CGCGGCGCCATTCACAGTTTCAAAATTGGAGATAAAGATCAAGAAATGAA ACCTTTAATTAATTTTCCATTTCAACGAGTGGTATAAATTTCTTTGTGGa taataaattttttcaaatgcaCTTCATGCCCCGACATCAACTATGACAAA TTTGGTGACATCAGCAAAAACAGGCCTATACTCTTGTGTTCCTAAAAACC GGGTGATTTCAAGCTAAGAACCGAAccctttcactttttttgcaaaggGT TGAATCTTGTTAAGGTAgcttaaaaactgaaaattgagCTTCTTAGAAGT TTCCGAAATTaccctttttagaaaaatttccataaaaaaaaagTACACCA AGTATAATCAAAACTCACGACTAGACACGTTGATCACAATGCATAATAAT TAGTATTTTATGCTAACAAGAAACCTGATGCTAGTCTAAGCAGTTTAGAT ATTCCATCTTATCGGAAAATGAAAACTTCAGTCTTCTCAATCAATTTCCT AATTAGATTTCTGGCATACTTCCATTACCAAACCTTCAAAAATCTGTTTC AACCACCAAAAAGCGTTCCGTAgggaaataaattcaaaagacGTGTACAT AAACACCATCAACtagcaaaaaaatcacaaaaatccgTTCATCCCAATAA TGGCAGAAAATGTTATGATGACAATCTGAATCATATTTAAAATTAAATCG AAAATTTGACTTCAAATATTATTCGCAGAATTCGATAGTAAAGATATTTC TTACTTGGTAAGAGTTACAAAATAAATCAGTGCAAGTGTTGCAAGCAgtg tgttaaaaaaaaaacagtacagtgataattttgttctaaaaaccaaggca aaccaaaaaaaaagctCCTCGTAGTGAACAAACATTCAAATAATCATCTT CCAAATAAAGCTATACAACACTAAACAAGCGATTGTTCAAAATAGCACGA TTTAAGGATAAATGAAACactttaataaaaaataaatatactatATCTCA ATTAACCAAAACCCTTTATTTAGTACGGAGGCGGGTCCAAACACATCTTA AAATGGCATCAAAAAACCGTTTGAGGTaacacaaaacaaagaaaactgtC ATTATCTTAATGGGCAATTTTTATCCCATCAATTTACAGGTGATTAGCTT GCGAAATGAAACCTCACCCAACCAAAATTTCGTCTGTCTGCAACAGTAAT TTGACAGCGTTAAAAAGCCGttttattaatgcaatcaatCATTATAAGTA CCCGAATTTTCTTTTATATGGCTATCCTGCCTTTCCGCTACATTTAATAC GTGAGGTCAAATATACTTGCTATATGATTCGATAGCTGCTGATTCTAAAA ATCCTGAGTAAGACAGTCAAAATGTGTGTCCTTAGGGTTTCGATGCCATA AACGGAGAGGAGCAAGGCTCTGGGGAGCTTTGTAGCCATTATTGGACGAG CTTTTTCTAGAATATTCAGCTGTTTCATATTCAAACTTTCTTTGCTGCTG ACTAATCAGCCACTTACAATGTTGCATCATAACGCCATTTAATCATAATA GATCATTCTTTCTACACGTTTCAACACTGCATTTAGACTAGAGTcaactt ctgactgaactttgtcTCCCGATGATTTTGATGTAGCTGAGTTCAGTGAA GTATACTAGAGGATATCGCTATCTTGGAAtttttcgctttcgttttcaaa aataatataaaaaccaaaacaagaaaaacatcttcaaatcctatcaaagt ttatgaaactataatTAAGATGAAAACACCTCCGAAAACctatttgtttt tcttcaaaacagGAATGGATCTAGTGGTATGAATTTGGTACCATCTCAAG CAGAGCTGAAAAATGAAGTCTGCCAAGTTACACAGGGCAACTTATCGGCG TCATCCAGTCAATCAAAAAGTGGCCCTGAGCTACACTGCACTATGCTATG GCCTATGCGATGATTTAAACTTGCTGTTTAgctttttgcctaaaaatgaa agtgaaagcaaCTTGGTTCTagtgtttatgtttatgtttagaatttgatt ttgatgcaaattcTGTCATAGCCATAACCGCGCTTAAAAGCTCATCTCAC CCCAAATCTGGATAAAAACATTAAAGCGGTTGTCTGACCTTGACAGATCG TCTTATGATGTGCGGTTATGGCATTCAGAATGAATACGTGCCATGCGCGG TGTAATCAGGATCTGCTCAAGAATGCAAAGCTACATGATGACACTCCTCC ACACTGAACAATTCGGCGGGATGTCATTCCAAGAGGGAAATATACtcaga atctcaaaaagtgagaaaaacagCGAACCGGAGAAAACCACCTTCCTTTA AATCCACAACTACACACTTTCTTTTTCTAGaccttgaaaatttcaatttt taacccAATAGcagaggccactatgtctttacgtgtgcagcagcttgtgc aaaggaaTTTAATGTCGCTTTTCcgcgacatagtggcccctactaCAACT GATTGAATAAGATCAGCCGAGGTAGAGTTTTACGATATTGAAGACCCAAC GGAACCCGTTGTCAGTTTTTGCTCTCGTCACGAATGGTCGGAATTGGTTC ATCACACATTAATAgtgaaaatagcccaaatcacgatTGCGCATCAAATA TCTGCTCTATCATGCATATCGTGAATCATGTCAAAAACTTGATTATACAT CATGCCAAAAACTTGATTATACCATAACGCAGATAAGGTCTCTAAATCAC GCCATCGTGTAAAGCCCCAATCACGCCATCGAACAAACAGCTAGGGGCTC CCTCCTGGAACGcaacattaatttttgtttatgtttggcTAGTTCACGAT TCAGAGGATCGCAAAAGACTAAATTCAAGCCATTTTATTCCTATATCAAA ATGATATAATATTATATAATGACATAGATgtataagcaagtgtctaccCT TATACCAAGCTCGTTtcatgcttagcattctattctTTAttaacaataga gccattgtttagttattaacaatagagccattgtttaggtaccaaagaCT GAGCCTGTACATGCTCATATAAACGTCATGCTTAAAGAAAGAAACACGTA AACAAATTAATTGGCTTAAGATAATGGCAATAGTGAAAACGGTGAATAGT GGAAACGTGGAAGATGCTTTCACTTGGTGATTTGCGGTCCTAAGACTTTA AAAACTAATTTAATTAATACCTTTGGTCGTAGGTCGTAGTATCAACTACT GTCAATTTCAAATCACTCTCTACGAACTTAGATAAATACTAGCCTAGTTA CTCTAAGGTCTCGAATNAAGCAAATTTTGAACAGGCTTCAGGAACACTGT AATAAAAAGAtaactttttcaaatgtttttaattCTGTATATTTCTACGA ACGAAATTCAGAAAATTGTCTCGTAATTACATAATTCAGTTATTGCAAGC GTCTGATCTTGATTTCTGAGAAAGTTGGTTTCCTAGAGGCATCAGATGTG