Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001593 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001593
Unique NameTCONS_00001593
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4033

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001593 ID=TCONS_00001593|Name=TCONS_00001593|organism=Clytia hemisphaerica|type=transcript|length=4033bp
atttaactttttaaagaaaacttttagTCTAGATTCGCTTGGTTGTGGAG
TTGACTAAAAGAATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTC
TGAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAA
CAGATTTCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAA
AATGATAACGGACCTCTGATCTCAATACATCTTGATATTTCTTTGTACCT
ACGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTG
AAGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAA
TATAAACCGTTGAAAGGTTTcaatttgttttggttttatatGATCTTCAG
TGTTGCTCTGTTTACCAGATTCTACACCATTACATTGCCTAAACATGTTT
GcTGGGATGAAActcattttggaaaatttgcaaATCACTATCTCAATGGA
ACATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTT
GGCTGGCTGGATGACAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAG
GCATGGAATACGGAGAACATAGATATGTTGGAATGAGAGCAttttgtgCC
TTATTGGGATGTTTTTGTGTACCACTGGCTTATTTGATTGTATGGGAATT
GACTCACAATCTTCCTGCATGTATACTTGCTGCTTCATTGAttctttttg
ATCACGGGTGTATAACGATATCACAGTACATTCTATTGGATCCAATCTTG
ATGTTTTTCATCATGATGTCTGTGTACAGTTTATTGAAATTCTACAGTTG
GCGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCG
GATATTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTG
ATTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATGGGATATTCTTGG
CGATCTATCAAATTCTCTGGTTGACGTTGGAAAACACTTCATAGCACGTG
CTATTGGCTTGATACTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCT
GTTCACTTCCAAGCACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAG
TTCCTCCTTCCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTT
TACCTGGTGAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAA
ACAGCTGGAACATTACTTCATTCACATCAACATCTTTATCCTAAAGAACA
TCCGCCAGAACAACAACAGATTACTGGTTACTCGCACAAAGATTCAAATA
ATGATTGGCAAATTAATAAAGCACACCATCTGATCAcTGAAGATGATCGA
TTGGAATACGTTCGTGATGGTGATGAAGTGAGATTAATGCATGTACAAAC
ACGTCGCAATTTACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACC
TTCATCAAGTCTCCGGCTATGGACAAGACGGTAACGGTGATGCCAATGAT
ATTTGGCTGATTCGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAG
TACGGTCAAAACCATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTT
TGcaagaaactgaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAG
ATGGCGTGCAATCCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAA
CATCGAAAGTAACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGT
TGTCGCCATCATTCTTCGAAAGTGTTTATGAATCACACGTTGTAATGGCA
AAGACGAACAACGGATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGC
ATGGCATTGGCCCATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATG
AGCGCGTATATTTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGA
ACGTATTTTCTTTACGTCATCGTTTACGTCATACAAACACTACGATGGAA
ACGAGGCTACAAGTTCGATGCCACCATTTACGcTGAATACACAACAATGG
TATCATCATGTTCGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCG
TTTTACGCCATGGGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCATA
TTTGTTTAGTGCAATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAA
CCGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTT
TGCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGtttttgcatGTTCCG
TGGTTTATCATATGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAA
CCATGGCTGCTTATCGATGGCTCGATACTTGGGATATTTAAATGAACATT
TTTATGCTGCGATGATGATCAAACAGTTTTTATAGAAGCAACCTTAATAG
ATTCACTTTCTAGACCAAACTAGAATATATTGAGAACAATCTAAAGCTGT
CAGAAATTTAACGGCTAATTAGGCAGTGCTAAGCATAAATTGAGCACCAA
TAAAAAAAACTGTTCCTTGTGAAAGAAAAGGGAACTTCTTGGGAAGTACT
TGCTCATGACAACAGAGGCCATAATCAGCCTGCAATTACCATGCAAAATG
AAGATTTTATACTGCTagttttagaaaattttatgatttgGGGGGCTTGG
CTAATTCAATAACAAgtagatatttttattatttatttggaGATGATACT
CTACGCTTTAAAAGtatataatttttaagaattttgataAATAATTGGCA
TGAATTAGCTGAAGTATGTAtgtttttctgtttgttttgtaattttttta
atgtcattttttatttttatgaatCCAGTAACAGTACACATTATCAGAAA
TATTACATTGAAATATTACACAAGTTTATTTTGTTAAAGTTATTTCGTGG
ATCCAACATCTCAAAGTGCTTTAATATTAAAATACAAGTGGTCAAAAGAC
AATAGATGTGTCACAGATCTGATCTTGCTATACCAGGTGAGCAAACtacc
taaagtctgtctcaatataatctgcagctaagacaaaaaaggctgtaaat
tttgatagaattcggaGAATAAGATAGATAtgttgtgcttgttgaaaaga
tatttagtgaaatattatcaaatagaaaaaagactttgaaaaaagttata
tccttttttgtctccgctgcagattattttgagacagactttaattttca
TTAACATTTGAAAACTACAATGGGCTCTACTAGTCTTAGTCACTAGTCAG
GTGGTTTATAAAATCCAGATCaaactaccgggtgcgccagaaaaaagaaa
actttaaagtgCCATAAACGGGCATTTTCTTGTCTGCTTTATATCTCACT
AAACTCGATCTAATCCTTTTTTAACACATTTTTGCcgaaaaaggactggg
acggttttagtgggataaagtggacaaaaaaatgcccgcgcgtccaattg
gtggctacggtcgaaaaggtgtattcaaggAGGGTAACTTATTTTTGACA
CACTCGGTAAATCAAGACGCATGCTTGAAGCAAAAGATTTCCTGCCCCCT
TCATTATATTTACAATAGTAAATTGATGGATTCATTTATCCGAATGTGGT
TGTAGAAGATATTGAATTTGAGATATATCATATTTTCTAATACATTATAA
ATCCTACTTACATACGTTATAacattaattcaaaaatcataaTATATGAA
AAGGCCTTTTGACCACTATTTGAAACAAGCAAAATGCTGTCTTGATTAAT
GTTGAGTTCTTCGACACCTAACTCGTGCAGCATCAAATTCTGATGAACCC
GGACATTCACGAACTGCAGGCTGTCCGTTATTCCGACATATGTAATATTT
GGAACGCGAGTGAGGATATGCGTACACAATGAAGGGTACACGCCCAACAC
ACAAATCACCAACGTCATTGGTCACATCTTCAT
Run BLAST on NCBI

protein sequence of TCONS_00001593-protein

>TCONS_00001593-protein ID=TCONS_00001593-protein|Name=TCONS_00001593-protein|organism=Clytia hemisphaerica|type=polypeptide|length=792bp
MTVRKRANHTSNSESKDDNTKNEEATEKKTDFPKALTNGSASKVKENDNG
PLISIHLDISLYLRNLRESLTTLSKQDFAEVPLHIWKVLINRSKHQYKPL
KGFNLFWFYMIFSVALFTRFYTITLPKHVCWDETHFGKFANHYLNGTFFL
DVHPPLGKMLLALAGWMTGYNGEFSFEKPGMEYGEHRYVGMRAFCALLGC
FCVPLAYLIVWELTHNLPACILAASLILFDHGCITISQYILLDPILMFFI
MMSVYSLLKFYSWRDCPFSFDWWGWMFVTGYFLACTFSVKWVGLFVILFA
GMTTVQDLWDILGDLSNSLVDVGKHFIARAIGLILLPIFIYLFFFAVHFQ
ALPKSGPGDGFFSSSFQSTLEGNKLYKAVLPGELGYGAVVTLKNHKTAGT
LLHSHQHLYPKEHPPEQQQITGYSHKDSNNDWQINKAHHLITEDDRLEYV
RDGDEVRLMHVQTRRNLHSHPEKAPISTNLHQVSGYGQDGNGDANDIWLI
RITKNPGPDNRISTVKTIFQLVHRNTGCVLQETEKQLPKWGWEQKEMACN
PNKFVTIVGSEWNIESNTHKKVPQVSVELLSPSFFESVYESHVVMAKTNN
GFKPKEGEFTSQAWHWPINYRGQVFSGGDERVYLLGNPIVWWLICGTYFL
YVIVYVIQTLRWKRGYKFDATIYAEYTTMVSSCSWLFMGWALHYLPFYAM
GRVLYFHHYFPAYLFSAMFSGILLEHVSRTVSYMFSGERRKHVYYFCLAT
VLAIAISSFCMFRGLSYGMSGPMGNQPNQTMAAYRWLDTWDI
Run BLAST on NCBI

transcript from alignment at sc0000011:659514..690240+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001593 ID=TCONS_00001593|Name=TCONS_00001593|organism=Clytia hemisphaerica|type=transcript|length=30727bp|location=Sequence derived from alignment at sc0000011:659514..690240+ (Clytia hemisphaerica)
atttaactttttaaagaaaacttttagTCTAGATTCGCTTGGTTGTGGAG TTGACTAAAAGAATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTC TGAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAA CAGATTTCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAA AATGATAACGGACCTCTGATCTCAATACATCTTGATATTTCTTTGTACCT ACGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTG AAGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAA TATAAACCGTTGAAAGGTTTcaatttgttttggttttatatGATCTTCAG TGTTGCTCTGTTTACCAGATTCTACACCATTACATTGCCTAAACATGTTT GGTAAGTACCTTTTAAAGTATGTTCCTAttttgttacacgtttttttttt attagaacacctggatgtgcttatttttttagcaattttcagcctgaaat gttcttagatgcgttcttaaattttcagactactctaaatcgacaatatc gtGCAGAATAAAGAgaacttaaaattggtaaaatttggacaatatttgac tctcggtttagaaaatccattcctaagtttgtttaaaactgcttgaaaag aggaaaatattGTAGTTTCTTCTCATTTTTTTTCCagactgaggctgggc atgttcttacgatgttcttaatttttcgacgaatttcagcctcaatgttc ttataaactgggttctaataaaagaaaaaacgtgtagtatatTTCTCGTT CAGTTTGTTCATCATATATTTACTCTTATGGCGTCTCGACTATCATTAGT TGCTAATAAACGAATTTTTACTAGTTTTTCTACCAAgatccaaaaaaaat attttcaaaatttagagaaTCCCTTTAACGTTTAACGTGGTGCTGTAACA AAGGAAGGATTTTGTCACATTAATCAGTTTTAAACTTTATGGTATCCTTA TcgtgcaaaaaatatttttcaacagCGGCTCGGCTTACGAGAGTATTTGA ATCTTTGAATGTCTCGATCGAGGTCTCGATGAAACTAGATAAGATGAAGT ACATATGATTCAAATCACTGATAACGATGAATTTATAATGGGTAATAAGA TTGCTCGCTAATTGTAATGCCTACAAACAACACTGTGTGTCTACGCACTT GAGTCATATGGTCTTAATCTGTTAATCATCAAATTTTCGTTACCAAGCGC TATTATTACGCGCGTTCATAAAGCGTGGGTGCTTGGGAAAGAATAAAGTG TGCTTAGTTTCTGGGTTGTTTTGCACCATCATTGAGTAAAATAAAAGCTT GATATATTCAATAGCGTGTCAGGCTTGGCAaagcgttgttactaaaagtg gtaacagtaggtaacgataggtaacgataggtaacgacaagtaacggtag gtaacgacaggtaacgatgaagtaacggtcggtaacgatgaagtaacgca agtaacgaggggtaacaaaaaagtaacgaagtaacgatgggaaaaaaact gaaaatggtggccctgaggtgtcgaactaacaaaatttgtaaatttctaC GCCGGTGCTAATGGTTCCGGTGATTCTGGGAGAACCTAACGACTCTAGTT AATCTATTCAAGAATTTTAGAAATCTGATGATTGTGCAGTAGGATCTGAT CGTTCTGCtgaatatgactgtggagataataaatccaatcgtttttattg taaattggtgtttgtgaataaactgaaagatttgacggcTTTGGTGAATC AATGNatctgatcgttctggtgaatatgactgtggagataataaatccaa tcgtttttattgtaaattggtgtttgtgaataaactgaaagatttgacgg cTTTGGTGGATCTTTGGTGGATCTTTGGTGTTAGTCAATGCAATGTTGaa ataaatggtgctggtcaatccagtgatggaatcaatggtgctggtcaatg caatgatgaaataaatggtgttggtcaatgcaatgatggaatcaatggtg ctggtcaatgcaatgatNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNaacaatggtgctggtcaatgcaatgat gaaatcaatggttcaggtgaattcaatggtggaatcgatggAGGTGTACT GTTTGATGCAATGCTGCACTCACCAATTTCTTACTCCGCTCACTTGCCGT ACCTTAACCCGTGTAAGAGACCGTAGTAAGTGTATATTTCAANGATCTAG CTTTCGCATTAAGCTCTTTACTtcatattggctggatattggtttatcta acaaaaagcattcacatggttaatgctttgtaagagggaaaacccgGTGA AATTTGTTagaaattgttcgaaaagatctccgAGAAAaccctagcctggg aatccatgctatgatttcttctttgataaactgatggcgaaatgtatagc atggtatgggctgagagtttgaatttctcaaatcctaataacggttgaaa acatagccaatcaaatatTGTTATTCTTtaactggtcacactttcttaga gaaagctcaactttcgaaattttgtttttattttagtaagtgaggacagc gctaaattcgaatttcccactgtaaaaaatgtgagtccaatattggactc acagctcgaacccgtcttgtgtacatcaaattatataaaaaaacacacga cggttctcctgtctaagaaaacccagaataaagatcttgctaaaaaaatt tacgttttcgagttttCGCTTtcgaaaagtaatatacggaggagatattt tcgtgttttttctacactatactacattttgtaaaatacaactatgaaaa tcaaaatggcgacaagcattttcagtggatcatggattttcttcatcatc taaaatacagatttacagctttctactcNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNTaacatctttcaaattctccttattgtagactctaaaattgacat ttttcaaatattatgcattatgcattatgcaatatgcattatgttttatg cattatgttttatgcattttgaaccTGCCGNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNttccatcattgcattgaccaacaccattgatttcat cattgcattgaccagcaccattgattccatcattgcattgaccagcacca ttgattccagcattgcaatgaccaacaccattgattccatcattgcaatg accaTCACCATTGATTTcttcattgtattgaccaacaccattgattccat cattgtattgaccagttCCACTGATTTTATCATTGCATTggccagcacca ttgattccttcattgtattgaccaacaccattgattccatcatcgCATTG ACCAGTTTtactgattccatcattgcattgagcagcaccattgattccat cattgcattgaccagcaccattgattccatcattgcaatgaccaacacca ttgattccatcattgcattgaccagcattattgattccagcattgtattg accaacaccattgattccatcattgtattgaccagcaccattgattccat cattgcaatgaccaacaccattgattccatcattgcattgaccagcatta ttgattccagcattgtattgaccaacaccattgattccatcattgtattg accagcaccattgattccatcattgcaatgaccaacaccattgattccat cattgcaatgaccaTCACCATTGATTCcttcattgtattgaccaacacca ttgattccatcattgcattgaccagcaccattgattccatcattgcaatg atcagcaccattgattccttcattgtattgaccaacaccattgattccat catcgCATTGACCAGTTTtactgattccatcattgcattgagcagcacca ttgattccatcattgcattgaccaacaccattgattccatcattgtattg accagttCCACTGATtttatcattgcattgaccagcactattgattccat cattgcaatgaccaacaccattgattcgaTCATTGCAATgatcagcacca ttgattccttcattgtattgaccaacaccattgattccatcattgcattg accagatttactgattccatcattgcattgaccagcaccattgattccac cattgcattgaccagcattattgattccatcattgcattgaccagcacca ttgatttcatcactgcattgaccaccaccatttatttcatcattgcattg accaacaccatttatttcatcattgcattgaccaacaccattgatttcat cattgcattgaccagcattattgattccatcattgcattgaccaacacca ttgattcccNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNcaggagatgttcagaaagacctaaggatctcaaaacacccaaaaa ccagaattcgacaattttttcgatgattttttatttttgggtagactacc accttaagcTTGCAGCCGGTAAGATTTTTCGGTTTTATTCAAAAAGTTTG ATGTTTAGTTCTACTTAGTTTAGTTACATCAGGCCCTCAttgctttttta tttaaaaaagatttattttataCCTTTTACAATCTCATTCTGAGACATAA GGCTTAAAGATTAGAGCAAGGGGCTAATGCAATGCTGCAATCCACGTCCA AAACTTGCTTGAATGTGGTTTTTTGTTATTTACTACCGTGAAGtcggtaa cttgcatcagtggaggctaacatgtatatgacctggctggtcattaaaat acaaagttaaatcaaaacaaaaatggtagagtagagctgcaagcagaGCT GCGCACGGCTGTTCCaatccagacccgatcaatcaaacttgtcaaaccaa tcgaactaatcgacgAACCCCATCAAACGTTTaaagttcaattaaaaaaa tcaatcaaacactaagattttttaaaagattgtgagtgtacgattaagtt cgatcaatgggtttcagTTCGATCTGtccgataaaccaattttgttcgac aagtttgtgctgctccgccaccgtatattaatagcttcttttcaaagcca atttggaatgtaaatcgggaaattactttcGAAAAcagattacacacttt tcctgtatccttttagcgccagagggggtttgttggggcgtagtattccg ccactcggctGCGTGCGAACctaaactaggctagtcttacctcttttatt tttcctttaacaacaatacaatgccagtgaagtcaagtttgaagatattc tttattagaaaaacagttaaaagcagtcaaaacgcaatttaccttacctc ctgagtttgtctttgttatgctaaaaNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNCCCCGTAACTATGCCcggggtacccgttg