Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001590 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001590
Unique NameTCONS_00001590
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4079

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001590 ID=TCONS_00001590|Name=TCONS_00001590|organism=Clytia hemisphaerica|type=transcript|length=4079bp
ATAGATATGAAAATAAGATATCAAAATTAAAAGTCCTATTGGTGTTAGCA
AATTAACCGAATGGTGAAATAATGATATTATAGAAGTTACTGGATATCCA
TATTATTATGGTGGCATCTACAGATGATACTCCTGACCTTCTTCGTATTG
GCGAATACGTTAAACAACGTTGGAAGATTGTGAAAAAAGTAGGTGGAGGA
GGTTTTGGTGAAATCTATCAAGGTCATGACACAGTCACTCATGAAATGGT
GGCTCTCAAATTGGAATCAGCCAACACTTCAAAGCAAGTCTTAAAGATGG
AAGTTGCTGTGCTGAAGAAACTTCAAGGGAGAGATCACGTGTGTCAGTTT
GTAGCTTGTGGACGCAACGATAGATTCAATTATGTCGTCATGTCGTTGGT
CGGACAAAACCTAGCGGAATTGCGACGTAGTCAATCTAGGGGTGCATTTT
CTATTGGAACTATGCTGAGATTGGGAGTGCAGATCTTGAATGGAATAGAG
GCTATACATGACTGTGGATTCTTACATCGAGATGTCAAGCCTtcaaattt
tGCAATGGGTAATACGAAACAAACAAATCGGATCGTTTATATGTTGGACT
TTGGTCTTGCCAGGCAATACATCAACAATGAAGGAAATGTCAGAGCACCT
CGTGCCGTGGCCGGTTTTCGTGGAACTGTCCGTTACGCTGCTATCACAGC
TCATGAAAATAAAGAAATGGCACGTCGTGACGATTTATGGTCTGTGTTTT
ACATGCTTGTTGAATTTGCTCAAGGAAGCCTTCCCTGGAGAAAATACAAA
GATAAGgaAGAGGTTGGGAAATTCAAGAAAGCATACGAACATAAACAACT
GTTGAAACACATGCCTGCAGAATTCAAAGAGTTTCTTGATCATATCAAAG
CATTGGAATACGCTGATAAGCCTGATTACGATTTCTTACGCCAATGTTGC
GAGAATGCACTCATGAAACGTGGTATCCGCCAAACAGATCCGTTCGATTG
GGAAAAATCTACAGTAGATGGCTCCCTTACCACAACCACATCCAGCACTT
CCAAATACATCGCTACTCCACAAGCTCTCAAACCTGACAACGCGCTCAAT
AATCCGTCCGACTTGCCGCGCTCGAATACCGTTCTAGCTGCAGGGGAGTT
TAGTTTACAGTATGATGAAGAGGACCAGCAGCAAGGACCGATTAATGTTC
AAGTGCCTGAAGGACGACAGCCcgaagtcattaataaaaagGAAGCATCA
TCGACTCCGGTGAAACTACCGAAAGCTTTCCTTCAAGCCATGAAAGAAAA
TATGTTAGCCGACGCTCGAACTAAAGATTTCAAACCGTCTGCTGCTAATC
ACGacaagaaaaattcaaagataCCTGTTTTAAAGGGGAAGTTAGCTACA
AAATCACAGAAACAACATGACTCAGGATCTACTAACCATGCTGGGAAAGT
TGCAACTCAACCAACGCCCAAAACAGAGGATTGTCCAAACTTAGAGAAAC
GCATTTCTCCGGagattttgattgaaaatgtcGATCAAAATGGACCGGCT
GAGGGcgtttgtaaacaaactgaagTGGATTCGAAAAACGAAAACAACGT
AGAACACAGTAATGATAGTAAAAGTAAAGAATCGAGCAGTCGAACTAAAA
CTTCAAAAACCGGGAAAATTGATGAGAATAACACCAAAGAAACCaataag
aaaatattgattCAAAAACAATTAGAGGAAGGACCGTTCTTTGTTCCTAC
GAAAACAGAAGATGAGGTTTTCGACCCTGGTAACGAAATGCTGGTTAACT
TACTAGGCAATATtatggaaaataaaaacaagaaactatCTTTAAATCAA
GAAGAAATTGTAGACACTGCAGATAATCCAAATTGTAACGTAAATGAGGA
ACCTGCAAATATTTATAATGAGGAGATTAAAATATCAGCTGATTCTCCAA
AGAGAAGCAACGACGAATCGCTACAACTTAAATTACCGGAAAATTTACCG