CCCCAAGAAATTCTACTGTTCCAATTCCTAATAAGATATTTATGTTTAAG CATGTATTTTTGGCACCATTCAGCCACCAGCCAGAGAATTGATAACCAAG TGCACAATTGTTCGACGGTGACCCATCGTGGTCTCGGTCAAAAGTCGAAA ATTCCACTTTGTTGAGATATGTCGCAAAGGATGATGCGTAACCGCCGGTG CCGCCACTTAAGTGTATCAAATAATTGCTTCTTTCGCTATCCACTTGAAC GTGGGCGTAATATTGATTGTATAGGCGGTCCCCGTGCCCTTCGAATTGGA GTTGGATCAAGAGTTCTGAGCCTTTTGGTAGAACAGCTTGTGCTGATAGA ATGTGTATGTTGTCGTTACCAAACCAAAACTCACGATGAAGTTTACCGAA TCCAATCTAGGTAAAACAgaaatgtaaaatacaaaaatgattgtATATGG TCGTTCTTTATACAATTGTTATTTTGACCCTCGTAGTCAGGGTCATCATT AGCCTAGcaaactaagcccgtattcacaaggctaggacacacgacTAATG GCAATATAGcattttcggcgctttaaattttttttatatttacggatttt aagtttgccttggaatactgttattcagtcacaacttaaccatcagattt atccaagtgactgaatggactgaatcaaactagcttagatttctaggcta gatAAATACCTAAAACCCTTTTAATGAATTAATTATAATGATAAAAGTAA CGTTTAATTAATTACCATAGAAACATGATACAGtgtgaaaacaaaagaag aaacgTCTCCATAATTTTATGTTTGACTGTagtaaataaaaacataccaC CTGTCTGGTCCAAAGCATCTTATTTTTCCACCAAATCTTGTAGACTAAAA TTCACAACTGGTATTACATAAAGTTACTTTAAAGAATACAAAATCGAAAT TACGTACAATAGATCAATACAACCAACCAGAAAAAAAGAGgagaaaagat gaaaaaatattgtGTCTTTCCAAATGACTTGATGAAAACAACTCATTAAC GTACAGGAACATGCTAATCACTAGAAAATAGCTTTCTCATAATCACTCTT GCTggatcattgacaataaaatcaattattctttaatattttctttctac TGCTATGTAGGgtaagatttaaaattttccagtatCTATCAAAATTgaat cttttctctttttttctcgaaaactATAGTACTTCGAATGAAAATCTTTG CTTCATCTTACTTAAAGAAAAAATCGCTTAAAGTTGGGATCATCCGAATG CTGTGTATCAAAGCTGTTACCACAAACTACCATACTATCGTTTTACTATG TGATTGGTCAAAGTTTATACATTTACGATGAAGCTGTGAAAATCTACCGA TCAGAGAAAATAGAAGCATTGACAGTGAGCTTTCTATAGAaacactggtc caaatttcaactttcaagTTCAAAACATTCTTTGCTCCACCCTTAATTAG ATAtgcaaaaaaggtaaatttagGTGGATCCTTTCgttgaatacacgctt tttttttataagaatggtgtatttTCAttccatcatggatattcttaact ttttggcgaaaatcatccaaaaatattcttacggtattcttaggttaaga tcgaaattggcaatctacaggttaaaatgcatcagttgctaaattccatg atggtgatattcttaccatattcttaatttttttaccattttcatcatgg acatttttataaagtgtattcttataaaaaaaaagcgtgtaaagaaaagt ttttcaaaatttgatgatgacgtcatcaaatttaaCAATAACGATCTCAA TCCATAATTGGGTCACACTATCTTAATTTCCTCAAATGGTTAATATATCG AAAGTTATTAAAATTTTCGTCCAAGTGAAGAAGTTACTCAAAGTTGATAC ATTCTCTAAATGTTCTAGTAAAAGATCTAGTAAAATTTGGGCCAATCAGA AAAGAGATATATTTTAGTAGGGAGGGGGCAAACCCTTGTGATCCGTAGCA TCTTTTCACGGACCCCtgctcaaaagatttcaaaatcctTATCTTTATAA CCAATCACATGCGGTTGCGTCCCACGAAATATGCTACGGATCCTAAAGGT TTGCCCCTAGACGATCATAATATGGATGTTTAAGACGAATTCGtataaaa agaaagtaataGTAGCCGCGCGGGAAATAAAAAGTCGGGCGGGAATTTTG TCTGCGTGTGCTGGTAAAAATTCGTTAAATGTTAACCGGGTTATCCTCTA AGATTCCTTACCTGACAAAACATAAAGAAGAATTAAccagcaaaaaatgt cacaccACCGATAGAATGATAATAATGACCTCTACTGGAAAACAACCAAA TAAAATCATATTACTTTTCGTTCATTCGACCCCTCTTTACTTAACGGTTT TTTGGCATTACATTtttatgatgaaatgaaaaggaatTACATTACAAATT ATATAATGATCACCCCAATACCATGCTGGGTAATTTTTTAATATCATAGC CCGTATCGATTAGTATGgattaagaaaaaaaagttatatatatgaaagta tgaaacaaaatagaaagtatccctcaaaattctcaaaatagaaaatcagt ttgattttttctttaaagtttgctCTGTAAGAAGATTAGAGTCAACTTTT TGTCATTTACAGCGATATTAGCTCTTTAATCATTTCTCCTTTGAGCTCAA AATCATAAATATAAAAccctttttgacattttagttcCAAGTACAAGAAT TATATCAAATGAAACatatttctagaatttttcaagATAACCGTTATTGA GAATACAAGTGTGTCTCTATATACCCTTTTAAGACTAGGAAATGGGGGGN TACCACCTGTAATAAGCTTATTTGGcttaaacacgtgcgctgagagcatg gaaagctattttctaccatagaggtataaagaaaaacaggagttgaatgt gtcggtaattggtcgttaaagtcttttgatttcttttataaaatgtatca aaagaaattctaagctcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNatatatgagattatgagcatgcatacatc gtaacttttttaatcgtagggcgagcttggttacaatagcatacttctcc tgtttctttatacctccatgtttCTACTGccaattcatatccatttatat ttccagcatcacattgagtataaatataattcttgattaaagtgacttta gaaccattgtattttataatgtgatcaaaatttttattaaaaagtgtNCA CCAACTAGAAAATTACCTAGACTCATATGAAACAAAATAGAAAGTCcctc aaaattctcaaaatagaaaatcagtttgattttttctttaaagtttgctC TGTAAGAAGATTAGAGTGAATTTTTTGTCATTTACAATGGTATTAGCTCT