Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001656 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001656
Unique NameTCONS_00001656
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1954

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001656 ID=TCONS_00001656|Name=TCONS_00001656|organism=Clytia hemisphaerica|type=transcript|length=1954bp
AAAACTTATTATGTAATGCCTGGTCACTAATATACTTTGGTTGATTTGTA
TTTTGCTGACTCGGCATTTTACTTTTCTTGACAGTATGGAATTTCCAGTC
CCTGCGATTGTATTTCTGTGCGTATTATGTGGCTGTATTATCATACTATG
CATCGTTTATCAACTCCTAAAACGTGATATGTGCTGTAACTTCGAAGCGG
GTCTTGGAGAAATCGAGAAAGCCACAAAGAATGGATACACAGAGCTCACC
GAGCATTTTTACGACTTTGATGAAACCGAAGGCCCGACTACGGATGATGA
CCCTCAGAGTCGGAAATCAAGCCGTCGTAGTAGCCGACGTAGTAGTTACG
ATTTGACGGCGACAAGTCAATCAGGGGGTGAGATGGGAGTCGATTCTTCA
TCGATATATGGCGGAGAATCGATTGATATTCGAATTAGTGGACCCGAAGA
TGAAGCCCAGAGACATGCTGGCAAAATTCTATTCGAATTCAATTATACCC
CTGAAACACAAAAGTTGTCTGTGACGGTTATTAAGGCTGCCGACGTCCCG
TCTAAAGCACGTGGAGGATCGTCCGCCATTCAAGTACGGTTGGTACTTCT
ACCGACTAAAGGACAACGGTTCAAAACAAAAGTTCGACCGGCTTCTAACC
CGGTTTTTAATGAGACATTTACATTTATGTATGTTGATCAGATAGCCATC
AGTCAATTCCAAATTCGAATTCGTATTTACGGTCAGGAGCGTTATAACCA
AGGACGATTGATCGGTGAGCTGATACAACCACTGAAAGAATTGAATTTAT
TTAATCCAGCTACGGAAGAAAATCAAGTATGGAAAACGTTAGCACCCAGA
GCTCTAACGAGCGCTGATTCCATGTACGATTTATCGGATACTACAAGTGT
CGGTTCACCTGGTTTTGGTTCCCCGATTTTGGGTGGTTCCCAATCCTCAT
TGACTGGACATTCAAGTGCACCAGAGCTTCTAATTTCTCTGTGTTATGCA
TCTTTGACGGGCCGTTTGACAGTTGAGGTGCTGAAAGCAAGTAATCTCCG
ACATTTACAACTACAAAGGGCACCAGACACTTACGTCAAAGTTTCAATGT
TCAACGCGGTGGGACAACAACTGGCCAAAAGTAAAACTTCAATCCGTCGT
TTAATGTTCGAACCCGAATACAATGAAACTTTCGTTTTCCAAATTATCGA
GTTCGATTTAGCAAGTGTCAGCCTCATGTTTTcaatcatgaatatcaaga
aaatGCGACGAAAAGAAATTCTGGGTTGGTTTTCTATTGGTAAAGATAAC
ACTTCGGAAGAAGAACTCTTCCATTGGCGTGAAATGCTTGAAGCGAAAGG
AAAGAAAGTTCGTAAATGGCATATTTTGTCGGCTGTAAATCGAAGCTTTG
ACGATGAATACTGAAGTGGGAAATCAAAGAGTGCAGACAAAATTATCTTC
CTTTTACACAACTCGAGACAAGCATTTAGATGCAGTATTTTAAGATTTGT
ACAGTTAAGTAACCCATTCCAGATCTTGACGTGGTattgtacaaaaaaaa
atattggcaATAAGAATAATATCCTAGACTTTCAACCATATATTAATCTA
CAAATTTCTTCATTAAATTGGCTACGTAGAAATTCTGGTTAATATCTGTC
TGGTTGATATAAGAGGTATTATTAAGTCGAAGCAAGACTTTATCACACct
ccaaaaaaagaaataacCTCCTTTCAAGAGTCACGATTCTCCAAAAACTT
TGACACAAATTTGAACGGATtggattaaatttttattttgagattaaaca
aattgaaagattgtaaaaattgttGTTATATTACTGTATTTAAAAATTGA