AAAAATAGTCAAGTCAATATTGCCGAACAAAATATCCCTGTTAAGGTAAC
CAAGAAAAACGAAATTAATATTTATCATGGCGAGATAAATAAAGAACTAA
ACCATGTAAATGATATACCAGAGGTCAAAGTAAGGACTTCCAATCAAATT
GATGTAGCTGTTGAAAGTAAAGAAAATGTCCAAGATGTTCGGAAAAGGAC
TTCAAATCATAGTGATCACACGGTTGAAAGCAAAATAAAGGATTCTAAGA
TCGAAAACGACAaggacttgaaaacaaaagcaacTATTGAAGTCAAATCA
GATGCGAAACCATCTACCAACATTCACAAGTCCagttctttttcgttttt
gaaCGCAAATCTTCTAGCAAACATAGAAGACCCTATAGAGCCAGAACACG
TGATCGATGCTAATGAAACCAGtattaaacttttgaaattagaACGGAAC
CCCTCATCAGAACATTCGAAAAATTCCTCAGTCTCGAAAAGCAAAGAAGA
AGAAATGGTTGAAAAGCATTCAggagaatctgaagttgaagatCCATCTT
TGGAGAAACCGAAGTTGCTTCCACCAACACCAACTCACAAACAAGACGCA
AAGTCACACTACAATAATGATCAAACTGAAACTGACAATAACGATCTACA
AAAAAGTGATCgattaaagatatttcaaacACCCATAGAAATTGGGAGGA
AAATTGAACCAGCCAAACATCACGAAGAGATTGTTGACCGTGATGAACTT
GAGGAGCGTGACTGTGCACTAGGCACCATTTACAGTGATGATAAACTAAC
TTCTGGTTATTCGTCACATCACGAAAATCACCAAGCAAAGGAAAGCTTCC
ATAATCATCATCAACCCATTGTTTTGGACGCGAAACAAGATAAAAGATAC
TCTACAGACAACCTACCACAACCCTCTTTAGAGATTCGACCAGATGCTCC
TGGCGGCAATGACATTGGAATCCTTAGATCGTCATCAAGTAGCAATCGAA
TAGCAGGCGGCGCCTCTTCATCTAAGAtgaacaaaacattcgatttacAA
TCTAACTACATGGACTCGTGCATAGATACAAAGAATCGACGTAAAGCTGA
AGTTTTAGCTGAAGATTCTATGGATGAAAATTCTGAAGGATTTCGTGGTG
AACCACATGAGAATAAATACGTTGTTGAGAAAACTGAAAATATACATTAT
TTGGAAGATGCTTACACCGGTGAAAATCCTTCGTCGGGTATAGTACAAGA
TTCTTTCGAAGAACTTAAAGTTGGACCACGGTTTACTGATAAAGAGTATT
CCAACGAAAGTCTCGATAGCCCAGAATTCAATACGAACGAAACAAAGAAA
GATAGGCGAGGCAGTAAATCCTCCTTAGCAGAGACGTTTATCAAACGGAA
AAATTCGGCcagtaatttttttaagaaagataagaaaaagGACAACTCGC
CCGATTATAAGGCGAAAAATGATAAACGACGTTTCGATGATATTCGCATG
AACGCCGACCAATCAGATCGTTCAGAAGAGTCGAGTAAAGCTGTGGTCCC
TCAACCGCCGAGTGGTCGACGCCGTGGTGCCAAGATCGAAGGGAGgtTTC
GAAGATACAAGATGTATGCTGTCCGAAATCCCAAAGGAGGTGGAAACTGA
CAAGTTAAATGAGATTCTaggtatatatttttcaatttttagtctTTTTA
CCTACTGTAATTCTTTTGATGAAATGCCATTATTGACAATAGATctatct
tatcggagttttctaaaaaagtgatgcattgtggggttgtttcgggggta
ttacaatagaaatacccccgaaacaatcccacaatgcatagctgttttag
aaaaatccaaAACTCCGTAAGGTCTATTAGGCAAAGCCTTTAAGAAATTT
TGCTTACaagaaaatcttaattttcGCCGAATAAGATTCCTTATTTTTTA
CCGTCTTCGATTTTTAATCGGTTTTGATACTCGATTTAttttaaaagtag
atttttaggaaatactCGAGTTTAtagttttcttgattttaccaaaagat
ttttaaaatcctcttgattgatattttta
Run BLAST on NCBI

protein sequence of TCONS_00001590-protein

>TCONS_00001590-protein ID=TCONS_00001590-protein|Name=TCONS_00001590-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1180bp
MVASTDDTPDLLRIGEYVKQRWKIVKKVGGGGFGEIYQGHDTVTHEMVAL