TTAATCATTTCTCCCATTCTATTATCATTGAGctcaaaatcataaataaa aaaccCTTTTTGACATGTTAGTTCCAAGTACAAGAATTATATCAAATGAA ACatatttctagaatttttcaagATAACCGTTATTGAGAATACAAGTGTG TCTCTATATACCCTTTTAAGACTAGGAAATGGGGGGTTCACTTTTACGGT ATGACGGTATTGGGCCTTTTTACCCCCGGTAAATCGGTATTACGAGGAAA AAAACGACGGGATTACGGTATTTCATTTTCTACCGGTATCGGTAAATtgc ctgtttttttgtcggtatttcgatatttttatcaataaaaaacggtattt cggtataaaactatttatcttttagtttcttcatgagtttcatgcagaaa tttttttaagtctattccgctattttaaccagtaaaattttcttgctcgc ttcgctcgcacaatcttggatgtccTATTGAGTTATTGTCATGatgaggt tattcaaaataagcaaaactttacgatatctaaacaaatattttcgttat ttttctgcggccgcatttttttaatgacaacttttgtgatgcaaatactg catccaacgaatgagtctagataaaattttctccgtcagcactaaatgat atggtcgtctctccgtattcacttatatactactacaatacaatacactg atactgcagtaacttagagacagtaaaggtggtatttactccttcaacaa ttagtaaaagtaggtagttctaaaaacatcttgcgtaggatcgaacgatt aaaaaataattcacatcatgatgcacatgatgcgttttcaggcaatctag gcattctaaattttgaatcttttcttgggcgaaactcttggaacgccgca ccgggtacggcaggtacgtcgctcgccgtaccatatttttctttttgcca gcaaatggtcagtgttaaataaaatcaaaaattgtgtgaccaaacaaggc atacttggctaacaatagcgtattaaggccgtttttcaataacaaaggaN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNgcttctcagaccatgattggcccaaacctcgatt ttaaattaattctcaatataaaagacatcttacgggtctgcgaggaagaa attcttgggggaaaggcttaattttgcatttgcctcccgtaacaagcaag taactttggcgcggcagacctaaaacattgctttatgaaagctcaaatag ctgtaaaagatgcCTTAAAAAGTCGAggatatcgagaataaggtcacaaa actagcaaaaaactttatatattggcgaaaatgtttggtataagaatagg tcaatctgatcatgaacatataaacgactggacgtctatcttttattgtc tctttgaagcgagcttcgttgccgcctgtatttcaaaattggtatgaaaa atccgacaatattccgtcataattttatttctttgaattatgtaggtaaa aggattgatagagcttgaacattactcctaatgcacaaaaaaattatttt cgaatttttttacaagtttgcaatatattttatcaacattttaaactcta aaatgcagaatttcaactgcgtgtatacttttgaatcccttttgtcactc caataaatttttttatgacttaaaaaaaaatagcttgccaaagttgagag cctgtttcataagaatatcgaaattagaatgtgacactctctaaaattat tagacacttttaagtcaaaatttagaaatattagtcggagttttgacaag ctgacgatgattttgcctctgttatctttgttattatATAGATAaacgac ttgagaagagtagaacaacagagacttttgtcgaagttttgacgttgtta gcaaggtattcccaagtggtatatcatcaaaatctattgtttcatttttt gcttttaacgaggcggcaacgaagctagcagccttttctacaaaaaagac aaaggagatggatgtccagtcgtttatatgttcatgatctgattaaaaga gaccataaaaaggttaaatttagcccaataaggtcacaatcgtttaacca aagatgtaaaagcaaaattggtgcgtgaacgggaaaatgatttttttcgc gcgtgaatacgtgaattggcaaaaatttgtgcgtgaatacctgaattgag ggttgactggggggcctcataaagtacaagacttgtttgcACAGTTTCTA ATTtattactacacaatagatttgataactgaaaattcattattttcgaa aaaaacataaaattataatatcggtatcggtattaggcttccttacccga cggtattacggtatttgacccaaaattttgtcggtatgacggtatttaag acccctgaaaccccccaGGAAAAGGtgccgtagtgtagtggttgtCAAAC TTGACTGCCGTCCAGGAGGTTGGGGTTCAATTGCCAATCTGTGTTGTGAT TCACTAGGTCTGTTGGTGACTTTGCTAGGTATTCACGTCGGGTTAACGCA CTTGATCCGAAAACTGTGTGTCAGTGTCTCGCAAGCTGACAGGCAGTATA AACTGCAGCGTAAGACGGCTCTGACGAGACGACTCCTAAACTGCTCAATA TAGAACTGGGAATCTTCTGTAAGGAGAAACTAGTCATAAATCAAGACAAA GAAAGGCAGCGCGGTGTGGTAACTTGACCAAGTTGAGGTAAGTCAAAAAA ATAGTTGCTGGTTCCCCAGAAAATAGTGAAAATGTAAAGAACTAACACGA GCAAGACATGTGCGAAAATTTTTACATTGTCTCGATTATTTTGTTTtagc tacacgctttttttttataagaatacactttataagaatgtccataatga aaatggccaaaaaattaagaatatggtaagaatatcaccatcatggaatt tagcaactgaacctaagaatgccattttaaaggcattttaacctgtagat tggcAATTTTGaacttaacctaagaataccgtaagaatatttttggatga ttttcgccaaaaagttaagaatatccatgatgaaatgaaaaaacaccatt cttataaaaaagcgtgtacaagCACATTTTGTGAACAGGGCAAAGATTTT TATTGCGTTGCGTTGTGTGTGTGCTTATATTATTCGTGACATCCACTATG AAAACGCAATATGTGTGATAGGAAGAGGAAGAAAACGAAAACTAACTTTA AATGCCGAAAATTGTCAAgccttttttatgtttttgagcGTTCTTACAAA AAGGAAAACTGACAAAACACTGTTTACTAGACACAAATCAATTAAAATCA TATTTCTCTTGCCTGAAAACGAGAGGGCACTCGCTAAGCTCTACCAGATA GAGCGTGACTGTTGAAATTTTGACACTGGTTAGcctttttttctagtttt