CTAATATTTTATTTTGGGCTTACTTTTTCTCATTAGATAGGTCAAGATAA
AAAACTTAAACCATGGATAAGTTAGATctcattttcctttttaaaattGA
GGAA
Run BLAST on NCBI

transcript from alignment at sc0000011:362890..367899-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001656 ID=TCONS_00001656|Name=TCONS_00001656|organism=Clytia hemisphaerica|type=transcript|length=5010bp|location=Sequence derived from alignment at sc0000011:362890..367899- (Clytia hemisphaerica)
AAAACTTATTATGTAATGCCTGGTCACTAATATACTTTGGTTGATTTGTA TTTTGCTGACTCGGCATTTTACTTTTCTTGACAGTATGGAATGTAAGTTG AAATTGTGCTCTAAACTTTCTTTTCCGCCTTGAAGTTTTTATCCTTATAT AATGATGTGGGTACAATGCTTCCCGTTCGAGTTTAACACCTTTTGTCTTT CTTTTCTAGTTCCAGTCCCTGCGATTGTATTTCTGTGCGTATTATGTGGC TGTATTATCATACTATGCATCGTTTATCAACTCCTAAAACGTGATATGTG CTGTAACTTCGAAGCGGGTCTTGGAGAAATCGAGAAAGCCACAAAGAATG GATACACAGAGCTCACCGAGCATTTTTACGACTTTGATGAAACCGAAGGC CCGACTACGGATGATGACCCTCAGAGTCGGAAATCAAGCCGTCGTAGTAG CCGACGTAGTAGTTACGATTTGACGGCGACAAGTCAATCAGGGGGTGAGA TGGGAGTCGATTCTTCATCGATATATGGCGGAGAATCGATTGATATTCGA ATTAGTGGACCCGAAGATGAAGCCCAGAGACATGCTGGCAAAATTCTATT CGAATTCAATTATACCCCTGAAACACAAAAGTTGTCTGTGACGGTTATTA AGGCTGCCGACGTCCCGTCTAAAGCACGTGGAGGATCGTCCGCCATTCAA GTACGGTTGGTACTTCTACCGACTAAAGGACAACGGTTCAAAACAAAAGT TCGACCGGCTTCTAACCCGGTTTTTAATGAGACATTTACATTTATGTATG TTGATCAGATAGCCATCAGTCAATTCCAAATTCGAATTCGTATTTACGGT CAGGAGCGTTATAACCAAGGACGATTGATCGGTGAGCTGATACAACCACT GAAAGAATTGAATTTATTTAATCCAGCTACGGAAGAAAATCAAGTATGGA AAACGTTAGCACCCAGAGCTCTAACGGTGAGTATTCAAACTTCATCTAGT AAGAGGGCGTTCTTTAGGATCTTACTTATAATTGTCTAATGTAAAATATT TTAAAAACACTACTCTTTAATTTTTCGTAGAAGGGCATAGTGGTCGTAGT ACTTGAGATATTGGGGTGAATTTGTGGTTTCATATAGTTTATTTTCGCTT TTTTGACATAAAGTAATAATAGGAGTTGTTAAATTGACATTATTTTGAAC CCGTACAATTTGGTACAAGAGTATTATGATGGCTTTTTACACGATTTTGC ATGATTGAAGAATCATTTTCAGATTGTGTGTTTGATGTATAATATACTTT TCAGAGCGCTGATTCCATGTACGATTTATCGGATACTACAAGTGTCGGTT CACCTGGTTTTGGTTCCCCGATTTTGGGTGGTTCCCAATCCTCATTGACT GGACATTCAAGTGCACCAGAGCTTCTAATTTCTCTGTGTTATGCATCTTT GACGGGCCGTTTGACAGTTGAGGTGCTGAAAGCAAGTAATCTCCGACATT TACAACTACAAAGGGCACCAGGTGTGTATTATGTTTTATTCTTTTATTTT ATTTGTTCTGACAATCCTCAAAATTCTACGCTTAGAATATTTTGACTCTG GATGGCTGTGAATTTTCAGATGGTCGATAAAACAATTCTAGTTTATTAAA AGATAAGCTAAAATCTATAATATCGTGATCGTATCAACTAATATCTTAAC AAATATAACTGGAACGTTTGAAAAAGTTTACATAAAATCGTATGTTTTAG AATTCATAATATTCACGACATAATGTTTCACGGATACCCCCAAAACAACC