ctaagaccttatgttaaaaacaaaagcgattacggcaaaaagtagcgatt ttcgtaatacctcaaatattgatacttgactgtactgaaTGCTGACaggt tgacacaacacattgacaagtaatccctgagagaagttttttatattgaa atctgcaacaaaaataaaaagtgatCTCTTCTGATTCGTCGGAATTTTTC AACTAGCAGAATATATTTTCTAACCTCGTTTATAAGAAGCTAGCTTTTGA AAGTTACACGTAAAGCTATAGATAAAGTGACCTTGGGACAATACTCGCTG CAGTAATAGAGAAAGTGGTTAGTTTGGTAAAAgtgaacttagaaacactc ttaaaagttacaaagaataaagcgatttgataaaagtgatatttgaGACA CTcataaaagttacaaaaaagcgatttgataagaTCGATCTTAGAatcac tcttaaaagtttcgaaaaaagcgaaaaaagaaagtaacgaagaagcaaag aaagcgatttgataaaagtgatcttagaaacactcataaaagtttcgaaa aaagcgctttgataaaagtgatcttagaaacactcttaaaagtttcgaaa aagcgattcgataaaagtgatctttgaaacactcttaaaagttacgaaga aagcgatttgataaaagtgatcttagaaacaccatggcgtcctccagctt tttggtcccccctaatatgagctaaaatcccccatctggcctttcccccc acctgtctttaaaatttgtGCTCCCCCCCTaattgggaaatccccctagc cgtattgtataagagttgcgaagtgatgatccagactcgcctcaattcgc aagctactatagcaaaaaaaagactctcaaaatcccaagaaagacaggct cataagCCTGAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAgagtaagagacag gggtgtatgtgAGATTTGTTcttgatgaaatgaatttttaagAGAATCCT CATTATTACTTGTAAattcttttgtagattttttcctaaaaaaaaaacag atttgtTGTTATTTCTTCTTTCGCTTTTGCCACAACTCTTTCTATTTACC TAatcagccctttttacgccaNTTGCAACatacaattttatgaaactaaa tagaaacattcaaacattaaaacaaaaaagtcaaaaagcctaaataacaa ttcgggaaaggtAATCGGCctaatcggccctttttacgccggcccttatt ggtgttatttttgggctcgtgcgTGGCGTGattaagggccggcgttaaaa ggaCCGCcgtaaaatgggccaaaatctttctatttttaCTTAAGCGGCGT TAATGTATTCACATTTTGTTCTTGTTTAAAGCAAtccagggccaaatttg gagtaaaaaattttcttacagCTCTAAATCGcgatcgcttcgctcgcgtt ttGTCACGCATCTGAAACTCAATCTAATTATACATAAACGGTAGTAgctc aaagtgcttgaaaaaatccctgctcacccttcatatatttgtttcaatcc atgATCCTAAACAGTCAGGGCTtccttggtcttttttaacattagttcgg aaagaataaaaacataTCGTCttctgctctaacttgggacggttggtcga aacatgggacttaTTGATATccggcctgtattttcacttacagtgaggct ggaacttcgatttttgaggattacgattttaccagctttttagcaatttt tgccacgctaacccaaatctcgcaacctctttaccttaaaggaaaatcga aattagagtttttcagcgttccgaaaaaaacgcaaagcaaaaatcttttc atcttcacaggatcgattctcaacaacaaaatacatcttttggtctttgg gtttgtttctgacgtttttccttcaaagaatatcgatcactttccttttc ccctcgagtgcgcgagaaaaaaatgattagcttgcattctcgcgcgggcg aataaagatgaggcggcaatcttgcactgagggtgctacttagcttccgc cctattttgcgcccacaatagaatggtccaaatacgggggtattccaaat gataaacaatgtcgttctgtaagtgtttattttctaagagatacaaatag tatattgaatattattaacttatttatttaagtatttaagagcccaaatt taaaattctggttaaataaaaaacaaatgatatcagttctgtttttcctc aaacccccaggaaaagttttttggccgacttagctattttacaaatttcg gaaaagaactcccataggaattccgatacataaccctATTGGTTCATTtt ggaacggcttcaagaaagtcataatggcagatgattttaaaagtttctga ggaagtGTGTGgaatttattgatgttgatggcttgttgattctttaaaga aaaaagataacaggtatagctttttctaatcctggaatattgagCTACAC tgacttactgttaaatctgtTTTGATAACTCCGCCAAGTTAATCAATCAT ATATTTTCTGTCATAatatgtcacgataactttcactgacagcacaccct ttttaacttttttgttttcattcaaaatgaccggatgcAGATTGGAGAAT TATAGAACGCCCGCCGCCTCACTGCCTAtcacccgatgggattaacaaat aacgagtgggTAACTTGCCGCGCAAGTGATGTCAAaagctccatcgtttt gccactaatttgttcttctttgttttgacaCACTTGCGtatgttccacta cagatttttatcatatttcgatttaaaagcttactcggtgcaaaagagaa atagtgtattttttaatatgccgttcattaactcaaatcaaaagactttG GAGTTTcgatgaaatggtggccgaattgccatcccatgttttCTCAGATA GTCCCaatttagagcagttgacggtacctgatcaacacaaccaaaccttc tgtcttgcgtttactctttctttcccaacaactttcgtatttggttatgt aggttttaaaatccacaagtaatgagaGGTCAACATCCCTAGGAAGTGGC AAGGAAAATGACTATTGATGTCAGTTTATGAGgagagaaccccctggaaa cctttaaaataacgcccttggaaaatctgaaaaataaacaaaaacccctt ggaaaatcaaagctcacccccctggaaaagtttgtcaatacccctCTATG GTTTAACAATGTAATAGCCCAATTCATCCTGTAGAGATGAAAATACATAA TTTGCACTATTTATAAAATGGGATTCCATAAAAAGACCCATGAAACCAAT GGCTAATTACTATTTCAGTCCAGTTTAACAAAACCTGGTAGCAACATATA GGCAATTTTTCCTCTTGATAAGTTAAGGCAGACTCTCTAAATCTTTCATA gaattccaacattgaatttcCCTTCTGTCTAGATATTTTCTCTCAGTTTT AAACCTCCTGGAACCACAAGCAATTTTGTTTTTGGTGAAGAAATATTTGC TAATTCATACTGGCTAATTCAACCTGGTCAGCAAAGGGTGAAGTATCTAG GACTGATAGTAAGGACAAAACGTATTATCAATCCAAATTTCTTTATTATA TACAAACAGAAACAAAATATAAAGGTAAAGTGAACAAATAATGATACACC ATGGCAAAAAGTAAATCTGAAAATAAGTCACCTAAAAAGGACAAACTCAG AGTAAATAATAATCAAAAAGACGCCAGTACAGACCAACAAACTGTtgaaa aaccaaacaaaaaaattaatgcaaCCAAAGATTTGAAAGAAGAGATTGAT GAAACAGTAGAAACAAAAGAACAATTAAAAGCTCAATCAGACAAAGATGA GCTTTCAAATAAAGAGCAAAATGAAGTACCACAGCAcaatgaaaatgata gttataatGAATGGAACCAAAAATTGTCATTGCTTTGTGTATGGATTCTG TCAATGATTACTAGGCTTTATAGTCTAGATTACCCAACAAAGATTTGGTa tattgtttttgttgataGAATCGTTCTTGTGCTTTTCATTCTTAAGTTTA CCTACTTACTTTCGTACCATTGACTAgtagtttttgtattttgactgttt cttttttttgtagcTGGGATGAAActcattttggaaaatttgcaaATCAC TATCTCAATGGAACATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGGT TTGATAGCATTTAAGTCAATTTTTAagtaaatttgaattattttgaaaat tagattgaggtcaaaaattttgacagAATGCTGATCTATGAGGGATAATA TTGATTAAAGactaatttttcaaatcttccagGAGCATAATGAAAAGTTG AATATTTTAAGTTTAAAGGAAATCTAAGGAAAGAAGAATATTGTATTATC AACCCTTCTTTACTTTTTATtcagcttgaaaaaaaaattaatttatcaaA TATATTGTTTTTGTAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCT ATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAATACGGAGAACAT AGATATGTTGGAATGAGAGCAGTATGTTaaaactactttaggcgtacaaa ctttcgcaacagaaactttcgcaattttggcccttttcgcaaaagtaaat gtctttaaaaattcttgacaaaataaagaatctgtaaaacttcaaacttt aaatgaaatgtagatttatggcactttttagcctgttaaaagactaataa gacaaaagacaaaagtttcaagccaatccaagaagtatttgtccctctaa gccattttttttttcatgtgaaaattttcatgtttacttcttgattcgcg aaagtttatgcttgcgaaaaattttccatcaaatttgcgaaagtaaatgt tgtaaattttacgattttttaacctctcaaaagtttctgcttgcaaaact ttgtacgcctaaagtatcttctttcttcttaaCATTTGGCTAGAACAACC TTTGTCCACTATTTGTTGAATTTTGATCTGATCTGCATATCTTAATAACC ACATCAAATTCTTTATTGCAATACTCTAATTAATCATATTcaccttttta ttattttttagttttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCT TATTTGATTGTATGGGAATTGACTCACAATCTTCCTGCATGTATACTTGC TGCTTCATTGAttctttttggtaaaattttattttcaaagctttATTTAA AACATTAATACGGTAGTGTATAATCTTTCAATAAgttataatttcatttt ctcattttcaatgTAATGTTTTGGTATTCTTAcaaatgaagtataagccc gaaggactagaatcgaatctctttGGTGGGATTTGAAGCCattaaatcct accaaagttgttCGGCCTTGGGCGGCCTGtgtggtttttatacaaattcc ggattaaagattcgcttctagcccttatacttcattgattcTTACTCTTC TTTGTGTATCTTTGATTTACTTCATAGATCACGGGTGTATAACGATATCA CAGTACATTCTATTGGATCCAATCTTGATGTTTTTCATCATGATGTCTGT GTACAGTTTATTGAAATTCTACAGTTGGCGTGATTGGTGAGTATTTATTT TGTTCTCTTTGCGAAACCTGGAACTTGCTGTTTATTTCTCAATCATTAGG TATAGTGTTATATAATTATAAAATAGATAATAATCACTCATGTAAATATT TTAGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATAT TTCTTGGCTTGTACCTTCAGGTGAATTAGTTGTTTTATAATCATACTTTG ATCCCATTTCTTCAGTAGTACCTTACCACATCTTACCTTTGTCAGTTGTT CTCAGTACAATTAAGTAAATAAAAGAGAGATTTTCTTTGGATCCCAATTC AAGCTCACTtctaaatcatttttgaaagcATAGCTTTTGTTTTTAAGATG AAATCCTtacctttttcaaaattaaattttttttcagcgtCAAATGGGTG GGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATG GGATATTCTTGGCGATCTATCAAATTCTCTGGTAAGAAATTATTTagtat tttggacttttgaaaGAGTTTTCAGTAAATGTAATTAATATTGTAACTTA TtgcacgaatattactaggcaagtattcaacggcttTGAAATTTGAACGA TCTGAAATATTAACACTAATTTTTCAAGAGAACAATCCCGGGCTGATTTT TATTAAGGGACATTTTATGAAcacaaaattttacaatttgTGTTAATaga atgactagtaatattcgtgacCCACCCGgtaattgtaaaaataaaatgta gGTTTTTGGTTTGACGTCCACTGAAATTTGTTCAGTGTGTTTACAgccaa aaaactttaaaaaaaggatagcctattctcaacttcagttgagttagaat ctgagaatgtctgtctgtctgtgtgtgtgtctgtgtgtctgtgacaaaaa ctttggggcaggctggagacttcaaaaatggtccgattgggctgaaattt tgaacaCTTGATCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttttcatttttt caaaattttgatttttggggcctggggacgagtttttcgccaaaacgagg ctaaaactttggggcaggctggagacttcaaaaatggtccgattgggctg aaattttgcacacttgatccttgggcaaatccctgggggtgtttttttca ttttttcaaaattttcatttttggggccttgggacgagtttttcgccaaa acgaggctaaaactttggggcaggctggagacttcaaaaatggtccgatt gggctgaaattttgcacccttgatccttgggcaaatccgtgtttttttca ttttttcaaaattttgatttttggggcctggggacgagtttttcgccaaa acgaggctaaaactttggggcaggctggagacttcaaaaatggtctNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaattttaattttt ggggcctggggacgagttttttgccaaaacgaggctaaaacccaaaatgc tataatttttcttaagccattaagtttacaattggccctacgaatgattt caaagatactgaagttgagccagtgcggttagcacgttcgacagtgaATA TATCAATATATCTAACTCGAATTCATctcttattttgataattttcttgc GAAACCAGAGATGTTTTTCCAAAGTGACGTCTGACTTTTCGATCAAGTTT TCAATCAATTGAGAATTGGTACACCAAGACTAAAAGATAAGTCCTGCAAA CTAGgttcgatttttaaaaataggtaTAGTAAAAGATGTCTTTTTAAAGC ACcctcatttttcgaaattttgacaaaactgacgtcaaaaacgtctaaaa gaAGCAATTTTTCTATTAAAAATGGAACTAAAACTGATTAAAATGCTGCT TTAATAAAATACCAAACGAGTCAAAACTTTACcgtttcttttgataattt gaCAGAAGGTCATCGGttagagacttttttacaaaaaaacattgTGATTT TTATCCAAAATGGTTTAAAATGGAATTATGCACTGGGAAAGATTCTTTAG GTGACAAATCAGTGCCATTTGGTTCATTTTTGTACTCCCAATGATTATTT GAAGCgtcagaaagaaaacaaaatttatcGACGTTTTGGGGTTCAGACAG TGTAAGGTAATGTGTGTTGCATATTGGTTTTTTATCACAGATTCAAACGT TGTACATATCTAATATTTTAACCTCATTTAGCACTTTTCTGTAGTAAAGT ATCTCCAAACTTAGATAATTGATTccttatcaaattctttttcagGTTGA CGTTGGAAAACACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCCTA TATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAA AggtaaattaaattttttggttcTCGATTTTTTTGAGAATCTGAACTTGC TCTTGCTTGCTCTATAGTTTTCTTTATGTcatcaattaaaaaattaaaat tttttaattgattatcccttaatgaaaatttgaagagaaaaaaaaatggc actctttttctttcatagtggtccAGGAGATGGATTTTTCAGTTCCTCCT TCCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGT GAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGG AACATTACTTCATTCACATCAACATCTTTATCCTAAAGAACATCCGCCAG AACAACAACAGGTATGAATCTTCAATAGACTACAAGTTCAAAATGCTAAT TAAGTTGATGGACTGTGGAGCCAGAAAAACGAATTTACATTAGAGGTTGA ATTTTGATCAAGtttgtttgaattcaaaaaaCACCTTGAATCATGTATAT CAATTACAAAGGGGCATGTTGAACCGTGAAAAAGAACGCTATTATACTTT GATTTTCCCGGCATGTTTCGGACTTGGTTCGTTCTCAAGGGAATGACAAA GGGGCATATATGACCTACTTGCTTGTTAAAGTTGAGTGAGACCCATTTTC TtgtcttttatatttttcatgttcTTCTTTTGAACTTAAGTTGAAATAGA TTCAATGTGGAAATTTGAATTAGTTTTAAACTGACATTGTCATTTCAGAT TACTGGTTACTCGCACAAAGATTCAAATAATGATTGGCAAATTAATAAAG CACACCATCTGATCAGTAAGTTTTCTATACATCAATACgaaaatatttta tgtttgtaCTCTATTATGATAATATGAGTATTTTTATGCATCCTTGTTTC CCGCAATACCTAGCTTGGATACCCAAGCTGTAaactatatttttcatttc gattcTTAGCTGAGCGCAGCATTAAATATTTACAAATTACGCAGTAATTT ACTGATTATGGAAGACCAGGTGATAATTCAGAAACATCAGAATAAGAAAA ATACTTTACTGACTGGTAATTTATCacctatttttcctttttttttagcT GAAGATGATCGATTGGAATACGTTCGTGATGGTGATGAAGTGAGATTAAT GCATGTACAGTAAGTcgtttttcaaatcaaattctTGCACCTCAGGCATA GCACAAAATGTTAAGTTTTCTGGAAATTATTTCAATAGACCTTGtctgag ttttttatttttccaaaagaacgatgcattgtggaattgtttcgggggta ttacaatagaattccctcgaggaatttcTCAGAGATTTCtgttgtaatac ccccgaaacaatcccataatgcattgcttttttagaaaaatcaaaaactc cgttAAGATCTATTGTGACAATCACAAAGTttgttcaataaaaaaaatac gaTTCTTGCTACAAAGATTTATGTTTGAGATCAGTACCATGTTAATGATT AACCGATTTACACGTACTCGTATTTCCTTAGAACACGTCGCAATTTACAT TCCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTCTCCGG CTATGGACAAGTAAGTTAACGGAGAAAGACTGTTCAGTTTTGAGCTTTTA CCTACACAATCAAAGTTTTATCTTTAGTACAATAACTcgcaaaattcttt tttcatgatattttgGAGCTgagtttattttttcaaattatgttgcttga ttaattttgaaaaaaagtttagaCCCTTAAGTGAATTAATTTACACGAGA ATTATATTCCACCAGATTTTCCGAAAGTTAATGCTTCCGAAAATTTTGCC ATAAACATTAGTATTTTTGCTAAAACCcctaaaaaaatgtaaataatttA TTGGAAAAGGGCCCGATACGCCAAAATAAGTCAAAagcgaaaattaaatt atcttttaaaaaaaatccacttaaggtaagttaaatttttgtaaatcgAT ATTCCTACCTCTTTAGGACGGTAACGGTGATGCCAATGATATTTGGCTGA TTCGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAAA ACCATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaac tgaaaaacaaCTGCCCAAATGGTGAGCCCTCTTTGCTTTTCAATAGAAAT GAAAACAAGACTAAATTTCTTAAatgtttttatcgttttttatatTAGAG GATTTGGCAATTAAAGCCAATTGGGTGAAATTACTGAGCTTTATAATAAA CCCTGGAGGCAGTTTCCCCAGCCTACCAAaatctccgatcaaagatggtg cATGTGGCTTCGTCCAGGATTAATAAATATTCTTGGGTGATAAACAGTAT CGGATATCTGAAGATTGattgttttggaaaaagttttttttcgtaTTACT TCCGAGTCTTCTATTTATGATGTTATAACCCTTTCCTTCTTTTTACATAT TTCAGGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGT AACCATCGTCGGAAGCGAATGGAACATCGAAAGTAACACTCATAAAAAAG GTaggaataaaaattttaataaattctGTCAAAACTTTCACGATAAAGCA GGTATTTTTTGGAATATGTGTGGCATTTTGACAACGTGACCGCTAGGGCT ttctatatttatttcaaacgAGAGCAGGAAGTGTTTCACAACAATCACCT TTGTGATCATAAATAAGGTATTGTTTAGTTAAGTTCTATCCCCATTCTTC CACCACTAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTC GAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGGTGAGGTTTAAATA GAAGGCATTGTTATCTACtctaaaatgctaaaaaattagaATTTATTTAC TTCTCGTCTACATATTTGGCTTTGGAAGTAGATTGAATGATTCGTAAATT AGTTGGATAACTAAATTATCCTTTATTATTTTCTAGACGAACAACGGATT CAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTGGCCCATCA ATTATCGCGTAAGGTTTTGCtttcaaaaattacaatattactaATTTTTT TATGCTACAATCTCAACACCAATCAGCCACAACCTCTGTTTCTTCGTTGG ATTCCTTCTAATAATTTACACTTTTTCAAAGTtgctttctttttgatttt attttcagggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTC GGCAACCCGGTAAGACAACTCTTTCTGCTAATTCTTTTTTGGTTGttacc atagatttataaagcccgaagggctagatgacgtactttaagccatcgca ggcaaaaaaaagtgaatttcgaaaaaatgttgttgctattgttttcgaaa