tactcaaaaacaggggatccgtcctgtatttttataatctgatgtataca agacgggttcgagctgtgaggaagatttttgcctgagaaaaTTTACAGTG GTAAATtagaatttagcgctgtcctcacttaaaAAATTAACAACAATTTT CGGAACttgcgtttttttataagaaattatgaccagtgaaagaataacaa aatttgattggccgTGTTTTCAACCGTCATTAAGATcttggaaattcaaa ctctcaacccaaaccatgctattcatttcgccatcagtatataaaagaAG AAGTCATAGATCTCCAGGCtagtttttattttaacagCGGCAAAAATAAC CGATCTTTtcaatcaatattttcaaaatttacttcCAAAAAATAAGTAAC TTGAAAGTTAGcaattataaaaaacataattACAGATGAGAGACCTAGAC ATTTAAAAAGAAGATGAATATTCTTTATGCTCCGCTTTCCAACACAACCA TTAAAACGGTTATTTAAAATCCTTTGACGCCCATAATAACTTTCTACTCC AGTTTATTTTATGTGGGGTGAGATTTTTGAAGGAAACTTTTAATTGGATT TCAGTCCCCATTCCAAACCACACTCTCGCCTTCTTCAGCGATATAAAAGT CTGAAGCTCGGTCTGAAGAATAACAAACAACGGGTTCGTATACGTCAGAA ATAAAGAAGATTAcataattttgaaaacgaagacAGTTCTCCCTTATTCC AAAGTCAAAACAGAAGACTTTTAcagttttttctataagaattacttaat tcttgatttaaaaagcccgaaaatttaaacattaaaaaattctAACTGCA ATCATGGTCAAACCTATTGAGAGCTTTATTTCCTcgttttcgaaatttgg agttcgggcgagaaagttgcttttgggctaattgataaatttattcgagt atttcaattcgggggggggggggggggggtaatggTTNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcagctgacgtggca ataaccgaatgtcgttcgtaccgggttccttaagtgacgcaaaaaaaatt ccttcccatcctccactctgagcttctattctttgacattGACACATTCT TTATATtgctaaatttttgaaagtttttgatgcatttcccgaaatttcga aacttttgccgctgatgggattcgaacccactgcATACAAAGCCCCTACG ATTAGAACGCCTGCGCcctaaccactcggccatcgagtcacaactgcatt aaggagctcaaagttccttataaacatggtatttactccaaactctaccc gggggttaaaaccctaaccaggggttaactcccatccccaaccctagccc taaccctacctgactctacctgaaacaaccctttaatctaaccgggaaat ttgactctactaccaattcaatccggttggtttagcctggacttgttaat ttattgcgcgcacaggccccgacaaagacaaaatcttttcgatcagttgc tttttaaaggctttaaaggtccattctgctgcgcgctaGACCAATTATTT CTACATCTAAAAAATCTTTGGgaataaaagttttttagtATTGCAGACAT ATTTTTAGTACAGCAGCCAAGGTTTTGTCTGTTTACCATGGCTTTTTAGA AAGATGAACATTATGAATTATCATGTCAACATTTCTCTTTATATTGTAAT GATGTCTGGGACTCAGGACTCCCGGTGCGAAATCCGTGACGTGGTCTGGC GAGATTCCGTAATCCAActttccagatgttgaaaaattATCCAACCTTCA ACGCTTCATTGcatcggaagaaaatttctactgCAGGTGCCAGATATTTT GATCTTCAGATCATGGATTAAAGTAATCGTGTAATGTTTGCAATGGCCCT TTGAAAATTggtttcagatttttttatttgctttCGAGGAATTTTTCGCA GACATGATCCAAAATAATAATCGTATTATGTTTGATTAATTATGACAAAA GTACTAAAATTGATTTTCTAGATCTAAATTAAATTCTTTTTGCGAACAGA AACAAATGGAACTTGTTGAATTAGCTGTCACTAGTAGGCTATAACGTTAT TGAAAATCCATACATTAGACAAAGCATTAATTTTTCCCAAATGTTTCTAC AAACGATGTAtggaagaaaacattttcattaTATTTCATTTCAACCCATC GAAACATACAAAGGACGGCTTTATTACGTACAAGGCAAAGGGAAGGTTAG AAATGAATTGTTCATGAAAAGCCAACAAGGACTTGTTATCTGATTAGCAT CCATCTTTTATCGATGAAAATGTTGAGTCCTTTTTCTCAGACCACAATCA TTGAATCTTACCATGGTCAGAATATGTTGGTATTTCTTGGTGCTTTTGTG TTTTGCAGAATCTAAAGTTTGGGAGAGAatgacattttcaggctttcCAC TTCATCATAtgtttcgatttgggaggggaataatggcttccaggctatat tctcagcctagtCAGACCAGGATCCTCAGATCCCAAGCTCTCAAATCTTA TCGTTATAAAACTCAAAGTTGAAACTCTACTTTTCCAACCCTAAGTTAAT GCACATAAAAACTGCTTGCGGCGGGACTTgcggttttttaaattttacag cgaaatcctttttttgccaaatattaTGCTCATAATAGTTGTAGTTCATG CTTAAGTATTATAAACATTAGTTCAGCCTCGTGATAAGCTTACATGAGTC TGAATTTATACCTCAGAGAAATTGGATAATAtctcttttttcaaattcac tttTCAGATTGTGCCATGCGTGAGAGACTGTTGTCACTAGAGCAGAGCTT TATTCTTGTTCCATTGTTATTGATGATACCTCCTGTAACACCTTTCGATA TAGTTAATGAAGTCCAACCATCAGGTAATACCGATATTGGTAATCTGACA CTCCAGCAACTTTGCCAATTCATTCTTCATTACAATGAATCTATGTGTAA CTGTCAAATCCTGGAAGAAATATGTTTAATCTATAACTATACTGATCACT GGCGATCTAAGGAAAAGGTCATTTACAAGTTCGAAGATTGTGATGAAATA ACTCAAGCAACTTTGGTGATCTCAATGTCCATTTTTGGTACCTTTGGCAA TCTTTTGGTGGTTATTATAACATACCATAACTGGAAACAAAGCTCTTTAT GTCATAAACTGATCGGTGGTTTAGGAATATGCGATCTGGCCTTCGCACTA ATGGACTTGATTCAGACAGTGCCTTTACTTTGGACTTGTAGTGCTTTCTA CGGTGAAATAATGTGCAAGTTCTTCGCATTTGCCAACAATACAGTGGCTA TGATTGGTCTTGGTTTCATATTGATCGTAGCTATCGAGAGATATGTTGGT ATATGTTATCCTTTCACAAGAGGACTTTCAACCAAAGCTGTTCTACTCAT