CGGGTGTCTGTCACACTAGTTTCATTTTTAAAAATTCAAAACTAGTGTCA AACACTCGGGCTTTTTGGGGGGCATCCGTATAAAAGATTACTTTATGACC AGTTTGCAAAGTATGGCAAGGCTGCACTCGAGGAAAAATTCGGAAATACC AAGTTCTGCACTGGAAGAACGCACCTGATAAATTTTGGTCCGGACAGGGT GCACCTAGATACCTCGGAAATTCGTCCAAAAAGGCAAAAATTGCTAAAAT TAGCTGCACTTGAAGAAAAAATAGCTGAACTTTGCACTTGAGGTTAAAAA AACGTTTGAATTTGCACCTGCACTCAACTTTTTCCGAGTTGTGCACTCGA GATCTCGAGCAAACTTGTCACACTCTGCAAATTGGCTTTATGAATACCAC GAGTTCGGTCGAGTGACTCGCAAAATACATTATTGTAAAAACCCACAATA CTCCCACTAACCGGTTTGGACTCTTTCCTAACCCATCGTCATAAAAATTT AGATTCGTACGTCAAGATTGAGGTATTATCGGCACGTGGCAAGCGCGTTG CAAAAAGTAAAACTACCATCCGACGATCTATGACAGATCCCGAATTTAAC GAATCGTTCGTCTTTCAAATGTCAGAGTCGGATTTGCAGGAAGTGACGTT AGTCTTTTCCGTCATTTGTATTTCGAAGACACGAAAGAAGAAAGATGTTT TGGGTTGGTTTACTATGGGTAAAGAAGCCAATAGTTTGGATGAGATCGAC CATTGGGAAGAAATGATCGCCCACAAAGAACAGAAATCAACGCACTATCA TGTTTTACTACAAGCTTGAATCGATTGATTCAACATAATTTATTCGGTAG AAAATAATATTGTTGTTTTCTTCATGGAGCTATGTCAGTCCATATTGTGA CTGATACATTCGACTTGATTCATATTTTTTTCAACGTTGTAATGTTGACT TGAAAAACAATCTGTGATGAATTTCGGAGATTTTGGAATCAAATTTGTAC GAGTTTACTAAATCAAAATTCAATGTTTGTATTTTTGTGAAAAGCATATA TTTGACCCATTGACCCAAACGGTATCATTTTACCCAGATTGACTTATATG AAATGTATATATTGATTGGTTTGTAGGAAAAAGCACGATGCTTGTTTTCT TTGTGGGGTTATTGAAATGTCTGGGACGGATGAATCGAGGCCAATTTACC ATGGAATTATTATTCATAATCATCTGATGCACACATATTGAGCTCGGCCA AAATCATACAGTGGTAGTAGATATTTTGAAAATATTTTGGTATTTCTAGA TACTTGTTGATTTGCAAGGAAGAAATCATATCGTTGATGAGATATTGTTT TTGTTTTAGAAAACGCTTTAGATGTTTTGTTTTTCTCATTATTTTATTTT GGGCGTTTTGGTTTACATTGAAAATCTGTTGGAGAGAAGATATGACAAAA ATACTATTTTGGCTATAGTTTAACCACCCTCCCTAACTTAAGGCAAATAT TATTTGCTTGGATCCAAAAGTATATTTTAAAACTTTATTTTTACCATTAA TTTTATCATATCACTCCAAATGTAATATATTATATTGTTAGAAAAGAAAT ATTTTTAGGTAATTTAAAACAAATTTATCGGAAATATTTACAAAAGGCGT TTTGAATTATTTTATTCGTTTTAAAATATTTTGTCGCAAAAATTTTGGGC CTTGTTCCCATGTTAGTTTAAGCAATTATTTTCAATATTATTTAAAAAAG AATCCTGTCTGAAAAAGAGGCCATTAACGTACATTCGTTGTATTGAGTGA GTTGAATTGAATTGATATCACTGTAACTTTTGGGCCACGGTGGATTTCTT TATTTCCTTCGAAAATTACTATCATCTTGAAAGAAGGCTCTTATAATAGA CCTATTCATAAATTACGTCACGAACATCACTTGCCTCGTATTCAAACAAT TACCATGGTGATTATGTCCCTTGAGACATAAAATGATTTTTTTATAAATA GAAGGAGTTTTTCTAAAATCCGTTAATCACCATGGCAATAATTTCAAAAC GAGGCAAGTGATGTTCATAACGTAATTTATGAAAAGGTCTATTTCCTCCC AAAGGTCTGGGAAGACGACTTTTGCAGATGACTTTTTGCAAAATCAATGC ACCAGTTAGTCACTGCAGTTTACAGTATAGTGCACTTAATTCATGTTTAG