acctgcaaAGCTTATGATTGGTCAAGTgctgaaattttattgtaatgtca cgtgacctaggtaagatttagcaaaagtacgccatctagcccCTCGGGCT AAATCTCTGGTTGTTACCTATCATTTCCTCCTTCCCCTCTCGACAAAGAT GTGATTTTCAAAATGCCTAATTGCAAACGGCCTTTGATTATGAACTTGAC CAAAGCGTTATAATGATTTTCTCGATGTCTCATTCCGCAGATTGTGTGGT GGTTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTCATACAA ACACTACGATGGAAACGAGGCTACAAGTTCGATGCCACCATTTACGGTAA TTAATCCCTTTGAGTCAACTTAAATTCGATACTTTTAGATTTGAACAATT CGTTAACAATTAACATGAACGAAATTTTTGCCGGGAAATTATCTGGAGCA ATCGGCAATTTTATCCTGATAATTCTTGAAACGAAACTAGATAGTTATAT GAAATTTTAAAGAAGGAAACGAGAAGGGAAGAAACCTAAATTTAgatgta atttttcttttttacagcTGAATACACAACAATGGTATCATCATGTTCGT GGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCCATGGGG CGTGTTTTGTATTTCCATCACTATTTCCCTGCATATTTGTTTAGTGCAAT GTTTTCAGGTAGAGtcttatctttttaaaaaatgttgacGGTTTTCGTGA ATTTTAGAGACGTTTTTTCCGGTATATTGAGCTGGTTGTCACATACCCGT TGGACCCATCCCCactagaaaaattggccaaaaatatctTCCCCGTTGGA CAAATTACCACAAAATTTTAACCCCACTTGAAAATTGCCCTATGATTTTA TACCTAAGATGTAAAAATTGTACTCTGAAACCATTCCCACTGGCGTTCTT GAACTGGTTGTAATAGATTTCCTATCTCCATTGGTATTTCTATAGAAATG TTCATCTCTACTGAGAGAGCTTTGAAACGGGGATGGGGTTGTTTTTATCA GCGAAATCTACGTCTTTGTAGCAAAAATCTTGTttataggccttttcata aattacgtcacgaacatcacttgcctcgtattcaaacaattaccatggtg attatgtcccttgagacatgaaatgatttttttataaatgaaagcAGTTT TGCTACAAAGACGTAGATTTCGCTGATAAAAACAACCCCATCCCCGTTTC AAAGCTCTCTCAGTAGAGATGAACATTTCTATAGAAATACCAATGGAGAT AGGAAATCTATTACAACCAGTTCAAGAACGCCAGTGGGAATGGTTTCAGA GTACAATTTTTACATCTTAGGTATAAAATCATAGGGCAATTTTCAAGTGG GGTTAAAATTTTGTGGTAATTTGTCCAACGGGGAagatatttttggccaa tttttctagtGGGGATGGGTCCAATAAAATCCACTGGGatttaatcacca tggcaatgatttcaaaacgaggcaagtgatgttcgtgacataatttatga aaaggtcttttGGACTTCACCTAATCAGACAGAATCAGACGTTGcattca aaatcttttaaatttattttaggcATCTTATTAGAGCACGTGTCAAGAAC CGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTT GCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGGTAAGTATTACccggg ggggcagtcaggcaaattgaccgacgggtatgtgcggcggttaagggtat gtttttcaaaatagcagaaatgcactgtaagggtggacttttgataaatg cactgtatgggtggaaatttcagcaaatctaggaaaaattggaaattttt acccaaaaatcttgatttttttgctctagaaaaatttaaaacttgaaaac atgcactgtaagggtatgaatttcaccgatttttttctgcactgtaaggg tgcgattctaaaagccaaacttttcgccgcacataccgtcagttggtaaa cctaCTGCCCCCCGGAAGTATTATTAAACTAATCTTGATTATCCAAGCCA GGGAGCTATAAAGGACCAGGACTTTGCTATCCActcagaaaaaaaagttt tatcgtCGCTAAACTTTAATCACGACGGTTgacattttttcagttcttct gTCTGAAAATGAATACTTCGAATTGGTGTGAATATATGCAATTCAAATTA GAACGAAGGGGTAGTTAAGAAAATCACAAATGTAATAATCCTTAATTCTT ACTAAAATCGCCTTAAAAAAGTTGTATTGTTTTATTGAATCATACACCCT TTCTTATTTATatccttgattttttttagtttttgcatGTTCCGTGGTTT ATCATATGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAACCATGG CTGCTTATCGATGGCTCGATACTTGGGATATTTAAATGAACATTTTTATG CTGCGATGATGATCAAACAGTTTTTATAGAAGCAACCTTAATAGATTCAC TTTCTAGACCAAACTAGAATATATTGAGAACAATCTAAAGCTGTCAGAAA TTTAACGGCTAATTAGGCAGTGCTAAGCATAAATTGAGCACCAATAAAAA AAACTGTTCCTTGTGAAAGAAAAGGGAACTTCTTGGGAAGTACTTGCTCA TGACAACAGAGGCCATAATCAGCCTGCAATTACCATGCAAAATGAAGATT TTATACTGCTagttttagaaaattttatgatttgGGGGGCTTGGCTAATT CAATAACAAgtagatatttttattatttatttggaGATGATACTCTACGC TTTAAAAGtatataatttttaagaattttgataAATAATTGGCATGAATT AGCTGAAGTATGTAtgtttttctgtttgttttgtaatttttttaatgtca ttttttatttttatgaatCCAGTAACAGTACACATTATCAGAAATATTAC ATTGAAATATTACACAAGTTTATTTTGTTAAAGTTATTTCGTGGATCCAA CATCTCAAAGTGCTTTAATATTAAAATACAAGTGGTCAAAAGACAATAGA TGTGTCACAGATCTGATCTTGCTATACCAGGTGAGCAAACtacctaaagt ctgtctcaatataatctgcagctaagacaaaaaaggctgtaaattttgat agaattcggaGAATAAGATAGATAtgttgtgcttgttgaaaagatattta gtgaaatattatcaaatagaaaaaagactttgaaaaaagttatatccttt tttgtctccgctgcagattattttgagacagactttaattttcaTTAACA TTTGAAAACTACAATGGGCTCTACTAGTCTTAGTCACTAGTCAGGTGGTT TATAAAATCCAGATCaaactaccgggtgcgccagaaaaaagaaaacttta aagtgCCATAAACGGGCATTTTCTTGTCTGCTTTATATCTCACTAAACTC GATCTAATCCTTTTTTAACACATTTTTGCcgaaaaaggactgggacggtt ttagtgggataaagtggacaaaaaaatgcccgcgcgtccaattggtggct acggtcgaaaaggtgtattcaaggAGGGTAACTTATTTTTGACACACTCG GTAAATCAAGACGCATGCTTGAAGCAAAAGATTTCCTGCCCCCTTCATTA TATTTACAATAGTAAATTGATGGATTCATTTATCCGAATGTGGTTGTAGA AGATATTGAATTTGAGATATATCATATTTTCTAATACATTATAAATCCTA CTTACATACGTTATAacattaattcaaaaatcataaTATATGAAAAGGCC TTTTGACCACTATTTGAAACAAGCAAAATGCTGTCTTGATTAATGTTGAG TTCTTCGACACCTAACTCGTGCAGCATCAAATTCTGATGAACCCGGACAT TCACGAACTGCAGGCTGTCCGTTATTCCGACATATGTAATATTTGGAACG CGAGTGAGGATATGCGTACACAATGAAGGGTACACGCCCAACACACAAAT CACCAACGTCATTGGTCACATCTTCAT

Coding sequence (CDS) from alignment at sc0000011:659514..690240+

>TCONS_00001593 ID=TCONS_00001593|Name=TCONS_00001593|organism=Clytia hemisphaerica|type=CDS|length=49959bp|location=Sequence derived from alignment at sc0000011:659514..690240+ (Clytia hemisphaerica)
ATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTCTGAGTCAAAAGA
TGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGATTTCCCTA
AAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAAAATGATAACGGA
CCTCTGATCTCAATACATCTTGATATTTCTTTGTACCTACGAAACTTACG
CGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTTC
ACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAATATAAACCGTTG
AAAGGTTTcaatttgttttggttttatatGATCTTCAGTGTTGCTCTGTT
TACCAGATTCTACACCATTACATTGCCTAAACATGTTTGcTGGGATGAAA
ctcattttggaaaatttgcaaATCACTATCTCAATGGAACATTCTTCTTG
GATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGAT
GACAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAATACG
GAGAACATAGATATGTTGGAATGAGAGCAttttgtgCCTTATTGGGATGT
TTTTGTGTACCACTGGCTTATTTGATTGTATGGGAATTGACTCACAATCT
TCCTGCATGTATACTTGCTGCTTCATTGAttctttttgATCACGGGTGTA
TAACGATATCACAGTACATTCTATTGGATCCAATCTTGATGTTTTTCATC
ATGATGTCTGTGTACAGTTTATTGAAATTCTACAGTTGGCGTGATTGCCC
CTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATATTTCTTGG
CTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGCT
GGAATGACAACCGTGCAAGATTTATGGGATATTCTTGGCGATCTATCAAA
TTCTCTGGTTGACGTTGGAAAACACTTCATAGCACGTGCTATTGGCTTGA
TACTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAA
GCACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAGTTCCTCCTTCCA
ATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGTGAAT
TGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGGAACA
TTACTTCATTCACATCAACATCTTTATCCTAAAGAACATCCGCCAGAACA
ACAACAGATTACTGGTTACTCGCACAAAGATTCAAATAATGATTGGCAAA
TTAATAAAGCACACCATCTGATCAcTGAAGATGATCGATTGGAATACGTT
CGTGATGGTGATGAAGTGAGATTAATGCATGTACAAACACGTCGCAATTT
ACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTCT
CCGGCTATGGACAAGACGGTAACGGTGATGCCAATGATATTTGGCTGATT
CGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAAAAC
CATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaactg
aaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAAT
CCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAACATCGAAAGTAA
CACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCAT
TCTTCGAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGACGAACAAC
GGATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTGGCC
CATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATT
TGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGAACGTATTTTCTT
TACGTCATCGTTTACGTCATACAAACACTACGATGGAAACGAGGCTACAA
GTTCGATGCCACCATTTACGcTGAATACACAACAATGGTATCATCATGTT
CGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCCATG
GGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCATATTTGTTTAGTGC
AATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAACCGTTTCATATA
TGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTTGCTTAGCCACA
GTTCTGGCCATCGCTATTTCAAGtttttgcatGTTCCGTGGTTTATCATA
TGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAACCATGGCTGCTT
ATCGATGGCTCGATACTTGGGATATTTAAATGACTGTTCGAAAAAGAGCT
AATCATACTTCGAATTCTGAGTCAAAAGATGACAATACGAAAAATGAAGA
AGCAACTGAAAAGAAAACAGATTTCCCTAAAGCATTAACAAATGGATCAG
CATCGAAAGTCAAGGAAAATGATAACGGACCTCTGATCTCAATACATCTT
GATATTTCTTTGTACCTACGAAACTTACGCGAGAGTTTAACCACACTTTC
AAAGCAAGATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAATCA
ATCGTTCGAAACATCAATATAAACCGTTGAAAGGTTTcaatttgttttgg
ttttatatGATCTTCAGTGTTGCTCTGTTTACCAGATTCTACACCATTAC
ATTGCCTAAACATGTTTGcTGGGATGAAActcattttggaaaatttgcaa
ATCACTATCTCAATGGAACATTCTTCTTGGATGTGCATCCACCGCTTGGC
AAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCTATAATGGTGAATT
TTCATTCGAAAAGCCAGGCATGGAATACGGAGAACATAGATATGTTGGAA
TGAGAGCAttttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCTTAT
TTGATTGTATGGGAATTGACTCACAATCTTCCTGCATGTATACTTGCTGC
TTCATTGAttctttttgATCACGGGTGTATAACGATATCACAGTACATTC
TATTGGATCCAATCTTGATGTTTTTCATCATGATGTCTGTGTACAGTTTA
TTGAAATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGGG
TTGGATGTTTGTTACCGGATATTTCTTGGCTTGTACCTTCAGcgtCAAAT
GGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGAT
TTATGGGATATTCTTGGCGATCTATCAAATTCTCTGGTTGACGTTGGAAA
ACACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCCTATATTCATCT
ATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgtggtccA
GGAGATGGATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAATAA
ACTTTACAAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGCTGTGGTGA
CGTTGAAGAATCACAAAACAGCTGGAACATTACTTCATTCACATCAACAT
CTTTATCCTAAAGAACATCCGCCAGAACAACAACAGATTACTGGTTACTC
GCACAAAGATTCAAATAATGATTGGCAAATTAATAAAGCACACCATCTGA
TCAcTGAAGATGATCGATTGGAATACGTTCGTGATGGTGATGAAGTGAGA
TTAATGCATGTACAAACACGTCGCAATTTACATTCCCATCCAGAGAAAGC
TCCCATTTCAACAAACCTTCATCAAGTCTCCGGCTATGGACAAGACGGTA
ACGGTGATGCCAATGATATTTGGCTGATTCGAATTACCAAAAATCCTGGC
CCAGACAATCGAATTAGTACGGTCAAAACCATCTTTCAATTGGTTCATCG
TAATACTGGATGTGTTTTGcaagaaactgaaaaacaaCTGCCCAAATGGG
GTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGTAACCATC
GTCGGAAGCGAATGGAACATCGAAAGTAACACTCATAAAAAAGTACCGCA
AGTCAGCGTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGTTTATGAAT
CACACGTTGTAATGGCAAAGACGAACAACGGATTCAAACCGAAGGAAGGG
GAATTTACGTCACAAGCATGGCATTGGCCCATCAATTATCGCggGCAAGT
GTTTTCTGGAGGAGATGAGCGCGTATATTTGCTCGGCAACCCGATTGTGT
GGTGGTTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTCATA
CAAACACTACGATGGAAACGAGGCTACAAGTTCGATGCCACCATTTACGc
TGAATACACAACAATGGTATCATCATGTTCGTGGCTTTTCATGGGATGGG
CGCTTCATTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGTATTTCCAT
CACTATTTCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgcATCTTATT
AGAGCACGTGTCAAGAACCGTTTCATATATGTTCAGCGGTGAACGAAGAA
AGCATGTTTACTACTTTTGCTTAGCCACAGTTCTGGCCATCGCTATTTCA
AGtttttgcatGTTCCGTGGTTTATCATATGGAATGTCAGGACCAATGGG
AAACCAACCCAACCAAACCATGGCTGCTTATCGATGGCTCGATACTTGGG
ATATTTAAATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTCTGAG
TCAAAAGATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGA
TTTCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAAAATG
ATAACGGACCTCTGATCTCAATACATCTTGATATTTCTTTGTACCTACGA
AACTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTGAAGT
CCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAATATA
AACCGTTGAAAGGTTTcaatttgttttggttttatatGATCTTCAGTGTT
GCTCTGTTTACCAGATTCTACACCATTACATTGCCTAAACATGTTTGcTG
GGATGAAActcattttggaaaatttgcaaATCACTATCTCAATGGAACAT
TCTTCTTGGATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCT
GGCTGGATGACAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAGGCAT
GGAATACGGAGAACATAGATATGTTGGAATGAGAGCAttttgtgCCTTAT
TGGGATGTTTTTGTGTACCACTGGCTTATTTGATTGTATGGGAATTGACT
CACAATCTTCCTGCATGTATACTTGCTGCTTCATTGAttctttttgATCA
CGGGTGTATAACGATATCACAGTACATTCTATTGGATCCAATCTTGATGT
TTTTCATCATGATGTCTGTGTACAGTTTATTGAAATTCTACAGTTGGCGT
GATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATA
TTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTT
TGTTCGCTGGAATGACAACCGTGCAAGATTTATGGGATATTCTTGGCGAT
CTATCAAATTCTCTGGTTGACGTTGGAAAACACTTCATAGCACGTGCTAT
TGGCTTGATACTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCTGTTC
ACTTCCAAGCACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAGTTCC
TCCTTCCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACC
TGGTGAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAG
CTGGAACATTACTTCATTCACATCAACATCTTTATCCTAAAGAACATCCG
CCAGAACAACAACAGATTACTGGTTACTCGCACAAAGATTCAAATAATGA
TTGGCAAATTAATAAAGCACACCATCTGATCAcTGAAGATGATCGATTGG
AATACGTTCGTGATGGTGATGAAGTGAGATTAATGCATGTACAAACACGT
CGCAATTTACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCA
TCAAGTCTCCGGCTATGGACAAGACGGTAACGGTGATGCCAATGATATTT
GGCTGATTCGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAGTACG
GTCAAAACCATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTTGca
agaaactgaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGG
CGTGCAATCCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAACATC
GAAAGTAACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTC
GCCATCATTCTTCGAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGA
CGAACAACGGATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGG
CATTGGCCCATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCG
CGTATATTTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGAACGT
ATTTTCTTTACGTCATCGTTTACGTCATACAAACACTACGATGGAAACGA
GGCTACAAGTTCGATGCCACCATTTACGcTGAATACACAACAATGGTATC
ATCATGTTCGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTT
ACGCCATGGGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCATATTTG
TTTAGTGCAATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAACCGT
TTCATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTTGCT
TAGCCACAGTTCTGGCCATCGCTATTTCAAGtttttgcatGTTCCGTGGT
TTATCATATGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAACCAT
GGCTGCTTATCGATGGCTCGATACTTGGGATATTTAAATGACTGTTCGAA
AAAGAGCTAATCATACTTCGAATTCTGAGTCAAAAGATGACAATACGAAA
AATGAAGAAGCAACTGAAAAGAAAACAGATTTCCCTAAAGCATTAACAAA
TGGATCAGCATCGAAAGTCAAGGAAAATGATAACGGACCTCTGATCTCAA
TACATCTTGATATTTCTTTGTACCTACGAAACTTACGCGAGAGTTTAACC
ACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGT
GTTAATCAATCGTTCGAAACATCAATATAAACCGTTGAAAGGTTTcaatt
tgttttggttttatatGATCTTCAGTGTTGCTCTGTTTACCAGATTCTAC
ACCATTACATTGCCTAAACATGTTTGcTGGGATGAAActcattttggaaa
atttgcaaATCACTATCTCAATGGAACATTCTTCTTGGATGTGCATCCAC
CGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCTATAAT
GGTGAATTTTCATTCGAAAAGCCAGGCATGGAATACGGAGAACATAGATA
TGTTGGAATGAGAGCAttttgtgCCTTATTGGGATGTTTTTGTGTACCAC
TGGCTTATTTGATTGTATGGGAATTGACTCACAATCTTCCTGCATGTATA
CTTGCTGCTTCATTGAttctttttgATCACGGGTGTATAACGATATCACA
GTACATTCTATTGGATCCAATCTTGATGTTTTTCATCATGATGTCTGTGT
ACAGTTTATTGAAATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGAT
TGGTGGGGTTGGATGTTTGTTACCGGATATTTCTTGGCTTGTACCTTCAG
cgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCG
TGCAAGATTTATGGGATATTCTTGGCGATCTATCAAATTCTCTGGTTGAC
GTTGGAAAACACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCCTAT
ATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAA
gtggtccAGGAGATGGATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAA
GGGAATAAACTTTACAAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGC
TGTGGTGACGTTGAAGAATCACAAAACAGCTGGAACATTACTTCATTCAC
ATCAACATCTTTATCCTAAAGAACATCCGCCAGAACAACAACAGATTACT
GGTTACTCGCACAAAGATTCAAATAATGATTGGCAAATTAATAAAGCACA
CCATCTGATCAcTGAAGATGATCGATTGGAATACGTTCGTGATGGTGATG
AAGTGAGATTAATGCATGTACAAACACGTCGCAATTTACATTCCCATCCA
GAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTCTCCGGCTATGGACA
AGACGGTAACGGTGATGCCAATGATATTTGGCTGATTCGAATTACCAAAA
ATCCTGGCCCAGACAATCGAATTAGTACGGTCAAAACCATCTTTCAATTG
GTTCATCGTAATACTGGATGTGTTTTGcaagaaactgaaaaacaaCTGCC
CAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTG
TAACCATCGTCGGAAGCGAATGGAACATCGAAAGTAACACTCATAAAAAA
GTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGT
TTATGAATCACACGTTGTAATGGCAAAGACGAACAACGGATTCAAACCGA
AGGAAGGGGAATTTACGTCACAAGCATGGCATTGGCCCATCAATTATCGC
ggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTCGGCAACCC
GATTGTGTGGTGGTTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTT
ACGTCATACAAACACTACGATGGAAACGAGGCTACAAGTTCGATGCCACC
ATTTACGcTGAATACACAACAATGGTATCATCATGTTCGTGGCTTTTCAT
GGGATGGGCGCTTCATTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGT
ATTTCCATCACTATTTCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgc
ATCTTATTAGAGCACGTGTCAAGAACCGTTTCATATATGTTCAGCGGTGA
ACGAAGAAAGCATGTTTACTACTTTTGCTTAGCCACAGTTCTGGCCATCG
CTATTTCAAGtttttgcatGTTCCGTGGTTTATCATATGGAATGTCAGGA
CCAATGGGAAACCAACCCAACCAAACCATGGCTGCTTATCGATGGCTCGA
TACTTGGGATATTTAAATGACTGTTCGAAAAAGAGCTAATCATACTTCGA
ATTCTGAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAACTGAAAAG
AAAACAGATTTCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAA
GGAAAATGATAACGGACCTCTGATCTCAATACATCTTGATATTTCTTTGT
ACCTACGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTT
GCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACA
TCAATATAAACCGTTGAAAGGTTTcaatttgttttggttttatatGATCT
TCAGTGTTGCTCTGTTTACCAGATTCTACACCATTACATTGCCTAAACAT
GTTTGcTGGGATGAAActcattttggaaaatttgcaaATCACTATCTCAA
TGGAACATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGATGCTGCTTG
CTTTGGCTGGCTGGATGACAGGCTATAATGGTGAATTTTCATTCGAAAAG
CCAGGCATGGAATACGGAGAACATAGATATGTTGGAATGAGAGCAttttg
tgCCTTATTGGGATGTTTTTGTGTACCACTGGCTTATTTGATTGTATGGG
AATTGACTCACAATCTTCCTGCATGTATACTTGCTGCTTCATTGAttctt
tttgATCACGGGTGTATAACGATATCACAGTACATTCTATTGGATCCAAT
CTTGATGTTTTTCATCATGATGTCTGTGTACAGTTTATTGAAATTCTACA
GTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTT
ACCGGATATTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTT
TGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATGGGATATTC
TTGGCGATCTATCAAATTCTCTGGTTGACGTTGGAAAACACTTCATAGCA
CGTGCTATTGGCTTGATACTTCTCCCTATATTCATCTATCTTTTCTTCTT
TGCTGTTCACTTCCAAGCACTTCCTAAAAgtggtccAGGAGATGGATTTT
TCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCT
GTTTTACCTGGTGAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCA
CAAAACAGCTGGAACATTACTTCATTCACATCAACATCTTTATCCTAAAG
AACATCCGCCAGAACAACAACAGATTACTGGTTACTCGCACAAAGATTCA
AATAATGATTGGCAAATTAATAAAGCACACCATCTGATCAcTGAAGATGA
TCGATTGGAATACGTTCGTGATGGTGATGAAGTGAGATTAATGCATGTAC
AAACACGTCGCAATTTACATTCCCATCCAGAGAAAGCTCCCATTTCAACA
AACCTTCATCAAGTCTCCGGCTATGGACAAGACGGTAACGGTGATGCCAA
TGATATTTGGCTGATTCGAATTACCAAAAATCCTGGCCCAGACAATCGAA
TTAGTACGGTCAAAACCATCTTTCAATTGGTTCATCGTAATACTGGATGT
GTTTTGcaagaaactgaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAA
AGAGATGGCGTGCAATCCAAATAAGTTTGTAACCATCGTCGGAAGCGAAT
GGAACATCGAAAGTAACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAA
TTGTTGTCGCCATCATTCTTCGAAAGTGTTTATGAATCACACGTTGTAAT
GGCAAAGACGAACAACGGATTCAAACCGAAGGAAGGGGAATTTACGTCAC
AAGCATGGCATTGGCCCATCAATTATCGCggGCAAGTGTTTTCTGGAGGA
GATGAGCGCGTATATTTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTG
CGGAACGTATTTTCTTTACGTCATCGTTTACGTCATACAAACACTACGAT
GGAAACGAGGCTACAAGTTCGATGCCACCATTTACGcTGAATACACAACA
ATGGTATCATCATGTTCGTGGCTTTTCATGGGATGGGCGCTTCATTACCT
CCCGTTTTACGCCATGGGGCGTGTTTTGTATTTCCATCACTATTTCCCTG
CATATTTGTTTAGTGCAATGTTTTCAGgcATCTTATTAGAGCACGTGTCA
AGAACCGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTA
CTTTTGCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGtttttgcatGT
TCCGTGGTTTATCATATGGAATGTCAGGACCAATGGGAAACCAACCCAAC
CAAACCATGGCTGCTTATCGATGGCTCGATACTTGGGATATTTAAATGAC
TGTTCGAAAAAGAGCTAATCATACTTCGAATTCTGAGTCAAAAGATGACA
ATACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGATTTCCCTAAAGCA
TTAACAAATGGATCAGCATCGAAAGTCAAGGAAAATGATAACGGACCTCT
GATCTCAATACATCTTGATATTTCTTTGTACCTACGAAACTTACGCGAGA
GTTTAACCACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTTCACATT
TGGAAAGTGTTAATCAATCGTTCGAAACATCAATATAAACCGTTGAAAGG
TTTcaatttgttttggttttatatGATCTTCAGTGTTGCTCTGTTTACCA
GATTCTACACCATTACATTGCCTAAACATGTTTGcTGGGATGAAActcat
tttggaaaatttgcaaATCACTATCTCAATGGAACATTCTTCTTGGATGT
GCATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGATGACAG
GCTATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAATACGGAGAA
CATAGATATGTTGGAATGAGAGCAttttgtgCCTTATTGGGATGTTTTTG
TGTACCACTGGCTTATTTGATTGTATGGGAATTGACTCACAATCTTCCTG
CATGTATACTTGCTGCTTCATTGAttctttttgATCACGGGTGTATAACG
ATATCACAGTACATTCTATTGGATCCAATCTTGATGTTTTTCATCATGAT
GTCTGTGTACAGTTTATTGAAATTCTACAGTTGGCGTGATTGCCCCTTCT
CCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATATTTCTTGGCTTGT
ACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAAT
GACAACCGTGCAAGATTTATGGGATATTCTTGGCGATCTATCAAATTCTC
TGGTTGACGTTGGAAAACACTTCATAGCACGTGCTATTGGCTTGATACTT
CTCCCTATATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACT
TCCTAAAAgtggtccAGGAGATGGATTTTTCAGTTCCTCCTTCCAATCCA
CGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGTGAATTGGGG
TACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGGAACATTACT
TCATTCACATCAACATCTTTATCCTAAAGAACATCCGCCAGAACAACAAC
AGATTACTGGTTACTCGCACAAAGATTCAAATAATGATTGGCAAATTAAT
AAAGCACACCATCTGATCAcTGAAGATGATCGATTGGAATACGTTCGTGA
TGGTGATGAAGTGAGATTAATGCATGTACAAACACGTCGCAATTTACATT
CCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTCTCCGGC
TATGGACAAGACGGTAACGGTGATGCCAATGATATTTGGCTGATTCGAAT
TACCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAAAACCATCT
TTCAATTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaactgaaaaa
caaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAA
TAAGTTTGTAACCATCGTCGGAAGCGAATGGAACATCGAAAGTAACACTC
ATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTC
GAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGACGAACAACGGATT
CAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTGGCCCATCA
ATTATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTC
GGCAACCCGATTGTGTGGTGGTTAATTTGCGGAACGTATTTTCTTTACGT
CATCGTTTACGTCATACAAACACTACGATGGAAACGAGGCTACAAGTTCG
ATGCCACCATTTACGcTGAATACACAACAATGGTATCATCATGTTCGTGG
CTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCCATGGGGCG
TGTTTTGTATTTCCATCACTATTTCCCTGCATATTTGTTTAGTGCAATGT
TTTCAGgcATCTTATTAGAGCACGTGTCAAGAACCGTTTCATATATGTTC
AGCGGTGAACGAAGAAAGCATGTTTACTACTTTTGCTTAGCCACAGTTCT
GGCCATCGCTATTTCAAGtttttgcatGTTCCGTGGTTTATCATATGGAA
TGTCAGGACCAATGGGAAACCAACCCAACCAAACCATGGCTGCTTATCGA
TGGCTCGATACTTGGGATATTTAAATGACTGTTCGAAAAAGAGCTAATCA
TACTTCGAATTCTGAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAA
CTGAAAAGAAAACAGATTTCCCTAAAGCATTAACAAATGGATCAGCATCG
AAAGTCAAGGAAAATGATAACGGACCTCTGATCTCAATACATCTTGATAT
TTCTTTGTACCTACGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGC
AAGATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGT
TCGAAACATCAATATAAACCGTTGAAAGGTTTcaatttgttttggtttta
tatGATCTTCAGTGTTGCTCTGTTTACCAGATTCTACACCATTACATTGC
CTAAACATGTTTGcTGGGATGAAActcattttggaaaatttgcaaATCAC
TATCTCAATGGAACATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGAT
GCTGCTTGCTTTGGCTGGCTGGATGACAGGCTATAATGGTGAATTTTCAT
TCGAAAAGCCAGGCATGGAATACGGAGAACATAGATATGTTGGAATGAGA
GCAttttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCTTATTTGAT
TGTATGGGAATTGACTCACAATCTTCCTGCATGTATACTTGCTGCTTCAT
TGAttctttttgATCACGGGTGTATAACGATATCACAGTACATTCTATTG
GATCCAATCTTGATGTTTTTCATCATGATGTCTGTGTACAGTTTATTGAA
ATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGA
TGTTTGTTACCGGATATTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTG
GGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATG
GGATATTCTTGGCGATCTATCAAATTCTCTGGTTGACGTTGGAAAACACT
TCATAGCACGTGCTATTGGCTTGATACTTCTCCCTATATTCATCTATCTT
TTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgtggtccAGGAGA
TGGATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAATAAACTTT
ACAAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGCTGTGGTGACGTTG
AAGAATCACAAAACAGCTGGAACATTACTTCATTCACATCAACATCTTTA
TCCTAAAGAACATCCGCCAGAACAACAACAGATTACTGGTTACTCGCACA
AAGATTCAAATAATGATTGGCAAATTAATAAAGCACACCATCTGATCAcT
GAAGATGATCGATTGGAATACGTTCGTGATGGTGATGAAGTGAGATTAAT
GCATGTACAAACACGTCGCAATTTACATTCCCATCCAGAGAAAGCTCCCA
TTTCAACAAACCTTCATCAAGTCTCCGGCTATGGACAAGACGGTAACGGT
GATGCCAATGATATTTGGCTGATTCGAATTACCAAAAATCCTGGCCCAGA
CAATCGAATTAGTACGGTCAAAACCATCTTTCAATTGGTTCATCGTAATA
CTGGATGTGTTTTGcaagaaactgaaaaacaaCTGCCCAAATGGGGTTGG
GAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGTAACCATCGTCGG
AAGCGAATGGAACATCGAAAGTAACACTCATAAAAAAGTACCGCAAGTCA
GCGTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGTTTATGAATCACAC
GTTGTAATGGCAAAGACGAACAACGGATTCAAACCGAAGGAAGGGGAATT
TACGTCACAAGCATGGCATTGGCCCATCAATTATCGCggGCAAGTGTTTT
CTGGAGGAGATGAGCGCGTATATTTGCTCGGCAACCCGATTGTGTGGTGG
TTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTCATACAAAC
ACTACGATGGAAACGAGGCTACAAGTTCGATGCCACCATTTACGcTGAAT
ACACAACAATGGTATCATCATGTTCGTGGCTTTTCATGGGATGGGCGCTT
CATTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGTATTTCCATCACTA
TTTCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgcATCTTATTAGAGC
ACGTGTCAAGAACCGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCAT
GTTTACTACTTTTGCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGttt
ttgcatGTTCCGTGGTTTATCATATGGAATGTCAGGACCAATGGGAAACC
AACCCAACCAAACCATGGCTGCTTATCGATGGCTCGATACTTGGGATATT
TAAATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTCTGAGTCAAA
AGATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGATTTCC
CTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAAAATGATAAC
GGACCTCTGATCTCAATACATCTTGATATTTCTTTGTACCTACGAAACTT
ACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTC
TTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAATATAAACCG
TTGAAAGGTTTcaatttgttttggttttatatGATCTTCAGTGTTGCTCT
GTTTACCAGATTCTACACCATTACATTGCCTAAACATGTTTGcTGGGATG
AAActcattttggaaaatttgcaaATCACTATCTCAATGGAACATTCTTC
TTGGATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTG
GATGACAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAAT
ACGGAGAACATAGATATGTTGGAATGAGAGCAttttgtgCCTTATTGGGA
TGTTTTTGTGTACCACTGGCTTATTTGATTGTATGGGAATTGACTCACAA
TCTTCCTGCATGTATACTTGCTGCTTCATTGAttctttttgATCACGGGT
GTATAACGATATCACAGTACATTCTATTGGATCCAATCTTGATGTTTTTC
ATCATGATGTCTGTGTACAGTTTATTGAAATTCTACAGTTGGCGTGATTG
CCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATATTTCT
TGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTC
GCTGGAATGACAACCGTGCAAGATTTATGGGATATTCTTGGCGATCTATC
AAATTCTCTGGTTGACGTTGGAAAACACTTCATAGCACGTGCTATTGGCT
TGATACTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCTGTTCACTTC
CAAGCACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAGTTCCTCCTT
CCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGTG
AATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGGA
ACATTACTTCATTCACATCAACATCTTTATCCTAAAGAACATCCGCCAGA
ACAACAACAGATTACTGGTTACTCGCACAAAGATTCAAATAATGATTGGC
AAATTAATAAAGCACACCATCTGATCAcTGAAGATGATCGATTGGAATAC
GTTCGTGATGGTGATGAAGTGAGATTAATGCATGTACAAACACGTCGCAA
TTTACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAG
TCTCCGGCTATGGACAAGACGGTAACGGTGATGCCAATGATATTTGGCTG
ATTCGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAA
AACCATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaa
ctgaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGC
AATCCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAACATCGAAAG
TAACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCAT
CATTCTTCGAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGACGAAC
AACGGATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTG
GCCCATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTAT
ATTTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGAACGTATTTT
CTTTACGTCATCGTTTACGTCATACAAACACTACGATGGAAACGAGGCTA
CAAGTTCGATGCCACCATTTACGcTGAATACACAACAATGGTATCATCAT
GTTCGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCC
ATGGGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCATATTTGTTTAG
TGCAATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAACCGTTTCAT
ATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTTGCTTAGCC
ACAGTTCTGGCCATCGCTATTTCAAGtttttgcatGTTCCGTGGTTTATC
ATATGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAACCATGGCTG
CTTATCGATGGCTCGATACTTGGGATATTTAAATGACTGTTCGAAAAAGA
GCTAATCATACTTCGAATTCTGAGTCAAAAGATGACAATACGAAAAATGA
AGAAGCAACTGAAAAGAAAACAGATTTCCCTAAAGCATTAACAAATGGAT
CAGCATCGAAAGTCAAGGAAAATGATAACGGACCTCTGATCTCAATACAT
CTTGATATTTCTTTGTACCTACGAAACTTACGCGAGAGTTTAACCACACT
TTCAAAGCAAGATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAA
TCAATCGTTCGAAACATCAATATAAACCGTTGAAAGGTTTcaatttgttt
tggttttatatGATCTTCAGTGTTGCTCTGTTTACCAGATTCTACACCAT
TACATTGCCTAAACATGTTTGcTGGGATGAAActcattttggaaaatttg
caaATCACTATCTCAATGGAACATTCTTCTTGGATGTGCATCCACCGCTT
GGCAAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCTATAATGGTGA
ATTTTCATTCGAAAAGCCAGGCATGGAATACGGAGAACATAGATATGTTG
GAATGAGAGCAttttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCT
TATTTGATTGTATGGGAATTGACTCACAATCTTCCTGCATGTATACTTGC
TGCTTCATTGAttctttttgATCACGGGTGTATAACGATATCACAGTACA
TTCTATTGGATCCAATCTTGATGTTTTTCATCATGATGTCTGTGTACAGT
TTATTGAAATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTG
GGGTTGGATGTTTGTTACCGGATATTTCTTGGCTTGTACCTTCAGcgtCA
AATGGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAA
GATTTATGGGATATTCTTGGCGATCTATCAAATTCTCTGGTTGACGTTGG
AAAACACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCCTATATTCA
TCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgtggt
ccAGGAGATGGATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAA
TAAACTTTACAAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGCTGTGG
TGACGTTGAAGAATCACAAAACAGCTGGAACATTACTTCATTCACATCAA
CATCTTTATCCTAAAGAACATCCGCCAGAACAACAACAGATTACTGGTTA
CTCGCACAAAGATTCAAATAATGATTGGCAAATTAATAAAGCACACCATC
TGATCAcTGAAGATGATCGATTGGAATACGTTCGTGATGGTGATGAAGTG
AGATTAATGCATGTACAAACACGTCGCAATTTACATTCCCATCCAGAGAA
AGCTCCCATTTCAACAAACCTTCATCAAGTCTCCGGCTATGGACAAGACG
GTAACGGTGATGCCAATGATATTTGGCTGATTCGAATTACCAAAAATCCT
GGCCCAGACAATCGAATTAGTACGGTCAAAACCATCTTTCAATTGGTTCA
TCGTAATACTGGATGTGTTTTGcaagaaactgaaaaacaaCTGCCCAAAT
GGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGTAACC
ATCGTCGGAAGCGAATGGAACATCGAAAGTAACACTCATAAAAAAGTACC
GCAAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGTTTATG
AATCACACGTTGTAATGGCAAAGACGAACAACGGATTCAAACCGAAGGAA
GGGGAATTTACGTCACAAGCATGGCATTGGCCCATCAATTATCGCggGCA
AGTGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTCGGCAACCCGATTG
TGTGGTGGTTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTC
ATACAAACACTACGATGGAAACGAGGCTACAAGTTCGATGCCACCATTTA
CGcTGAATACACAACAATGGTATCATCATGTTCGTGGCTTTTCATGGGAT
GGGCGCTTCATTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGTATTTC
CATCACTATTTCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgcATCTT
ATTAGAGCACGTGTCAAGAACCGTTTCATATATGTTCAGCGGTGAACGAA
GAAAGCATGTTTACTACTTTTGCTTAGCCACAGTTCTGGCCATCGCTATT
TCAAGtttttgcatGTTCCGTGGTTTATCATATGGAATGTCAGGACCAAT
GGGAAACCAACCCAACCAAACCATGGCTGCTTATCGATGGCTCGATACTT
GGGATATTTAAATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTCT
GAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAAC
AGATTTCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAAA
ATGATAACGGACCTCTGATCTCAATACATCTTGATATTTCTTTGTACCTA
CGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTGA
AGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAAT
ATAAACCGTTGAAAGGTTTcaatttgttttggttttatatGATCTTCAGT
GTTGCTCTGTTTACCAGATTCTACACCATTACATTGCCTAAACATGTTTG
cTGGGATGAAActcattttggaaaatttgcaaATCACTATCTCAATGGAA
CATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTTG
GCTGGCTGGATGACAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAGG
CATGGAATACGGAGAACATAGATATGTTGGAATGAGAGCAttttgtgCCT
TATTGGGATGTTTTTGTGTACCACTGGCTTATTTGATTGTATGGGAATTG
ACTCACAATCTTCCTGCATGTATACTTGCTGCTTCATTGAttctttttgA
TCACGGGTGTATAACGATATCACAGTACATTCTATTGGATCCAATCTTGA
TGTTTTTCATCATGATGTCTGTGTACAGTTTATTGAAATTCTACAGTTGG
CGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGG
ATATTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGA
TTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATGGGATATTCTTGGC
GATCTATCAAATTCTCTGGTTGACGTTGGAAAACACTTCATAGCACGTGC
TATTGGCTTGATACTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCTG
TTCACTTCCAAGCACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAGT
TCCTCCTTCCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTT
ACCTGGTGAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAA
CAGCTGGAACATTACTTCATTCACATCAACATCTTTATCCTAAAGAACAT
CCGCCAGAACAACAACAGATTACTGGTTACTCGCACAAAGATTCAAATAA
TGATTGGCAAATTAATAAAGCACACCATCTGATCAcTGAAGATGATCGAT
TGGAATACGTTCGTGATGGTGATGAAGTGAGATTAATGCATGTACAAACA
CGTCGCAATTTACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACCT
TCATCAAGTCTCCGGCTATGGACAAGACGGTAACGGTGATGCCAATGATA
TTTGGCTGATTCGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAGT
ACGGTCAAAACCATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTT
GcaagaaactgaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGA
TGGCGTGCAATCCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAAC
ATCGAAAGTAACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTT
GTCGCCATCATTCTTCGAAAGTGTTTATGAATCACACGTTGTAATGGCAA
AGACGAACAACGGATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGCA
TGGCATTGGCCCATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATGA
GCGCGTATATTTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGAA
CGTATTTTCTTTACGTCATCGTTTACGTCATACAAACACTACGATGGAAA
CGAGGCTACAAGTTCGATGCCACCATTTACGcTGAATACACAACAATGGT
ATCATCATGTTCGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGT
TTTACGCCATGGGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCATAT
TTGTTTAGTGCAATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAAC
CGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTT
GCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGtttttgcatGTTCCGT
GGTTTATCATATGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAAC
CATGGCTGCTTATCGATGGCTCGATACTTGGGATATTTAAATGACTGTTC
GAAAAAGAGCTAATCATACTTCGAATTCTGAGTCAAAAGATGACAATACG
AAAAATGAAGAAGCAACTGAAAAGAAAACAGATTTCCCTAAAGCATTAAC
AAATGGATCAGCATCGAAAGTCAAGGAAAATGATAACGGACCTCTGATCT
CAATACATCTTGATATTTCTTTGTACCTACGAAACTTACGCGAGAGTTTA
ACCACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTTCACATTTGGAA
AGTGTTAATCAATCGTTCGAAACATCAATATAAACCGTTGAAAGGTTTca
atttgttttggttttatatGATCTTCAGTGTTGCTCTGTTTACCAGATTC
TACACCATTACATTGCCTAAACATGTTTGcTGGGATGAAActcattttgg
aaaatttgcaaATCACTATCTCAATGGAACATTCTTCTTGGATGTGCATC
CACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCTAT
AATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAATACGGAGAACATAG
ATATGTTGGAATGAGAGCAttttgtgCCTTATTGGGATGTTTTTGTGTAC
CACTGGCTTATTTGATTGTATGGGAATTGACTCACAATCTTCCTGCATGT
ATACTTGCTGCTTCATTGAttctttttgATCACGGGTGTATAACGATATC
ACAGTACATTCTATTGGATCCAATCTTGATGTTTTTCATCATGATGTCTG
TGTACAGTTTATTGAAATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTT
GATTGGTGGGGTTGGATGTTTGTTACCGGATATTTCTTGGCTTGTACCTT
CAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGACAA
CCGTGCAAGATTTATGGGATATTCTTGGCGATCTATCAAATTCTCTGGTT
GACGTTGGAAAACACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCC
TATATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTA
AAAgtggtccAGGAGATGGATTTTTCAGTTCCTCCTTCCAATCCACGCTA
GAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGTGAATTGGGGTACGG
TGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGGAACATTACTTCATT
CACATCAACATCTTTATCCTAAAGAACATCCGCCAGAACAACAACAGATT
ACTGGTTACTCGCACAAAGATTCAAATAATGATTGGCAAATTAATAAAGC
ACACCATCTGATCAcTGAAGATGATCGATTGGAATACGTTCGTGATGGTG
ATGAAGTGAGATTAATGCATGTACAAACACGTCGCAATTTACATTCCCAT
CCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTCTCCGGCTATGG
ACAAGACGGTAACGGTGATGCCAATGATATTTGGCTGATTCGAATTACCA
AAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAAAACCATCTTTCAA
TTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaactgaaaaacaaCT
GCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGT
TTGTAACCATCGTCGGAAGCGAATGGAACATCGAAAGTAACACTCATAAA
AAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTCGAAAG
TGTTTATGAATCACACGTTGTAATGGCAAAGACGAACAACGGATTCAAAC
CGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTGGCCCATCAATTAT
CGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTCGGCAA
CCCGATTGTGTGGTGGTTAATTTGCGGAACGTATTTTCTTTACGTCATCG
TTTACGTCATACAAACACTACGATGGAAACGAGGCTACAAGTTCGATGCC
ACCATTTACGcTGAATACACAACAATGGTATCATCATGTTCGTGGCTTTT
CATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCCATGGGGCGTGTTT
TGTATTTCCATCACTATTTCCCTGCATATTTGTTTAGTGCAATGTTTTCA
GgcATCTTATTAGAGCACGTGTCAAGAACCGTTTCATATATGTTCAGCGG
TGAACGAAGAAAGCATGTTTACTACTTTTGCTTAGCCACAGTTCTGGCCA
TCGCTATTTCAAGtttttgcatGTTCCGTGGTTTATCATATGGAATGTCA
GGACCAATGGGAAACCAACCCAACCAAACCATGGCTGCTTATCGATGGCT
CGATACTTGGGATATTTAAATGACTGTTCGAAAAAGAGCTAATCATACTT
CGAATTCTGAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAACTGAA
AAGAAAACAGATTTCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGT
CAAGGAAAATGATAACGGACCTCTGATCTCAATACATCTTGATATTTCTT
TGTACCTACGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGAT
TTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAA
ACATCAATATAAACCGTTGAAAGGTTTcaatttgttttggttttatatGA
TCTTCAGTGTTGCTCTGTTTACCAGATTCTACACCATTACATTGCCTAAA
CATGTTTGcTGGGATGAAActcattttggaaaatttgcaaATCACTATCT
CAATGGAACATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGATGCTGC
TTGCTTTGGCTGGCTGGATGACAGGCTATAATGGTGAATTTTCATTCGAA
AAGCCAGGCATGGAATACGGAGAACATAGATATGTTGGAATGAGAGCAtt
ttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCTTATTTGATTGTAT
GGGAATTGACTCACAATCTTCCTGCATGTATACTTGCTGCTTCATTGAtt
ctttttgATCACGGGTGTATAACGATATCACAGTACATTCTATTGGATCC
AATCTTGATGTTTTTCATCATGATGTCTGTGTACAGTTTATTGAAATTCT
ACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTT
GTTACCGGATATTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTT
GTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATGGGATA
TTCTTGGCGATCTATCAAATTCTCTGGTTGACGTTGGAAAACACTTCATA
GCACGTGCTATTGGCTTGATACTTCTCCCTATATTCATCTATCTTTTCTT
CTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgtggtccAGGAGATGGAT
TTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAATAAACTTTACAAA
GCTGTTTTACCTGGTGAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAA
TCACAAAACAGCTGGAACATTACTTCATTCACATCAACATCTTTATCCTA
AAGAACATCCGCCAGAACAACAACAGATTACTGGTTACTCGCACAAAGAT
TCAAATAATGATTGGCAAATTAATAAAGCACACCATCTGATCAcTGAAGA