GATCATTGCAAATGTATTACTAGGTGTTGTTTTGAATATACCGCTAGCGA TCATTTACAAAGTTGACGAGTTCAATCGTTGCAGAGAATTCTGGTCGTCT CGTCTCCGTGCTAAAGTTTACTCTTGGCTCATGTTGATGCTTTCTTTTGT CCTTCCTATCACGGCTATCGCATTAATGTACTATCGAATTATTTACACAA TGAGAAGATCAATGAAGCAATATCGGAATGTCTCGATCAAGGATAAACCA ACCATGAGGCGTAACAAAGAACAACAGCGAGTAATGTTTATTCTTATAGC GATATTAATTGCGTTTTTCCTGCTGGTGGCACCCGATAAATTCATATGGG CGTTAAAGGATCAAGGATTCCTGGAAAACCTAACCAATCAaatgttgaat attttgaatcTGTGCGCAAGAATTCCGTTTTCTTTCCATGTGGTGATAAA CCCACTTATTTATTCAGTTATCGATCGAAAGTTTCgtgaatctttaaaaa acttattaTCATGCCGAGACTATCATCGGAGTGAACCGGGTGGTAAGAAT AAGAGAGATTCGGTAAATGTCACTGGTAAAGATGGATCAATGAACAGTGA CGAAAAAGATTGCGCAGTTTGAACTCTTTATATGTTTGTATTATAGGTCG GTTTGTATATTTTAGAATGAAAACGACAAAAGACATCAGCCTGTGTTCGG AGAGGCTTACTATGTTAAATCttgtttccaaaatattttgttcttcttac aagaaataagtataaaatatttctgttatgattaaaaaaaattctgaatt ttatgTGTGAAAAGCATACAGCGGAATAGCACGCGATCCGATCAACAAGT ATTACCTAATTAAATAAATTTACGTTGTACCTTTATCATATCTAATTTCC CCGAGCACTAGTTGTTTGAGGGAAGCAGGGTTTTGAATTAACTGACTGAA TGTGTGGCTCCTTATGGCATAAAATGTTACTTTTGAGGAGGGTGTGCGTG TAAAGTGAGAAATAttggttaaaaacattttaaagatcGATTTTTCGCTT AGATTCCATTACAAGCTTTTTCTTGGGTTGTGAATTTAGACCTCCACTCT AATCTTTTCAAATCAGTCGCCAGGATGTATTGTCGTTTCCAGATCGAATG GCTCTGCGTGCATTGATGAACTTTCAGTCTTGCCTTATGCAAGGATTTGG TATATATAGAGTAAACTTTAAAACTTAATACCTTTGTTTAGAAAGAATTA TCAGTGTTATTATTTCAAAGATCGTAAATTTAAAAAGCTGGGGATTAAAT GACGGTCATATCGGACCGTTTCGGCTTATCCCACAATCGNTTAAAAAGCT GGGGGATTAAATGACGGTCATATCGGACCGTTTCGGCTTATCCCACAATC GCAAAGGAAATTCGATATAGTGtccttttattttcatatgGCCTTTGGTG AGACCTTTTAATTTACTTCTACGGTATATTTTTGCCACCCTGAAGGTTCT ATAACAATACAAGGGAAAATCTTGTGTTGAACTTTGTACCTTAAAGAGAG AGAAACCTTTCAAGTCCTAAGAAACacctccaaagtttttgacccaatta ttttccaaagtaGATCTACTATATCTCGAGatatttgatttgaattttca aatttttacttgtaaacaatagaaattcaacgtaaagactcatttttttt agagatttcaaattcaaatatctAAGATACCTTGGAAAAAAAATAGGTCA GAAGATTTAGAGGTGTCTCTCTGGACCATAAAAAATATCTCTaagcaaaa tataaaaaatcatctgataatccctttaaaatcacgggttgttttttttt aaagtacttAAAACCTTTCCACTTTTTTGCATTCTGATACGCTGCAATTT TGATGACAGATTGATGCATTTATTTCTGTCTTAAGTGATATCTTATTATT GCAAGTGACATATTTAACTTCAATTCAGCTTTCATTTGAAAAAACCACAC AGATCACCCGTCTTAGATTGGGAGGGTATAAGTTGTTTTATTTCCAATCA AGGACCTCACCAAGGATTTCCAAGACTTTAACTCCCCAAAGCTCACTGTT CCCGTATTCCATTACGCGAGAAAAAAAAGTCTAATGTTATTGTAGCGTAA CTTCATAACTGAAGACGTACAAAGAATGCATATATGTTTGTTAACTGAAA GAATCAGAAAAGTGGCGTAAAAAAGCTGAGTTTCTTTCTCAATTTTGTGA CACAGGCTTATAAttcatcataaaaaattattacGGATAAGATACAAGAA TTACTTAGTTATTATAAACGTACAACAATTGCTGAATAAAGGGCAACGAT AACACTTAAAAAGATTGacaaataaaatttgatagggTACCATTAATTTA GCTTTTTTCCCGAGTTATTTCACGATtactttttttctctatttcaaaAT AGTAAATTATAAATCAAGCTAGAAAGTAAAACTCCAAATATCGATTGTTG AATGCGAGCAGCAGTTGAAGCTAGATCTTCTGCTTTTTTTTCGGATACTT TAACATTGTTATCACCGACAGGTACCATGTTCATGCAGTTTTCGTTGTTT TCAGAATACACGAACGATCCGTCGAAAAGCTTCTCACAGAACTGTTTAGC AGACGAGAAATAATCCTTGAACTTCTTGCACGATTTTGGACACATAGTTG GTGTTCCTTTCTTTGACCAGTCCCATCCAGTAGCCCAATTATCATTGCAC GTGTAATCCTCACTACAATCCGAAAACCATGCTTCACAATCGGATTTACA AATCGGAACATTTCGGACTCTTTCTTTCCGGGTTTTCTTGGAAGTCGTAT CAGCGACGATCCATGGTCCAAGGTTTGGAGAACATTCATAGAAACAAGTA TCCCGTTTGAAATGTTGCTTGCATTTGTCAGAcatgttttgaattttcgg ACATTGATCCCAAACGATGTTGTACAGTGACAGGGCGCCGTCTTTGTCAA TATTATCGGTTGTATTCCAAGTACAGCATGATTTGTTTTGCCAAGGTGTA CAGTGATAATTTTCCATGGCTTTACCTTCTTTTCCTGGTACGTTTTTATG GTTTGTAGATGAGATACATTTGTTCAAATAGTCATCGGCCGTTGAAGAAT GGACAAAAACAGCGCACCAAAAAATTACGCCCAAGAATAGTATTAAATTC ATCCTTTTCGACAACATCGTGTACATATCATGCATCTAACACAGCTACTA TGCCTCACTTTGTGTTGAGTGTATGTGTAATAAGTTGTGTAACTCTACAC CCTTCCTCTTGACTAAAAGTTTGTAAAGTGATCGAAATGAAGTCAAAAAG CCCAAATTATTCGCAACTTTGCGCTTTTTATTTAATGCGTTCAGTTTTTA CCGCATAACGTGATATCCGGTTGTTCGAATGAAATATCCGGGCAttaaaa ttttatgaatttgcCGAACTTGAGAAATATCCTAGCTGTTTCAGCATTTC