TTGGTACACAACGTTGTTTCAACGTCAATCTAACGTTATTTTATGACTAT TTGGGGGCTATGGTGAATACTTGAAAAAGACTTGATTCAGTGTTGCTTAT TTTTGTTTTTTCTTTGTTTTTTTTCACTTCAGACACTTACGTCAAAGTTT CAATGTTCAACGCGGTGGGACAACAACTGGCCAAAAGTAAAACTTCAATC CGTCGTTTAATGTTCGAACCCGAATACAATGAAACTTTCGTTTTCCAAAT TATCGAGTTCGATTTAGCAAGTGTCAGCCTCATGTTTTCAATCATGAATA TCAAGAAAATGCGACGAAAAGAAATTCTGGGTTGGTTTTCTATTGGTAAA GATAACACTTCGGAAGAAGAACTCTTCCATTGGCGTGAAATGCTTGAAGC GAAAGGAAAGAAAGTTCGTAAATGGCATATTTTGTCGGCTGTAAATCGAA GCTTTGACGATGAATACTGAAGTGGGAAATCAAAGAGTGCAGACAAAATT ATCTTCCTTTTACACAACTCGAGACAAGCATTTAGATGCAGTATTTTAAG ATTTGTACAGTTAAGTAACCCATTCCAGATCTTGACGTGGTATTGTACAA AAAAAAATATTGGCAATAAGAATAATATCCTAGACTTTCAACCATATATT AATCTACAAATTTCTTCATTAAATTGGCTACGTAGAAATTCTGGTTAATA TCTGTCTGGTTGATATAAGAGGTATTATTAAGTCGAAGCAAGACTTTATC ACACCTCCAAAAAAAGAAATAACCTCCTTTCAAGAGTCACGATTCTCCAA AAACTTTGACACAAATTTGAACGGATTGGATTAAATTTTTATTTTGAGAT TAAACAAATTGAAAGATTGTAAAAATTGTTGTTATATTACTGTATTTAAA AATTGACTAATATTTTATTTTGGGCTTACTTTTTCTCATTAGATAGGTCA AGATAAAAAACTTAAACCATGGATAAGTTAGATCTCATTTTCCTTTTTAA AATTGAGGAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000865XLOC_000865Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001656-exon-sc0000011-1575043694:367808..367899TCONS_00001656-exon-sc0000011-1575043694:367808..367899Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1575043694:366924..367690TCONS_00001656-exon-sc0000011-1575043694:366924..367690Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1575043694:366379..366595TCONS_00001656-exon-sc0000011-1575043694:366379..366595Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1575043694:362890..363767TCONS_00001656-exon-sc0000011-1575043694:362890..363767Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1510915933:367808..367899TCONS_00001656-exon-sc0000011-1510915933:367808..367899Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1510915933:366924..367690TCONS_00001656-exon-sc0000011-1510915933:366924..367690Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1510915933:366379..366595TCONS_00001656-exon-sc0000011-1510915933:366379..366595Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1510915933:362890..363767TCONS_00001656-exon-sc0000011-1510915933:362890..363767Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1491911889:367808..367899TCONS_00001656-exon-sc0000011-1491911889:367808..367899Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1491911889:366924..367690TCONS_00001656-exon-sc0000011-1491911889:366924..367690Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1491911889:366379..366595TCONS_00001656-exon-sc0000011-1491911889:366379..366595Clytia hemisphaericaexon