KLESANTSKQVLKMEVAVLKKLQGRDHVCQFVACGRNDRFNYVVMSLVGQ
NLAELRRSQSRGAFSIGTMLRLGVQILNGIEAIHDCGFLHRDVKPSNFAM
GNTKQTNRIVYMLDFGLARQYINNEGNVRAPRAVAGFRGTVRYAAITAHE
NKEMARRDDLWSVFYMLVEFAQGSLPWRKYKDKEEVGKFKKAYEHKQLLK
HMPAEFKEFLDHIKALEYADKPDYDFLRQCCENALMKRGIRQTDPFDWEK
STVDGSLTTTTSSTSKYIATPQALKPDNALNNPSDLPRSNTVLAAGEFSL
QYDEEDQQQGPINVQVPEGRQPEVINKKEASSTPVKLPKAFLQAMKENML
ADARTKDFKPSAANHDKKNSKIPVLKGKLATKSQKQHDSGSTNHAGKVAT
QPTPKTEDCPNLEKRISPEILIENVDQNGPAEGVCKQTEVDSKNENNVEH
SNDSKSKESSSRTKTSKTGKIDENNTKETNKKILIQKQLEEGPFFVPTKT
EDEVFDPGNEMLVNLLGNIMENKNKKLSLNQEEIVDTADNPNCNVNEEPA
NIYNEEIKISADSPKRSNDESLQLKLPENLPKNSQVNIAEQNIPVKVTKK
NEINIYHGEINKELNHVNDIPEVKVRTSNQIDVAVESKENVQDVRKRTSN
HSDHTVESKIKDSKIENDKDLKTKATIEVKSDAKPSTNIHKSSSFSFLNA
NLLANIEDPIEPEHVIDANETSIKLLKLERNPSSEHSKNSSVSKSKEEEM
VEKHSGESEVEDPSLEKPKLLPPTPTHKQDAKSHYNNDQTETDNNDLQKS
DRLKIFQTPIEIGRKIEPAKHHEEIVDRDELEERDCALGTIYSDDKLTSG
YSSHHENHQAKESFHNHHQPIVLDAKQDKRYSTDNLPQPSLEIRPDAPGG
NDIGILRSSSSSNRIAGGASSSKMNKTFDLQSNYMDSCIDTKNRRKAEVL
AEDSMDENSEGFRGEPHENKYVVEKTENIHYLEDAYTGENPSSGIVQDSF
EELKVGPRFTDKEYSNESLDSPEFNTNETKKDRRGSKSSLAETFIKRKNS
ASNFFKKDKKKDNSPDYKAKNDKRRFDDIRMNADQSDRSEESSKAVVPQP
PSGRRRGAKIEGRFRRYKMYAVRNPKGGGN
Run BLAST on NCBI

transcript from alignment at sc0000011:633542..645024+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001590 ID=TCONS_00001590|Name=TCONS_00001590|organism=Clytia hemisphaerica|type=transcript|length=11483bp|location=Sequence derived from alignment at sc0000011:633542..645024+ (Clytia hemisphaerica)
ATAGATATGAAAATAAGATATCAAAATTAAAAGTCCTATTGGTGTTAGCA AATTAACCGAATGGTGAAATAATGATATTATAGAAGTTACTGGATATCCA TATTATTATGGTGGCATCTACAGATGATACTCCTGACCTTCTTCGTATTG GCGAATACGTTAAACAACGTTGGAAGATTGTAAGTCgatattttcatatt tgtcAAAGAGTTCTTGGCTTAACATTTCAATATTTGTATGAAATCATGTT AGCAGCTTATCAAACTAATTAGAATAGAATGGCTTCCACAAGAGAAATCA GAACACAAAAAACCAAATTCAAATACCATTTTAATTGGAATCCTCAAGCT GCTGGCCCTTCTTAGATGTTTAGGCATCTGtctattaaattttttttctt ttttaaataaaaatttcttcaaCATGTGTTCTCCAAAAGGGTCACTGCTA TTTGTCATTGTTGATACTATTTATATGCTTTCTCCCTACTTGTATctcat ttcactgaagattggcGCAAAAGccccatgaaactctgagtatGAAATAA GAAGTTAACTCTTAAAATATGATGCCTTCTCCTTACATAGAGATAATGGG AAAAAGAAGCTTTGATCTCTTTGATCTAATGCTTGATTATAACATGCTTT GTAGTTGCATAAAGTAGTTTCTTATAAACATTAGGAATCGTATGAAATGT TTACAGTTATTTCTGCCCCCCTCtaattaaattgtttttattttgtctta GGTGAAAAAAGTAGGTGGAGGAGGTTTTGGTAAGTTGCAATGTTCTATAG TCACAAATaggttgaaatatattttttttagaaattttagaaatgcAATC CTTAGTAAGATTATTCAAATTCTctgatttcattaaaatatgTACCCTTC