TTTTCTCTGAGTTTCCTAAGTCGAAAGGGTTGGGaaggaaaatatttgaa aatgtgtattttacagaacaaaAGCTATACCCATTGATTACTCATAAAGG CAACAGTGTTACAAGCAAGAAGATAGCAAAGAAAAAATGGGAGGAAACTT aaattctttttattatttggtGAATGTTTATGAAATGTCATGGTTTTGTA ATATTTAATAAGTAAATATGCCATTCACTATCCCTgctgtatgatttttt tttaattacataTCGACAGAAGCCTGCTAAAACTATGGTTTTAGAGTTTA GAAGAGTAGTGGCcataaggaaaatattttattttcttcataACCTTTTA TAATTTACAAGTCATACCTTTCATTTACAGCTACTAACTAAAGTATTACA TACTGAATATATTATATAAGGGATGGTTGAAGAGGACTCAACAAGAGGTG ATGAATGCAGGAACAAGAATTtcccacaaaaaaaaacatacttAAAAGTT TCATTTTGTTTGGCTTGGGGTTagggcggcaatcacaaatatcttcgtgt TTTAGCTTGGAATATTAGCAAAAATCAAAANGGTTAGGGCGGCAATCGCA AATATCTTCGTGTTTTAGCTTGGAATATTGGcgaaaatcaaaattgacaT TTCCTGGAGCCTTCCCTGAAGTGTTTGGTTGCTGAGAATCTCAAGTGTGA ACCTTGCtttcactttgaatttttttatatactttGCCATTTGACGATCT GTACCCTACAATTGATAATCGAAGTTATATTATTGAAAGTAATCAATCAG TCAAAGTACTCCATGGTTATCAACTCTTTAAAGGGATGTTAAAAAAGTGA TGGAatatcacaatttttttgaaattttggtacttgAAATTCCATTGTCA TTCGATAAGTGGTCGTTGGATTACTTTgatcattatcaattactttgata atcaaatttattgattagTAATATGGAATGTTACTTCTCGTCATGTTTCT TTTTGATCGCTGGCCTGATGGCctgatgttttttcttctctttgttTGAC AGCCCTCACAGCCCTTGAATTTTTGTAGATGgctgttttttttctccaag ccggtgtcaaccgaaccctatcgaaaCCGATTTTCGTAATCGAACCATCA AACTTTATCGAACATAATCTAACAAtactgtgagtggtcctaaatccgac agccctgcctcaatccgaccccccaaataactgctatgaaaaaaattcta tgttttcaaacattccctctccaagttgaacaataaactatattgcaaga actctcgaaacaaaacatctaacaagatgactaaaatgtcaagatgtcaa ttaatgtGATAAAAAAAGTGTGAGTTGttaaaataattacctctattatt ctgaatctgttgttcgtgtttaaaacgttaacaattttgtaataaaaaat tatgttttttataagaagcaattaatgttttggttcaattggttcagtgt atcaaatctctcagtttagttgacactttggcaTCTTCAtagcgtcacag cgaaaggtttgtttttattttagtttgtatctttgaaagaccccatcgga tttaggcagtgctgtcggatttaggaccactcacggtagctGTCCGATTA CCAAACCCAAGCGAACagctatcgaactttacgaaaatttcttgataagt tcgatttagttcgatgaGTGTTCTTTGTTTAATGAATTTCTATTGATGTT CGATGAAgatcgattgatgttcgatgtgGTTTGATGAAAGTTCGATGTGG TTCGATGATTGTGTTggattgattctacttttctttacctttcagaaaat taggaggttgtttaatcaaaacacaggcacTGTATGCTTCACTCATACAC TTTTTTTGGActtaccccggtggggtggaggtcctataaattaaccaatg tttgttcgttagttagtgtgtTCGTTTAcagcttttcttgagattggctg attagttttttctgatttttggcacgaaggtgcatgaccataaaccctca aatgtgacggagcccgattttcaaaaaaaaaattggggggcaaatttggc ccaaaaacgggttaaaaacaggttttttagactttgtgaaaaattggatc attaattttttctgatttttagcatgaaagtaaGGTATAATCAtagttaa aagatggctcaagcagatttgcaaaaaaaattttgggtcaaaaatcgcat ttttatctataagaaccacttttataataagaatacatcaatgttcttag ccatattattattaagtttattagttttttttaagatgaaaatttcacgg tggagggtaatgatttgagttttctagaaacacttattatttttttggct gaaaaacgaatctttttttatctataagaatcactaattttaagcataga tcaatgttcttagccaaattattattttattattatttttttggctgaat ttaaacaaatctttatctataagaatcactatttatgagcatagatcaat gttattagccaaattatttttttattattttttctaaaagaagaaaatgt cacggtagagccatagtatgaaccccccccttttttaagggggggggatc cgagttttcaaggaaggctttataggggggatgggcaattttccagttaa aatggggggtttgagcttataggggggatcaaataaaaatgggggggaTA GTAACTTTCTGGTTTTACTATTATTAGTTTACTGTTTATTTGCTAGTGTT TTCAAATTCATTGACTATTGGTATGAATTCacactgaaaaatatatttca ttcatcaaaattcttccccaatactgggagtacaaattatatgttggggg ctcggacccctgtaaatggtgcgggatcaaaaaattttaaaaataggggg gatacctttatagggggggatgaaatattaataggggggttcagacccct ctgcacactatgagaGCGCGAcagtttgagttttctggaaaccttattta ttaagctgtgcatttttctgatagtggtttttataaagaaaagcgtttaa tagcttttttatttctttttcaaaaatctttttcaatagtgttgatagtt tctctcaataagagaaagaaatcgtgtattttttaatacctACCTACCTT GAGTTACCTTGAGCTTGTTTCGTAATATCTTTACGCATCCATCCTGTGAG GACcgatgtaaattttcatattgatgatGCTGTTTGTTTCAGCTCGTNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNATTTAATTAACTCTATAACTGGTTTGAA TTGTTCATTCTTAGATGGATTTCCGTTTGATGAGTCGTCTGGCTGTCGGT ATATTCCCCATATTTGGATATCCAATGTATTCGAACTCAGACAGATGACT TTGATAACGCCATTTGAGTGTTTAACGGTCTGTTTGAAGTGTGATGAAAT