TCONS_00001656-exon-sc0000011-1491911889:362890..363767TCONS_00001656-exon-sc0000011-1491911889:362890..363767Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:362890..367899 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.135885 0 8.00618e-10 3.77136e-09 0.26657 1.01448 13.444 10.7864 8.76869 8.61469 3.44425 5.92667 3.74324 4.3532 0.540135 0.495715 2.45992 5.34135 5.08321 8.27392 7.71921 9.08585 2.09014 3.97355 3.17554 2.45756 6.43858 4.30766 0.213242 0.314293
Blast
BLAST of TCONS_00001656 vs. Swiss-Prot (Human)
Match: SYT14 (Synaptotagmin-14 OS=Homo sapiens GN=SYT14 PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 3.692e-68
Identity = 133/344 (38.66%), Postives = 197/344 (57.27%), Query Frame = 2
Query:  347 YDLTATSQSGGEMGVDSSSIYGGESIDIRISGPEDEAQRHAGKILFEFNYTPETQKLSVTVIKAADVPSKARGGSSAIQVRLVLLPTKGQRFKTKVRPASNPVFNETFTFMYVDQIAISQFQIRIRIYGQERYNQGRLIGELIQPLKELNLFNPATEENQVWKTLAPRALTSADSMYDLSDTTSVGSPGFGSPILGGSQSSLTGHSSAPELLISLCYASLTGRLTVEVLKASNLRHLQLQRAPDTYVKVSMFNAVGQQLAKSKTSIRRLMFEPEYNETFVFQIIEFDLASVSLMFSIMNIKKMRRKEILGWFSIGKDNTSEEELFHWREMLEAKGKKVRKWHIL 1378
            Y+    S S   +  +  S  G  S   +   PE EA+   G +   F+Y  + QKL VTV    D+P+  R G ++ QV LVLLP K QR KT ++    PVF ETF F +V+   I  + +R R+YG  R  + +++GE I  L +LNL    +    +  +       S  S+ ++S + S  S           QS    H S PE+LI L Y + TGRL+ EV+K S+ ++L   R P+TYVK+++ N++GQ+++K KTSIRR    P Y ETFVFQ+  F L+ V+L+ S+ N + M+RKE++GW S+G +++ EEEL HW EM E+KG++V +WH L
Sbjct:  223 YEEDVPSDSTAVLSPEDMSAQGSSSQLPKPFDPEPEAK--YGTLDVTFDYDSQEQKLLVTVTAVTDIPTYNRTGGNSWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNHSGCDSQMSVSEMSCSESTSS----------CQS--LEHGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHAL 552          
The following BLAST results are available for this feature:
BLAST of TCONS_00001656 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SYT143.692e-6838.66Synaptotagmin-14 OS=Homo sapiens GN=SYT14 PE=1 SV=... [more]
back to top