TGATCGATTGGAATACGTTCGTGATGGTGATGAAGTGAGATTAATGCATG
TACAAACACGTCGCAATTTACATTCCCATCCAGAGAAAGCTCCCATTTCA
ACAAACCTTCATCAAGTCTCCGGCTATGGACAAGACGGTAACGGTGATGC
CAATGATATTTGGCTGATTCGAATTACCAAAAATCCTGGCCCAGACAATC
GAATTAGTACGGTCAAAACCATCTTTCAATTGGTTCATCGTAATACTGGA
TGTGTTTTGcaagaaactgaaaaacaaCTGCCCAAATGGGGTTGGGAGCA
AAAAGAGATGGCGTGCAATCCAAATAAGTTTGTAACCATCGTCGGAAGCG
AATGGAACATCGAAAGTAACACTCATAAAAAAGTACCGCAAGTCAGCGTG
GAATTGTTGTCGCCATCATTCTTCGAAAGTGTTTATGAATCACACGTTGT
AATGGCAAAGACGAACAACGGATTCAAACCGAAGGAAGGGGAATTTACGT
CACAAGCATGGCATTGGCCCATCAATTATCGCggGCAAGTGTTTTCTGGA
GGAGATGAGCGCGTATATTTGCTCGGCAACCCGATTGTGTGGTGGTTAAT
TTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTCATACAAACACTAC
GATGGAAACGAGGCTACAAGTTCGATGCCACCATTTACGcTGAATACACA
ACAATGGTATCATCATGTTCGTGGCTTTTCATGGGATGGGCGCTTCATTA
CCTCCCGTTTTACGCCATGGGGCGTGTTTTGTATTTCCATCACTATTTCC
CTGCATATTTGTTTAGTGCAATGTTTTCAGgcATCTTATTAGAGCACGTG
TCAAGAACCGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTA
CTACTTTTGCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGtttttgca
tGTTCCGTGGTTTATCATATGGAATGTCAGGACCAATGGGAAACCAACCC
AACCAAACCATGGCTGCTTATCGATGGCTCGATACTTGGGATATTTAAAT
GACTGTTCGAAAAAGAGCTAATCATACTTCGAATTCTGAGTCAAAAGATG
ACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGATTTCCCTAAA
GCATTAACAAATGGATCAGCATCGAAAGTCAAGGAAAATGATAACGGACC
TCTGATCTCAATACATCTTGATATTTCTTTGTACCTACGAAACTTACGCG
AGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTTCAC
ATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAATATAAACCGTTGAA
AGGTTTcaatttgttttggttttatatGATCTTCAGTGTTGCTCTGTTTA
CCAGATTCTACACCATTACATTGCCTAAACATGTTTGcTGGGATGAAAct
cattttggaaaatttgcaaATCACTATCTCAATGGAACATTCTTCTTGGA
TGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGATGA
CAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAATACGGA
GAACATAGATATGTTGGAATGAGAGCAttttgtgCCTTATTGGGATGTTT
TTGTGTACCACTGGCTTATTTGATTGTATGGGAATTGACTCACAATCTTC
CTGCATGTATACTTGCTGCTTCATTGAttctttttgATCACGGGTGTATA
ACGATATCACAGTACATTCTATTGGATCCAATCTTGATGTTTTTCATCAT
GATGTCTGTGTACAGTTTATTGAAATTCTACAGTTGGCGTGATTGCCCCT
TCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATATTTCTTGGCT
TGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGCTGG
AATGACAACCGTGCAAGATTTATGGGATATTCTTGGCGATCTATCAAATT
CTCTGGTTGACGTTGGAAAACACTTCATAGCACGTGCTATTGGCTTGATA
CTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGC
ACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAGTTCCTCCTTCCAAT
CCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGTGAATTG
GGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGGAACATT
ACTTCATTCACATCAACATCTTTATCCTAAAGAACATCCGCCAGAACAAC
AACAGATTACTGGTTACTCGCACAAAGATTCAAATAATGATTGGCAAATT
AATAAAGCACACCATCTGATCAcTGAAGATGATCGATTGGAATACGTTCG
TGATGGTGATGAAGTGAGATTAATGCATGTACAAACACGTCGCAATTTAC
ATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTCTCC
GGCTATGGACAAGACGGTAACGGTGATGCCAATGATATTTGGCTGATTCG
AATTACCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAAAACCA
TCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaactgaa
aaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCC
AAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAACATCGAAAGTAACA
CTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCATTC
TTCGAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGACGAACAACGG
ATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTGGCCCA
TCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATTTG
CTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGAACGTATTTTCTTTA
CGTCATCGTTTACGTCATACAAACACTACGATGGAAACGAGGCTACAAGT
TCGATGCCACCATTTACGcTGAATACACAACAATGGTATCATCATGTTCG
TGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCCATGGG
GCGTGTTTTGTATTTCCATCACTATTTCCCTGCATATTTGTTTAGTGCAA
TGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAACCGTTTCATATATG
TTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTTGCTTAGCCACAGT
TCTGGCCATCGCTATTTCAAGtttttgcatGTTCCGTGGTTTATCATATG
GAATGTCAGGACCAATGGGAAACCAACCCAACCAAACCATGGCTGCTTAT
CGATGGCTCGATACTTGGGATATTTAAATGACTGTTCGAAAAAGAGCTAA
TCATACTTCGAATTCTGAGTCAAAAGATGACAATACGAAAAATGAAGAAG
CAACTGAAAAGAAAACAGATTTCCCTAAAGCATTAACAAATGGATCAGCA
TCGAAAGTCAAGGAAAATGATAACGGACCTCTGATCTCAATACATCTTGA
TATTTCTTTGTACCTACGAAACTTACGCGAGAGTTTAACCACACTTTCAA
AGCAAGATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAATCAAT
CGTTCGAAACATCAATATAAACCGTTGAAAGGTTTcaatttgttttggtt
ttatatGATCTTCAGTGTTGCTCTGTTTACCAGATTCTACACCATTACAT
TGCCTAAACATGTTTGcTGGGATGAAActcattttggaaaatttgcaaAT
CACTATCTCAATGGAACATTCTTCTTGGATGTGCATCCACCGCTTGGCAA
GATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCTATAATGGTGAATTTT
CATTCGAAAAGCCAGGCATGGAATACGGAGAACATAGATATGTTGGAATG
AGAGCAttttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCTTATTT
GATTGTATGGGAATTGACTCACAATCTTCCTGCATGTATACTTGCTGCTT
CATTGAttctttttgATCACGGGTGTATAACGATATCACAGTACATTCTA
TTGGATCCAATCTTGATGTTTTTCATCATGATGTCTGTGTACAGTTTATT
GAAATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTT
GGATGTTTGTTACCGGATATTTCTTGGCTTGTACCTTCAGcgtCAAATGG
GTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGATTT
ATGGGATATTCTTGGCGATCTATCAAATTCTCTGGTTGACGTTGGAAAAC
ACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCCTATATTCATCTAT
CTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgtggtccAGG
AGATGGATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAATAAAC
TTTACAAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGCTGTGGTGACG
TTGAAGAATCACAAAACAGCTGGAACATTACTTCATTCACATCAACATCT
TTATCCTAAAGAACATCCGCCAGAACAACAACAGATTACTGGTTACTCGC
ACAAAGATTCAAATAATGATTGGCAAATTAATAAAGCACACCATCTGATC
AcTGAAGATGATCGATTGGAATACGTTCGTGATGGTGATGAAGTGAGATT
AATGCATGTACAAACACGTCGCAATTTACATTCCCATCCAGAGAAAGCTC
CCATTTCAACAAACCTTCATCAAGTCTCCGGCTATGGACAAGACGGTAAC
GGTGATGCCAATGATATTTGGCTGATTCGAATTACCAAAAATCCTGGCCC
AGACAATCGAATTAGTACGGTCAAAACCATCTTTCAATTGGTTCATCGTA
ATACTGGATGTGTTTTGcaagaaactgaaaaacaaCTGCCCAAATGGGGT
TGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGTAACCATCGT
CGGAAGCGAATGGAACATCGAAAGTAACACTCATAAAAAAGTACCGCAAG
TCAGCGTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGTTTATGAATCA
CACGTTGTAATGGCAAAGACGAACAACGGATTCAAACCGAAGGAAGGGGA
ATTTACGTCACAAGCATGGCATTGGCCCATCAATTATCGCggGCAAGTGT
TTTCTGGAGGAGATGAGCGCGTATATTTGCTCGGCAACCCGATTGTGTGG
TGGTTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTCATACA
AACACTACGATGGAAACGAGGCTACAAGTTCGATGCCACCATTTACGcTG
AATACACAACAATGGTATCATCATGTTCGTGGCTTTTCATGGGATGGGCG
CTTCATTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGTATTTCCATCA
CTATTTCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgcATCTTATTAG
AGCACGTGTCAAGAACCGTTTCATATATGTTCAGCGGTGAACGAAGAAAG
CATGTTTACTACTTTTGCTTAGCCACAGTTCTGGCCATCGCTATTTCAAG
tttttgcatGTTCCGTGGTTTATCATATGGAATGTCAGGACCAATGGGAA
ACCAACCCAACCAAACCATGGCTGCTTATCGATGGCTCGATACTTGGGAT
ATTTAAATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTCTGAGTC
AAAAGATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGATT
TCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAAAATGAT
AACGGACCTCTGATCTCAATACATCTTGATATTTCTTTGTACCTACGAAA
CTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTGAAGTCC
CTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAATATAAA
CCGTTGAAAGGTTTcaatttgttttggttttatatGATCTTCAGTGTTGC
TCTGTTTACCAGATTCTACACCATTACATTGCCTAAACATGTTTGcTGGG
ATGAAActcattttggaaaatttgcaaATCACTATCTCAATGGAACATTC
TTCTTGGATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGG
CTGGATGACAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGG
AATACGGAGAACATAGATATGTTGGAATGAGAGCAttttgtgCCTTATTG
GGATGTTTTTGTGTACCACTGGCTTATTTGATTGTATGGGAATTGACTCA
CAATCTTCCTGCATGTATACTTGCTGCTTCATTGAttctttttgATCACG
GGTGTATAACGATATCACAGTACATTCTATTGGATCCAATCTTGATGTTT
TTCATCATGATGTCTGTGTACAGTTTATTGAAATTCTACAGTTGGCGTGA
TTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATATT
TCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTG
TTCGCTGGAATGACAACCGTGCAAGATTTATGGGATATTCTTGGCGATCT
ATCAAATTCTCTGGTTGACGTTGGAAAACACTTCATAGCACGTGCTATTG
GCTTGATACTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCTGTTCAC
TTCCAAGCACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAGTTCCTC
CTTCCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTG
GTGAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCT
GGAACATTACTTCATTCACATCAACATCTTTATCCTAAAGAACATCCGCC
AGAACAACAACAGATTACTGGTTACTCGCACAAAGATTCAAATAATGATT
GGCAAATTAATAAAGCACACCATCTGATCAcTGAAGATGATCGATTGGAA
TACGTTCGTGATGGTGATGAAGTGAGATTAATGCATGTACAAACACGTCG
CAATTTACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATC
AAGTCTCCGGCTATGGACAAGACGGTAACGGTGATGCCAATGATATTTGG
CTGATTCGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGT
CAAAACCATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTTGcaag
aaactgaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCG
TGCAATCCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAACATCGA
AAGTAACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGC
CATCATTCTTCGAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGACG
AACAACGGATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCA
TTGGCCCATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCG
TATATTTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGAACGTAT
TTTCTTTACGTCATCGTTTACGTCATACAAACACTACGATGGAAACGAGG
CTACAAGTTCGATGCCACCATTTACGcTGAATACACAACAATGGTATCAT
CATGTTCGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTAC
GCCATGGGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCATATTTGTT
TAGTGCAATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAACCGTTT
CATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTTGCTTA
GCCACAGTTCTGGCCATCGCTATTTCAAGtttttgcatGTTCCGTGGTTT
ATCATATGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAACCATGG
CTGCTTATCGATGGCTCGATACTTGGGATATTTAAATGACTGTTCGAAAA
AGAGCTAATCATACTTCGAATTCTGAGTCAAAAGATGACAATACGAAAAA
TGAAGAAGCAACTGAAAAGAAAACAGATTTCCCTAAAGCATTAACAAATG
GATCAGCATCGAAAGTCAAGGAAAATGATAACGGACCTCTGATCTCAATA
CATCTTGATATTTCTTTGTACCTACGAAACTTACGCGAGAGTTTAACCAC
ACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGT
TAATCAATCGTTCGAAACATCAATATAAACCGTTGAAAGGTTTcaatttg
ttttggttttatatGATCTTCAGTGTTGCTCTGTTTACCAGATTCTACAC
CATTACATTGCCTAAACATGTTTGcTGGGATGAAActcattttggaaaat
ttgcaaATCACTATCTCAATGGAACATTCTTCTTGGATGTGCATCCACCG
CTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCTATAATGG
TGAATTTTCATTCGAAAAGCCAGGCATGGAATACGGAGAACATAGATATG
TTGGAATGAGAGCAttttgtgCCTTATTGGGATGTTTTTGTGTACCACTG
GCTTATTTGATTGTATGGGAATTGACTCACAATCTTCCTGCATGTATACT
TGCTGCTTCATTGAttctttttgATCACGGGTGTATAACGATATCACAGT
ACATTCTATTGGATCCAATCTTGATGTTTTTCATCATGATGTCTGTGTAC
AGTTTATTGAAATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTG
GTGGGGTTGGATGTTTGTTACCGGATATTTCTTGGCTTGTACCTTCAGcg
tCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTG
CAAGATTTATGGGATATTCTTGGCGATCTATCAAATTCTCTGGTTGACGT
TGGAAAACACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCCTATAT
TCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgt
ggtccAGGAGATGGATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGG
GAATAAACTTTACAAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGCTG
TGGTGACGTTGAAGAATCACAAAACAGCTGGAACATTACTTCATTCACAT
CAACATCTTTATCCTAAAGAACATCCGCCAGAACAACAACAGATTACTGG
TTACTCGCACAAAGATTCAAATAATGATTGGCAAATTAATAAAGCACACC
ATCTGATCAcTGAAGATGATCGATTGGAATACGTTCGTGATGGTGATGAA
GTGAGATTAATGCATGTACAAACACGTCGCAATTTACATTCCCATCCAGA
GAAAGCTCCCATTTCAACAAACCTTCATCAAGTCTCCGGCTATGGACAAG
ACGGTAACGGTGATGCCAATGATATTTGGCTGATTCGAATTACCAAAAAT
CCTGGCCCAGACAATCGAATTAGTACGGTCAAAACCATCTTTCAATTGGT
TCATCGTAATACTGGATGTGTTTTGcaagaaactgaaaaacaaCTGCCCA
AATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGTA
ACCATCGTCGGAAGCGAATGGAACATCGAAAGTAACACTCATAAAAAAGT
ACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGTTT
ATGAATCACACGTTGTAATGGCAAAGACGAACAACGGATTCAAACCGAAG
GAAGGGGAATTTACGTCACAAGCATGGCATTGGCCCATCAATTATCGCgg
GCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTCGGCAACCCGA
TTGTGTGGTGGTTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTTAC
GTCATACAAACACTACGATGGAAACGAGGCTACAAGTTCGATGCCACCAT
TTACGcTGAATACACAACAATGGTATCATCATGTTCGTGGCTTTTCATGG
GATGGGCGCTTCATTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGTAT
TTCCATCACTATTTCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgcAT
CTTATTAGAGCACGTGTCAAGAACCGTTTCATATATGTTCAGCGGTGAAC
GAAGAAAGCATGTTTACTACTTTTGCTTAGCCACAGTTCTGGCCATCGCT
ATTTCAAGtttttgcatGTTCCGTGGTTTATCATATGGAATGTCAGGACC
AATGGGAAACCAACCCAACCAAACCATGGCTGCTTATCGATGGCTCGATA
CTTGGGATATTTAAATGACTGTTCGAAAAAGAGCTAATCATACTTCGAAT
TCTGAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAA
AACAGATTTCCCTAAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGG
AAAATGATAACGGACCTCTGATCTCAATACATCTTGATATTTCTTTGTAC
CTACGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGC
TGAAGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTCGAAACATC
AATATAAACCGTTGAAAGGTTTcaatttgttttggttttatatGATCTTC
AGTGTTGCTCTGTTTACCAGATTCTACACCATTACATTGCCTAAACATGT
TTGcTGGGATGAAActcattttggaaaatttgcaaATCACTATCTCAATG
GAACATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCT
TTGGCTGGCTGGATGACAGGCTATAATGGTGAATTTTCATTCGAAAAGCC
AGGCATGGAATACGGAGAACATAGATATGTTGGAATGAGAGCAttttgtg
CCTTATTGGGATGTTTTTGTGTACCACTGGCTTATTTGATTGTATGGGAA
TTGACTCACAATCTTCCTGCATGTATACTTGCTGCTTCATTGAttctttt
tgATCACGGGTGTATAACGATATCACAGTACATTCTATTGGATCCAATCT
TGATGTTTTTCATCATGATGTCTGTGTACAGTTTATTGAAATTCTACAGT
TGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTAC
CGGATATTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTG
TGATTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATGGGATATTCTT
GGCGATCTATCAAATTCTCTGGTTGACGTTGGAAAACACTTCATAGCACG
TGCTATTGGCTTGATACTTCTCCCTATATTCATCTATCTTTTCTTCTTTG
CTGTTCACTTCCAAGCACTTCCTAAAAgtggtccAGGAGATGGATTTTTC
AGTTCCTCCTTCCAATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGT
TTTACCTGGTGAATTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACA
AAACAGCTGGAACATTACTTCATTCACATCAACATCTTTATCCTAAAGAA
CATCCGCCAGAACAACAACAGATTACTGGTTACTCGCACAAAGATTCAAA
TAATGATTGGCAAATTAATAAAGCACACCATCTGATCAcTGAAGATGATC
GATTGGAATACGTTCGTGATGGTGATGAAGTGAGATTAATGCATGTACAA
ACACGTCGCAATTTACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAA
CCTTCATCAAGTCTCCGGCTATGGACAAGACGGTAACGGTGATGCCAATG
ATATTTGGCTGATTCGAATTACCAAAAATCCTGGCCCAGACAATCGAATT
AGTACGGTCAAAACCATCTTTCAATTGGTTCATCGTAATACTGGATGTGT
TTTGcaagaaactgaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAG
AGATGGCGTGCAATCCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGG
AACATCGAAAGTAACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATT
GTTGTCGCCATCATTCTTCGAAAGTGTTTATGAATCACACGTTGTAATGG
CAAAGACGAACAACGGATTCAAACCGAAGGAAGGGGAATTTACGTCACAA
GCATGGCATTGGCCCATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGA
TGAGCGCGTATATTTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCG
GAACGTATTTTCTTTACGTCATCGTTTACGTCATACAAACACTACGATGG
AAACGAGGCTACAAGTTCGATGCCACCATTTACGcTGAATACACAACAAT
GGTATCATCATGTTCGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCC
CGTTTTACGCCATGGGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCA
TATTTGTTTAGTGCAATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAG
AACCGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACT
TTTGCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGtttttgcatGTTC
CGTGGTTTATCATATGGAATGTCAGGACCAATGGGAAACCAACCCAACCA
AACCATGGCTGCTTATCGATGGCTCGATACTTGGGATATTTAAATGACTG
TTCGAAAAAGAGCTAATCATACTTCGAATTCTGAGTCAAAAGATGACAAT
ACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGATTTCCCTAAAGCATT
AACAAATGGATCAGCATCGAAAGTCAAGGAAAATGATAACGGACCTCTGA
TCTCAATACATCTTGATATTTCTTTGTACCTACGAAACTTACGCGAGAGT
TTAACCACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTTCACATTTG
GAAAGTGTTAATCAATCGTTCGAAACATCAATATAAACCGTTGAAAGGTT
TcaatttgttttggttttatatGATCTTCAGTGTTGCTCTGTTTACCAGA
TTCTACACCATTACATTGCCTAAACATGTTTGcTGGGATGAAActcattt
tggaaaatttgcaaATCACTATCTCAATGGAACATTCTTCTTGGATGTGC
ATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGC
TATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAATACGGAGAACA
TAGATATGTTGGAATGAGAGCAttttgtgCCTTATTGGGATGTTTTTGTG
TACCACTGGCTTATTTGATTGTATGGGAATTGACTCACAATCTTCCTGCA
TGTATACTTGCTGCTTCATTGAttctttttgATCACGGGTGTATAACGAT
ATCACAGTACATTCTATTGGATCCAATCTTGATGTTTTTCATCATGATGT
CTGTGTACAGTTTATTGAAATTCTACAGTTGGCGTGATTGCCCCTTCTCC
TTTGATTGGTGGGGTTGGATGTTTGTTACCGGATATTTCTTGGCTTGTAC
CTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGA
CAACCGTGCAAGATTTATGGGATATTCTTGGCGATCTATCAAATTCTCTG
GTTGACGTTGGAAAACACTTCATAGCACGTGCTATTGGCTTGATACTTCT
CCCTATATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTC
CTAAAAgtggtccAGGAGATGGATTTTTCAGTTCCTCCTTCCAATCCACG
CTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGTGAATTGGGGTA
CGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGGAACATTACTTC
ATTCACATCAACATCTTTATCCTAAAGAACATCCGCCAGAACAACAACAG
ATTACTGGTTACTCGCACAAAGATTCAAATAATGATTGGCAAATTAATAA
AGCACACCATCTGATCAcTGAAGATGATCGATTGGAATACGTTCGTGATG
GTGATGAAGTGAGATTAATGCATGTACAAACACGTCGCAATTTACATTCC
CATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTCTCCGGCTA
TGGACAAGACGGTAACGGTGATGCCAATGATATTTGGCTGATTCGAATTA
CCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAAAACCATCTTT
CAATTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaactgaaaaaca
aCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATA
AGTTTGTAACCATCGTCGGAAGCGAATGGAACATCGAAAGTAACACTCAT
AAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTCGA
AAGTGTTTATGAATCACACGTTGTAATGGCAAAGACGAACAACGGATTCA
AACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTGGCCCATCAAT
TATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTCGG
CAACCCGATTGTGTGGTGGTTAATTTGCGGAACGTATTTTCTTTACGTCA
TCGTTTACGTCATACAAACACTACGATGGAAACGAGGCTACAAGTTCGAT
GCCACCATTTACGcTGAATACACAACAATGGTATCATCATGTTCGTGGCT
TTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCCATGGGGCGTG
TTTTGTATTTCCATCACTATTTCCCTGCATATTTGTTTAGTGCAATGTTT
TCAGgcATCTTATTAGAGCACGTGTCAAGAACCGTTTCATATATGTTCAG
CGGTGAACGAAGAAAGCATGTTTACTACTTTTGCTTAGCCACAGTTCTGG
CCATCGCTATTTCAAGtttttgcatGTTCCGTGGTTTATCATATGGAATG
TCAGGACCAATGGGAAACCAACCCAACCAAACCATGGCTGCTTATCGATG
GCTCGATACTTGGGATATTTAAATGACTGTTCGAAAAAGAGCTAATCATA
CTTCGAATTCTGAGTCAAAAGATGACAATACGAAAAATGAAGAAGCAACT
GAAAAGAAAACAGATTTCCCTAAAGCATTAACAAATGGATCAGCATCGAA
AGTCAAGGAAAATGATAACGGACCTCTGATCTCAATACATCTTGATATTT
CTTTGTACCTACGAAACTTACGCGAGAGTTTAACCACACTTTCAAAGCAA
GATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAATCAATCGTTC
GAAACATCAATATAAACCGTTGAAAGGTTTcaatttgttttggttttata
tGATCTTCAGTGTTGCTCTGTTTACCAGATTCTACACCATTACATTGCCT
AAACATGTTTGcTGGGATGAAActcattttggaaaatttgcaaATCACTA
TCTCAATGGAACATTCTTCTTGGATGTGCATCCACCGCTTGGCAAGATGC
TGCTTGCTTTGGCTGGCTGGATGACAGGCTATAATGGTGAATTTTCATTC
GAAAAGCCAGGCATGGAATACGGAGAACATAGATATGTTGGAATGAGAGC
AttttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCTTATTTGATTG
TATGGGAATTGACTCACAATCTTCCTGCATGTATACTTGCTGCTTCATTG
AttctttttgATCACGGGTGTATAACGATATCACAGTACATTCTATTGGA
TCCAATCTTGATGTTTTTCATCATGATGTCTGTGTACAGTTTATTGAAAT
TCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGGGTTGGATG
TTTGTTACCGGATATTTCTTGGCTTGTACCTTCAGcgtCAAATGGGTGGG
TTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGATTTATGGG
ATATTCTTGGCGATCTATCAAATTCTCTGGTTGACGTTGGAAAACACTTC
ATAGCACGTGCTATTGGCTTGATACTTCTCCCTATATTCATCTATCTTTT
CTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgtggtccAGGAGATG
GATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAATAAACTTTAC
AAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGCTGTGGTGACGTTGAA
GAATCACAAAACAGCTGGAACATTACTTCATTCACATCAACATCTTTATC
CTAAAGAACATCCGCCAGAACAACAACAGATTACTGGTTACTCGCACAAA
GATTCAAATAATGATTGGCAAATTAATAAAGCACACCATCTGATCAcTGA
AGATGATCGATTGGAATACGTTCGTGATGGTGATGAAGTGAGATTAATGC
ATGTACAAACACGTCGCAATTTACATTCCCATCCAGAGAAAGCTCCCATT
TCAACAAACCTTCATCAAGTCTCCGGCTATGGACAAGACGGTAACGGTGA
TGCCAATGATATTTGGCTGATTCGAATTACCAAAAATCCTGGCCCAGACA
ATCGAATTAGTACGGTCAAAACCATCTTTCAATTGGTTCATCGTAATACT
GGATGTGTTTTGcaagaaactgaaaaacaaCTGCCCAAATGGGGTTGGGA
GCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGTAACCATCGTCGGAA
GCGAATGGAACATCGAAAGTAACACTCATAAAAAAGTACCGCAAGTCAGC
GTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGTTTATGAATCACACGT
TGTAATGGCAAAGACGAACAACGGATTCAAACCGAAGGAAGGGGAATTTA
CGTCACAAGCATGGCATTGGCCCATCAATTATCGCggGCAAGTGTTTTCT
GGAGGAGATGAGCGCGTATATTTGCTCGGCAACCCGATTGTGTGGTGGTT
AATTTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTCATACAAACAC
TACGATGGAAACGAGGCTACAAGTTCGATGCCACCATTTACGcTGAATAC
ACAACAATGGTATCATCATGTTCGTGGCTTTTCATGGGATGGGCGCTTCA
TTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGTATTTCCATCACTATT
TCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgcATCTTATTAGAGCAC
GTGTCAAGAACCGTTTCATATATGTTCAGCGGTGAACGAAGAAAGCATGT
TTACTACTTTTGCTTAGCCACAGTTCTGGCCATCGCTATTTCAAGttttt
gcatGTTCCGTGGTTTATCATATGGAATGTCAGGACCAATGGGAAACCAA
CCCAACCAAACCATGGCTGCTTATCGATGGCTCGATACTTGGGATATTTA
AATGACTGTTCGAAAAAGAGCTAATCATACTTCGAATTCTGAGTCAAAAG
ATGACAATACGAAAAATGAAGAAGCAACTGAAAAGAAAACAGATTTCCCT
AAAGCATTAACAAATGGATCAGCATCGAAAGTCAAGGAAAATGATAACGG
ACCTCTGATCTCAATACATCTTGATATTTCTTTGTACCTACGAAACTTAC
GCGAGAGTTTAACCACACTTTCAAAGCAAGATTTTGCTGAAGTCCCTCTT
CACATTTGGAAAGTGTTAATCAATCGTTCGAAACATCAATATAAACCGTT
GAAAGGTTTcaatttgttttggttttatatGATCTTCAGTGTTGCTCTGT
TTACCAGATTCTACACCATTACATTGCCTAAACATGTTTGcTGGGATGAA
ActcattttggaaaatttgcaaATCACTATCTCAATGGAACATTCTTCTT
GGATGTGCATCCACCGCTTGGCAAGATGCTGCTTGCTTTGGCTGGCTGGA
TGACAGGCTATAATGGTGAATTTTCATTCGAAAAGCCAGGCATGGAATAC
GGAGAACATAGATATGTTGGAATGAGAGCAttttgtgCCTTATTGGGATG
TTTTTGTGTACCACTGGCTTATTTGATTGTATGGGAATTGACTCACAATC
TTCCTGCATGTATACTTGCTGCTTCATTGAttctttttgATCACGGGTGT
ATAACGATATCACAGTACATTCTATTGGATCCAATCTTGATGTTTTTCAT
CATGATGTCTGTGTACAGTTTATTGAAATTCTACAGTTGGCGTGATTGCC
CCTTCTCCTTTGATTGGTGGGGTTGGATGTTTGTTACCGGATATTTCTTG
GCTTGTACCTTCAGcgtCAAATGGGTGGGTTTGTTTGTGATTTTGTTCGC
TGGAATGACAACCGTGCAAGATTTATGGGATATTCTTGGCGATCTATCAA
ATTCTCTGGTTGACGTTGGAAAACACTTCATAGCACGTGCTATTGGCTTG
ATACTTCTCCCTATATTCATCTATCTTTTCTTCTTTGCTGTTCACTTCCA
AGCACTTCCTAAAAgtggtccAGGAGATGGATTTTTCAGTTCCTCCTTCC
AATCCACGCTAGAAGGGAATAAACTTTACAAAGCTGTTTTACCTGGTGAA
TTGGGGTACGGTGCTGTGGTGACGTTGAAGAATCACAAAACAGCTGGAAC
ATTACTTCATTCACATCAACATCTTTATCCTAAAGAACATCCGCCAGAAC
AACAACAGATTACTGGTTACTCGCACAAAGATTCAAATAATGATTGGCAA
ATTAATAAAGCACACCATCTGATCAcTGAAGATGATCGATTGGAATACGT
TCGTGATGGTGATGAAGTGAGATTAATGCATGTACAAACACGTCGCAATT
TACATTCCCATCCAGAGAAAGCTCCCATTTCAACAAACCTTCATCAAGTC
TCCGGCTATGGACAAGACGGTAACGGTGATGCCAATGATATTTGGCTGAT
TCGAATTACCAAAAATCCTGGCCCAGACAATCGAATTAGTACGGTCAAAA
CCATCTTTCAATTGGTTCATCGTAATACTGGATGTGTTTTGcaagaaact
gaaaaacaaCTGCCCAAATGGGGTTGGGAGCAAAAAGAGATGGCGTGCAA
TCCAAATAAGTTTGTAACCATCGTCGGAAGCGAATGGAACATCGAAAGTA
ACACTCATAAAAAAGTACCGCAAGTCAGCGTGGAATTGTTGTCGCCATCA
TTCTTCGAAAGTGTTTATGAATCACACGTTGTAATGGCAAAGACGAACAA
CGGATTCAAACCGAAGGAAGGGGAATTTACGTCACAAGCATGGCATTGGC
CCATCAATTATCGCggGCAAGTGTTTTCTGGAGGAGATGAGCGCGTATAT
TTGCTCGGCAACCCGATTGTGTGGTGGTTAATTTGCGGAACGTATTTTCT
TTACGTCATCGTTTACGTCATACAAACACTACGATGGAAACGAGGCTACA
AGTTCGATGCCACCATTTACGcTGAATACACAACAATGGTATCATCATGT
TCGTGGCTTTTCATGGGATGGGCGCTTCATTACCTCCCGTTTTACGCCAT
GGGGCGTGTTTTGTATTTCCATCACTATTTCCCTGCATATTTGTTTAGTG
CAATGTTTTCAGgcATCTTATTAGAGCACGTGTCAAGAACCGTTTCATAT
ATGTTCAGCGGTGAACGAAGAAAGCATGTTTACTACTTTTGCTTAGCCAC
AGTTCTGGCCATCGCTATTTCAAGtttttgcatGTTCCGTGGTTTATCAT
ATGGAATGTCAGGACCAATGGGAAACCAACCCAACCAAACCATGGCTGCT
TATCGATGGCTCGATACTTGGGATATTTAAATGACTGTTCGAAAAAGAGC
TAATCATACTTCGAATTCTGAGTCAAAAGATGACAATACGAAAAATGAAG
AAGCAACTGAAAAGAAAACAGATTTCCCTAAAGCATTAACAAATGGATCA
GCATCGAAAGTCAAGGAAAATGATAACGGACCTCTGATCTCAATACATCT
TGATATTTCTTTGTACCTACGAAACTTACGCGAGAGTTTAACCACACTTT
CAAAGCAAGATTTTGCTGAAGTCCCTCTTCACATTTGGAAAGTGTTAATC
AATCGTTCGAAACATCAATATAAACCGTTGAAAGGTTTcaatttgttttg
gttttatatGATCTTCAGTGTTGCTCTGTTTACCAGATTCTACACCATTA
CATTGCCTAAACATGTTTGcTGGGATGAAActcattttggaaaatttgca
aATCACTATCTCAATGGAACATTCTTCTTGGATGTGCATCCACCGCTTGG
CAAGATGCTGCTTGCTTTGGCTGGCTGGATGACAGGCTATAATGGTGAAT
TTTCATTCGAAAAGCCAGGCATGGAATACGGAGAACATAGATATGTTGGA
ATGAGAGCAttttgtgCCTTATTGGGATGTTTTTGTGTACCACTGGCTTA
TTTGATTGTATGGGAATTGACTCACAATCTTCCTGCATGTATACTTGCTG
CTTCATTGAttctttttgATCACGGGTGTATAACGATATCACAGTACATT
CTATTGGATCCAATCTTGATGTTTTTCATCATGATGTCTGTGTACAGTTT
ATTGAAATTCTACAGTTGGCGTGATTGCCCCTTCTCCTTTGATTGGTGGG
GTTGGATGTTTGTTACCGGATATTTCTTGGCTTGTACCTTCAGcgtCAAA
TGGGTGGGTTTGTTTGTGATTTTGTTCGCTGGAATGACAACCGTGCAAGA
TTTATGGGATATTCTTGGCGATCTATCAAATTCTCTGGTTGACGTTGGAA
AACACTTCATAGCACGTGCTATTGGCTTGATACTTCTCCCTATATTCATC
TATCTTTTCTTCTTTGCTGTTCACTTCCAAGCACTTCCTAAAAgtggtcc
AGGAGATGGATTTTTCAGTTCCTCCTTCCAATCCACGCTAGAAGGGAATA
AACTTTACAAAGCTGTTTTACCTGGTGAATTGGGGTACGGTGCTGTGGTG
ACGTTGAAGAATCACAAAACAGCTGGAACATTACTTCATTCACATCAACA
TCTTTATCCTAAAGAACATCCGCCAGAACAACAACAGATTACTGGTTACT
CGCACAAAGATTCAAATAATGATTGGCAAATTAATAAAGCACACCATCTG
ATCAcTGAAGATGATCGATTGGAATACGTTCGTGATGGTGATGAAGTGAG
ATTAATGCATGTACAAACACGTCGCAATTTACATTCCCATCCAGAGAAAG
CTCCCATTTCAACAAACCTTCATCAAGTCTCCGGCTATGGACAAGACGGT
AACGGTGATGCCAATGATATTTGGCTGATTCGAATTACCAAAAATCCTGG
CCCAGACAATCGAATTAGTACGGTCAAAACCATCTTTCAATTGGTTCATC