ATCTTCTCTCATGTATATAGCGACACCACCACCACATCTTCCAAATCGTG ACTTTGGTCTTTTTCTGTCGGACCGAAATATTTCATAGCCTTCTATGTGT AACTCAGCATCATTATGGTCTTTGAGCCAAGTTTNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTTCtgtt aaaatcataaataaaaagttattctcaATCAACTTGTCTTTGATATATGG TACTGTTGATTGAACTGTTTGTGGTTTAAGTCCTTGAACGTgtaatacgc ggttcattaaaaTCAAGTCAAATGAccttggaggttcggtgaaatggtgg tggaatggccgtcccatgttgcgtaagatagtcccaagttggagcagttg acggtatagcaaaaagaatcactggtttctaaaatcctctaaataataaa gtaaatagccaaagcttgttttttacctttttaaataagaacaattcaag gctcaaagtgccaaaaaaataagaaaagccaagcctcagcaaaaatttac tggttcttataaaaaaaaaagtgcattgctcatttgaaataataaagaCT ACACGttctttaattttaaagaaagtaataaaaattaaaacttttttttt tacaaattaacgaccaaagagcttgtaaaagctccagcttgtcccatctg ATGGGATAGATATAGGATGACCCGCAAGAATGGCCCATGGGCGGCCCCCA ATACGCCCTCGGAATATGAGTAAAAAATTTGGCGGCAAGGTATAAATCCA TttaatcgaacttcatcgatctTAATCAAACTGATCGAACCTCAATCCTA TTCATTGAACTGCGATGGAACTATAATGgtataatcgaacagtcatcaaa ctttacaaaagttttcccgattCGATAGGTGTTCAattgggttcggtaat cgaacagctatcgtttgaTAGGATTCGATTAGTTCAATAATCTAACAGTT CGATTGACCTTGCCTGGTTTTCTGCTGTTTATATATTACAGGATACTAAT TCGaggaatttcatgaaaaaaattagaaatgagacgaagataaaaaaatg tagtgtttctggaatgcgggtgaagggaAAATgctctttttttttgctat ttttgataacttaagttcattgaaatataactttaaagataacttttata aacagtatgaagtaagccctgaatactaatgtatcaactactaacgaaca aaacttgatttacaagcgggaatatctaaccagatttcgacgtttgatag cttgaacagtcaacttgattttcattatgatgaaccatatagatgaaccc atagtctgcggccaagtcaggaaagttttttttttcacccggccagTTTC Tgaaaacactacattttttattttcgcctgatctctgtttttttttatat caattGCGAGCAGCATTGAAAAACAGCAATTAGGGTTGAATATCATAAAC ATCTAAAATTATCCCTGAGGGatttcagtcatttgatgaCCCCTTACAAA CAGCGAGTGGCCATAAACTTTCAGTTGTATAAGACTAACTGAattgaatt tccttttttatcaaaaattactATAGTTTGAGATGATATTGGCCTGGCTA TAAATGCATAGTTCAGAAGGGACGGGGTCTCTACCCTCCCCCAAGTCTAG ACTTTTAAACGAGTGTGGTCGATTTCTGTATTTGATGAAGAAGTGGTGGT TTCTCCCTCATTTTGGTCATAAATCGCTTATAAAATGACACTTCTACATC AAATAACTCCTGTTCAGTAAAGAAATCGGCCATAGTCGCTTAAAGGTCTT Ctgtatagtttttcgagagctttcagattctataattggttttggcctaa aatgagtttgaaatttccataaaaaatgagCCTTTGGGCTTTAGGGCtga ctaaaatttttaaaaaagtccTACAAAAAATATTAAGATTTGCAAAACTA GTGTAACTCTGGTTATAATTGCATTACAATGAGTTATTTCAAAAACTGCA ctcgtaatttttttgttttgaattttcctcgtcctttcagactataaaat aacaaaaaaaatcacttgtgcaattattctcgaattgcactctTTATCTT GTGATTACATATATACTAATTGAGCTGTGGTCTCCAAATCTGGTACATAA CTATAAACAccgacctttatatatccctggaccaagctactCGATCCCGg cgaagcaaaaaaaaatctttgatcagagaatgacggcactactcaatagt ggTGAAAATGCATCAAGactctacttttcctcaaatactCTTGATGATGT AGCGCAGTTAgacaatttttaacattgcaatggcttcttctcgggtacca ttTCAAAAAAACCTCAATCAAgcatggcggatatagcttggtccagggat ataaaGGTCGGTGACTTTAAACGATTTGGATAAACAATAGAACATATTAG GAAGGTAAGGTCACTCAGAAATCTCATTTACAAAAAGgggaatttttctc aaatttcaattaCTGCAGCAAAATGGccctcaaattcaaattttgacaaa accAGTCATTTTTTGAATCTCTTTTTCACTTATTTAAGCCCAACCTACCT ATGATTGTCAgtatataataaaaacatttacATACATGCTCATACAATAA ATATACCAAAATGTTAAATAATCCAAAATGGTTAataatgttttatattt ttctggtaGTACTCGTTAGAAATAAGTACTCAGGTTGTAAGGATTGAGAA CTGATTTGCAGCtgtttatttttaataattatttttcagataaaaatgaA TAACATGGATCAAGATACAGACCAATTGATGGAAGAGCCAGAAACAAAAG TTTCTTCGAGGCTCAAGTATTTTCTCCTGGCATTTTCTATGTTCTTTTGG CTACTGGGAGCATTGTTTGCTGCTATTGGTGGTTATGTTGTTTCTCAGAA GACTGGGTATGAAGAGTTGTCAGATTTTGCAACCGACCCTGGAATCATTC TTGCAACTTTGGGTTGCTTTATCTTCGTTGTCTCCTCTTTTGGTGTTTTG GGATCCCTTCGAGAAAATGTTTGTCTTCTCAACACatacaaatattttct tttggtAACTTTGGTTTTTGAATTGATCTGTGGCCTTATTGCTTTTGCTT TTTGGCCTGAAGTTAAGAAAATGGTTGACCGAAATCTCTCACTGGCTATT GAGAAATACACATCCAATGTTGATCTCCGAAACATGATGGATAAATTGCA AAGAGAGCTTGAATGCTGTGGAAGTTTGACCATTGATGACTGGGATAGTA ACCCGTATTTCAgttgcaaaaatgttgaaagTTACCGTTCATGTGGTGTC CCATGGTCATGTTGCTTGagaaaatatgaaagaaatcGACAATGTGGTTA TGGTGTCCGAAAGAATCGTGTCCACGTCAAAATGTCCAACGAAATATACA