GTAATACTGGATGTGTTTTGcaagaaactgaaaaacaaCTGCCCAAATGG
GGTTGGGAGCAAAAAGAGATGGCGTGCAATCCAAATAAGTTTGTAACCAT
CGTCGGAAGCGAATGGAACATCGAAAGTAACACTCATAAAAAAGTACCGC
AAGTCAGCGTGGAATTGTTGTCGCCATCATTCTTCGAAAGTGTTTATGAA
TCACACGTTGTAATGGCAAAGACGAACAACGGATTCAAACCGAAGGAAGG
GGAATTTACGTCACAAGCATGGCATTGGCCCATCAATTATCGCggGCAAG
TGTTTTCTGGAGGAGATGAGCGCGTATATTTGCTCGGCAACCCGATTGTG
TGGTGGTTAATTTGCGGAACGTATTTTCTTTACGTCATCGTTTACGTCAT
ACAAACACTACGATGGAAACGAGGCTACAAGTTCGATGCCACCATTTACG
cTGAATACACAACAATGGTATCATCATGTTCGTGGCTTTTCATGGGATGG
GCGCTTCATTACCTCCCGTTTTACGCCATGGGGCGTGTTTTGTATTTCCA
TCACTATTTCCCTGCATATTTGTTTAGTGCAATGTTTTCAGgcATCTTAT
TAGAGCACGTGTCAAGAACCGTTTCATATATGTTCAGCGGTGAACGAAGA
AAGCATGTTTACTACTTTTGCTTAGCCACAGTTCTGGCCATCGCTATTTC
AAGtttttgcatGTTCCGTGGTTTATCATATGGAATGTCAGGACCAATGG
GAAACCAACCCAACCAAACCATGGCTGCTTATCGATGGCTCGATACTTGG
GATATTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000832XLOC_000832Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001593-exon-sc0000011-1491911889:659514..659964TCONS_00001593-exon-sc0000011-1491911889:659514..659964Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:659514..659964TCONS_00001593-exon-sc0000011-1510915933:659514..659964Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:659514..659964TCONS_00001593-exon-sc0000011-1575043694:659514..659964Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:678577..678661TCONS_00001593-exon-sc0000011-1491911889:678577..678661Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:678577..678661TCONS_00001593-exon-sc0000011-1510915933:678577..678661Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:678577..678661TCONS_00001593-exon-sc0000011-1575043694:678577..678661Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:678930..679034TCONS_00001593-exon-sc0000011-1491911889:678930..679034Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:678930..679034TCONS_00001593-exon-sc0000011-1510915933:678930..679034Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:678930..679034TCONS_00001593-exon-sc0000011-1575043694:678930..679034Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:679575..679683TCONS_00001593-exon-sc0000011-1491911889:679575..679683Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:679575..679683TCONS_00001593-exon-sc0000011-1510915933:679575..679683Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:679575..679683TCONS_00001593-exon-sc0000011-1575043694:679575..679683Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:679991..680099TCONS_00001593-exon-sc0000011-1491911889:679991..680099Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:679991..680099TCONS_00001593-exon-sc0000011-1510915933:679991..680099Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:679991..680099TCONS_00001593-exon-sc0000011-1575043694:679991..680099Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:680218..680283TCONS_00001593-exon-sc0000011-1491911889:680218..680283Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:680218..680283TCONS_00001593-exon-sc0000011-1510915933:680218..680283Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:680218..680283TCONS_00001593-exon-sc0000011-1575043694:680218..680283Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:680501..680594TCONS_00001593-exon-sc0000011-1491911889:680501..680594Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:680501..680594TCONS_00001593-exon-sc0000011-1510915933:680501..680594Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:680501..680594TCONS_00001593-exon-sc0000011-1575043694:680501..680594Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:682609..682715TCONS_00001593-exon-sc0000011-1491911889:682609..682715Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:682609..682715TCONS_00001593-exon-sc0000011-1510915933:682609..682715Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:682609..682715TCONS_00001593-exon-sc0000011-1575043694:682609..682715Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:682882..683074TCONS_00001593-exon-sc0000011-1491911889:682882..683074Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:682882..683074TCONS_00001593-exon-sc0000011-1510915933:682882..683074Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:682882..683074TCONS_00001593-exon-sc0000011-1575043694:682882..683074Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:683462..683528TCONS_00001593-exon-sc0000011-1491911889:683462..683528Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:683462..683528TCONS_00001593-exon-sc0000011-1510915933:683462..683528Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:683462..683528TCONS_00001593-exon-sc0000011-1575043694:683462..683528Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:683812..683872TCONS_00001593-exon-sc0000011-1491911889:683812..683872Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:683812..683872TCONS_00001593-exon-sc0000011-1510915933:683812..683872Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:683812..683872TCONS_00001593-exon-sc0000011-1575043694:683812..683872Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:684245..684323TCONS_00001593-exon-sc0000011-1491911889:684245..684323Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:684245..684323TCONS_00001593-exon-sc0000011-1510915933:684245..684323Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:684245..684323TCONS_00001593-exon-sc0000011-1575043694:684245..684323Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:684730..684884TCONS_00001593-exon-sc0000011-1491911889:684730..684884Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:684730..684884TCONS_00001593-exon-sc0000011-1510915933:684730..684884Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:684730..684884TCONS_00001593-exon-sc0000011-1575043694:684730..684884Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:685219..685313TCONS_00001593-exon-sc0000011-1491911889:685219..685313Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:685219..685313TCONS_00001593-exon-sc0000011-1510915933:685219..685313Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:685219..685313TCONS_00001593-exon-sc0000011-1575043694:685219..685313Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:685523..685599TCONS_00001593-exon-sc0000011-1491911889:685523..685599Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:685523..685599TCONS_00001593-exon-sc0000011-1510915933:685523..685599Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:685523..685599TCONS_00001593-exon-sc0000011-1575043694:685523..685599Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:685750..685821TCONS_00001593-exon-sc0000011-1491911889:685750..685821Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:685750..685821TCONS_00001593-exon-sc0000011-1510915933:685750..685821Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:685750..685821TCONS_00001593-exon-sc0000011-1575043694:685750..685821Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:685972..686022TCONS_00001593-exon-sc0000011-1491911889:685972..686022Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:685972..686022TCONS_00001593-exon-sc0000011-1510915933:685972..686022Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:685972..686022TCONS_00001593-exon-sc0000011-1575043694:685972..686022Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:686404..686509TCONS_00001593-exon-sc0000011-1491911889:686404..686509Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:686404..686509TCONS_00001593-exon-sc0000011-1510915933:686404..686509Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:686404..686509TCONS_00001593-exon-sc0000011-1575043694:686404..686509Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:686731..686871TCONS_00001593-exon-sc0000011-1491911889:686731..686871Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:686731..686871TCONS_00001593-exon-sc0000011-1510915933:686731..686871Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:686731..686871TCONS_00001593-exon-sc0000011-1575043694:686731..686871Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:687786..687897TCONS_00001593-exon-sc0000011-1491911889:687786..687897Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:687786..687897TCONS_00001593-exon-sc0000011-1510915933:687786..687897Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:687786..687897TCONS_00001593-exon-sc0000011-1575043694:687786..687897Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1491911889:688543..690240TCONS_00001593-exon-sc0000011-1491911889:688543..690240Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1510915933:688543..690240TCONS_00001593-exon-sc0000011-1510915933:688543..690240Clytia hemisphaericaexon
TCONS_00001593-exon-sc0000011-1575043694:688543..690240TCONS_00001593-exon-sc0000011-1575043694:688543..690240Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001593-proteinTCONS_00001593-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:659514..690240 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.220616 0.0710802 0 0.0920621 12.3086 12.9909 139.084 155.561 66.3433 74.8255 44.8117 40.8141 1.66537 1.14954 0 0 3.49006 7.08409 3.68486 5.89678 3.29686 4.74228 1.07952 1.17617 0.000150615 2.23432 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR016093MIR_motif
IPR032421PMT_4TMC
IPR003342Glyco_trans_39/83
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0000030mannosyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0006493protein O-linked glycosylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006493 protein O-linked glycosylation
cellular_component GO:0016020 membrane
molecular_function GO:0000030 mannosyltransferase activity
Blast
BLAST of TCONS_00001593 vs. Swiss-Prot (Human)
Match: POMT2 (Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 344/698 (49.28%), Postives = 462/698 (66.19%), Query Frame = 3
Query:  381 WFYMIFSVALF---TRFYTITLPKHVCWDETHFGKFANHYLNGTFFLDVHPPLGKMLLALAGWMTGYNGEFSFEKPGMEYGEHRYVGMRAFCALLGCFCVPLAYLIVWELTHNLPACILAASLILFDHGCITISQYILLDPILMFFIMMSVYSLLKFYSWRDCPFSFDWWGWMFVTGYFLACTFSVKWVGLFVILFAGMTTVQDLWDILGDLSNSLVDVGKHFIARAXXXXXXXXXXXXXXXAVHFQALPKXXXXXXXXXXXXXXTLEGNKLYKAVLPGELGYGAVVTLKNHKTAGTLLHSHQHLYPKEHPPEQQQITGYSHKDSNNDWQINKAHHLITEDDRL------EYVRDGDEVRLMHVQTRRNLHSHPEKAPISTNLHQVSGYGQDGNGDANDIWLIRITKNPGPDNRISTVKTIFQLVHRNTGCVLQETEKQLPKWGWEQKEMACNPNKFVTIVGSEWNIESNTHKKVPQVSVELLSPSFFESVYESHVVMAKTNNGFKPKEGEFTSQAWHWPINYRGQVFSG---GDERVYLLGNPIVWWLICGTYFLYVIVYVIQTLRWKRGYKFDATIYAEYTTMVSSCSWLFMGWALHYLPFYAMGRVLYFHHYFPAYLFSAMFSGILLEHVSRTVSY-MFSGERRKHVYYFCLATVLAIAISSFCMFRGLSYGMSGPMGNQPNQTMAAYRWLDTWD 2435
            W+ ++  V L    TRF+ +  P H+CWDETHFGK  ++Y+N TFF DVHPPLGKML+ LAG+++GY+G F F+KPG +Y  H Y+GMR FCA LG + VP AYL V +L+ +L A +L A+L+ FD GC+T+SQYILLDPILMFFIM ++ S++K+ S  D PFS  WW W+ +TG  LA    VK+VGLF+IL  G+ T+ DLW + GDLS SLV VGKH  AR + LI+LP+ +Y   FAVHF  L KSGPGDGFFSS+FQ+ L GN L+ A +P  L YG+V+T+KN + A   LHSH+HLYP+     QQQ+T Y HKD NN W I K +   T  D L      E+VR GD +RL H +T RNLHSH  +AP++   +QV+GYG +G GD+ND W I +  N    NRI  +++  + +H  TGCVL  + K LPKWGWEQ E+ C P    T+  S WN+E + + K+P +S+++L PSF E + ESH+VM + N+G KPK+ EFTS+ WHWPINY+G  FSG    D RVYLLGNP+VWWL   +  LY++   I  +  +RG +  A +      ++     + +GW LHY PF+ MGRVLYFHHYFPA LFS+M +GIL + + R  ++ + S    + ++   + ++L     SF +F  L+YGM GP+   P   MA  RWLD+WD
Sbjct:   57 WWALLALVTLLSFATRFHRLDEPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFLFQKPGDKYEHHSYMGMRGFCAFLGSWLVPFAYLTVLDLSKSLSAALLTAALLTFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCADRPFSAPWWFWLSLTGVSLAGALGVKFVGLFIILQVGLNTIADLWYLFGDLSLSLVTVGKHLTARVLCLIVLPLALYTATFAVHFMVLSKSGPGDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHN---TNSDPLDPSFPVEFVRHGDIIRLEHKETSRNLHSHYHEAPMTRKHYQVTGYGINGTGDSNDFWRIEVV-NRKFGNRIKVLRSRIRFIHLVTGCVLGSSGKVLPKWGWEQLEVTCTPYLKETL-NSIWNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFSGVNDTDFRVYLLGNPVVWWLNLLSIALYLLSGSIIAVAMQRGARLPAEVAGLSQVLLRGGGQVLLGWTLHYFPFFLMGRVLYFHHYFPAMLFSSMLTGILWDTLLRLCAWGLASWPLARGIHVAGILSLLLGTAYSFYLFHPLAYGMVGPLAQDPQSPMAGLRWLDSWD 749          
The following BLAST results are available for this feature:
BLAST of TCONS_00001593 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
POMT20.000e+049.28Protein O-mannosyl-transferase 2 OS=Homo sapiens G... [more]
back to top