CCATTGGCTGTCTGGATAAAGGTTTTGAGTTCTTTAGGAATAACATGATG CTGGTTGCTGCCATGGCTGTTGCTTTTACACTCCCTCTTGTCATTGGTAT TTTCAGCATCCATATCTTTGTCGGCCAAATCTTGTCACAGCTTGTCAAAG TAAACAGAGAGAAAATTTATTTgtaagtgaaaaataaaaatgaagtaaCC AGGACCAGGAACATTCAcataatgaaaacaaaacaatgcaaCTTTATTCT TGTTTTCAGCAGATAACCATGTTTTATGAAAACTTAAGGATTGGTATTAG AACCGTTTGATAACAATTTCAACACCGTcagttttgaaattcaacattaa aaatttcattttgaggGACAGATTCTGTATGTTATAAAACAAACATtaat gtatttttcttttttttttttgcatccaTTTTATAATATTactatttata agaatgtctgATTTTTTAATTAATGTGGTTAaggttttttaagtttttgt atGTAGCTTTTATTTGGataattgattgaaattttgttgCATGTTTTAAA CCTTTAAATAATGTGCAGCATTGATAACGAATATCTCAAAATTATAGAGT GACCCTTCCACGAGACTGTCAGTTAACTTTTGCCAGAGAtggactttgat ttcatttctGTTTTAAATAGTAAACTGAAATAAGAGATTCCCTTCTTTTG TGTAGGGTCAAATCGATGTCGTCCTCTGGCATGTTTTGTTCTTTCTTTAT AGATATTATAAAGAATACGGTTTTAGGTCCTCTCTAATATCACTTTTGAT ATCATTTtacatttatttttatcaattttgacaCACAAAATGGTTTACTT TGCTATTTGAATCTTTAGAAATCCATTGATTGTAATGATGTGTCTAGTAT CTTGACTTCAACCAACTATCAACTATCTTATTTTTACCTAGTATCCCTAA GAAATATTCGTATCCTCATAAAACTTGAGCACTAAGAAGGAACCAAACTA TTTTTTATTATATTCTAAAAAACATCataaatttgtaatttttattCACT CATTTGTAAGATCTTTATTCTATTCTATATTCTTTATAAACTAACTACTT CTCCATTAAATTGTTCTTTCATTGCCTATTTATTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000974XLOC_000974Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001842-exon-sc0000012-1491911889:836643..836710TCONS_00001842-exon-sc0000012-1491911889:836643..836710Clytia hemisphaericaexon
TCONS_00001842-exon-sc0000012-1510915933:836643..836710TCONS_00001842-exon-sc0000012-1510915933:836643..836710Clytia hemisphaericaexon
TCONS_00001842-exon-sc0000012-1575043694:836643..836710TCONS_00001842-exon-sc0000012-1575043694:836643..836710Clytia hemisphaericaexon
TCONS_00001842-exon-sc0000012-1491911889:920132..921927TCONS_00001842-exon-sc0000012-1491911889:920132..921927Clytia hemisphaericaexon
TCONS_00001842-exon-sc0000012-1510915933:920132..921927TCONS_00001842-exon-sc0000012-1510915933:920132..921927Clytia hemisphaericaexon
TCONS_00001842-exon-sc0000012-1575043694:920132..921927TCONS_00001842-exon-sc0000012-1575043694:920132..921927Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:836643..921927 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.1836 12.5425 23.9077 28.5666 199.325 136.972 142.679 149.262 115.07 118.792 88.6105 82.4338 86.0973 78.2936 80.3748 74.0406 97.0697 110.412 74.9715 98.578 124.606 121.375 80.5205 81.1599 52.6598 59.6303 147.352 124.821 124.533 124.14
Blast
BLAST of TCONS_00001842 vs. Swiss-Prot (Human)
Match: TSN33 (Tetraspanin-33 OS=Homo sapiens GN=TSPAN33 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 3.385e-43
Identity = 86/252 (34.13%), Postives = 141/252 (55.95%), Query Frame = 3
Query:  129 VSSRLKYFLLAFSMFFWLLGALFAAIGGYVVSQKTGYEELSDFATDPGIILATLGCFIFVVSSFGVLGSLRENVCLLNTYKYFLLVTLVFELICGLIAFAFWPEVKKMVDRNLSLAIEKYTSNVDLRNMMDKLQRELECCGSLTIDDWDSNPYFSC-KNVESYRSCGVPWSCCLRKYER---NRQCGYGVRKNRVHVKMSNEIYTIGCLDKGFEFFRNNXXXXXXXXXXFTLPLVIGIFSIHIFVGQILSQL 872
            VS  +KY L  F+M FW++  +  A+G Y    K     L+  A DP I+L  +G  +F+++  G +GSLREN+CLL T+   L    + +L  G++ F F  + +  V   ++ AI  Y  ++DL+N++D  Q++  CCG ++  DW  N YF+C ++  S   C VP+SCCL   ++   N  CG G++    +++ S  IYT GC+DK   +  +N+ L+  +A+   +P ++GI    I V QI  Q+
Sbjct:   18 VSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFD-YLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQI 268          
The following BLAST results are available for this feature:
BLAST of TCONS_00001842 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TSN333.385e-4334.13Tetraspanin-33 OS=Homo sapiens GN=TSPAN33 PE=1 SV=... [more]
back to top