TAGAAATGTATAAAATATTGCAAACCTCGTTCTCAAAGCCTTGTTGCTAC GATACTTCAACTCCGTCAGAAGACAAAATTAATGTTTACAAGCAGTTTTA TATCTTTTGGGAAAACATATTACATGTGTAATTGTTTGAAGTAATTATTT CAATTGAAATTGAGCCTCGCAATGCTCTTGATTTATATCGAGAAGTGTGT ACTGTAAACTGATTTTTGGGATTCATTTTTGTTTcatctcttttttttta acttaaacTTTTAGGTGAAATCTATCAAGGTCATGACACAGTCACTCATG AAATGGTGGCTCTCAAATTGGAATCAGCCAACACTTCAAAGCAAGTCTTA AAGATGGAAGTTGCTGTGCTGAAGAAACTTCAAGGTGTGTATCTCCCAAG TTAATTAAAGTCTCTCCTCAttaggggccatccatatagtacacATGCAA GAAAGGGGGGGTGtaaaaaatttggcatttttgttggTACGTGCTATTTG GATAACCCCTTACGTGATTGTTTTAAAAGCAGAGGTTTGAGAttaaatat ataaattttttgaatttgtagAATTATTTGGTAAAGAAGATTTTCTAAGG GCCATATTAAAGATACAGGCAAAATGTAAAACCTGTTTAAAGgtttcatt ccattttatatccatacatggAAGTTGAAGAACATGTCCTGGGTGGGGGT TTAAGGAAATTACTTGCATTTTTCCAGGGAGtttgttttaagtttttctt tcaaagggtTTTGGTGACCAAGAATCTTCTGcctgtattttcttttttcc agggGCAAAATGATAAGCTCGACTGAGTACAAAGAGTATTTTTTGAATCT CCGGGGATGTAATTTAAAttacttaaaaagtttttctgaAGCTTCCAAGG GGGCAAAGATCCATTTAAATGCATCCAAACTCACTTTGTGTTATAAAGAA GAATTTTCATAAGGGTAATAGAAtccttttttcaagatttttttttgtaa atttttcctTTTGAAGGGGAAATCCCCTTAATCGAATCGTCCAGCTCTTG GATGGATACTAAATGGAAGTTCCAATAATATTATCAAGAACTATTTTAAA CTAATCGTCTGACGAAATTTTCTAACCTGATTTTCATCCCTAGTGATTTT AATCGGGTTGAAGGTAGTCTAGAGCTAGACTACTAATTAAcatcagtttt actcaaaagctTCTTTTACAGTAGTAGAAAAAACCTACCTAGAAGTTTGT TTACTTCTCGAGTGTTTGAATTAGTATTGACACTATTCCAACTTCCCGTA cggcttttttcttctttttgactttgagGCAGGATTGCTCCAGCTACGTT TTGTGTTAAAGAATAGTGGTCTGGAAATCGAGACTAGTTTGAAGGAAAAA ATTCAACTTAACGATCATTAGTACATTAAGTATTGTTATTGATCATTTTT AGGGAGAGATCACGTGTGTCAGTTTGTAGCTTGTGGACGCAACGATAGAT TCAATTATGTCGTCATGTCGTTGGTCGGACAAAACCTAGCGGAATTGCGA CGTAGTCAATCTAGGGGTGCATTTTCTATTGGAACTATGCTGAGATTGGG AGTGCAGATCTTGAATGGAATAGAGGCTATACATGACTGTGGATTCTTAC ATCGAGATGTCAAGCCTGTAAGTTGTATTCCTCAAGATAAACACTGTATG TTTTTATCATCATTTTTGGGGATATAATTGTCCATGTGCAACCATCTAAG attaaaattttagtttttttaaatctgatgtaTTTTAGGTTTTCACTTTC GAAACAGTGAGCGTTTTAATTTAGAAGTATGACGCTTATAAGCCTAGCAT ACCCAGGCTGACATTTTTGGCTTCAACACCttagaacaaaagaaatttaa gGATATacgtgttttcttttttataagcatacaaaaatgcaaaagctggc tcggaaatgcttagattgagagatttacaaagctgaaaaatgctttgagG GATGCTTATAATCCTAAGCAAAACTTTAGAGAAATTTcgaaattccagcc aaaaacaaacaaaatctaAAAGGAAGCTCAAAGTAATAGCATATGCTTGA ATTGTTGCTATatatgagcctagatatgcttataagcgcaatgcttatta aaaaaaacatgtgcCGAGCTTCAGCTCAAAATGAACACTATACTCGAGAA AAGAACGtttgtaatttttgttgttatgatatcttttctttttttaagtc aaattttGCAATGGGTAATACGAAACAAACAAATCGGATCGTTTATATGT TGGACTTTGGTCTTGCCAGGCAATACATCAACAATGAAGGAAATGTCAGA GCAGTGAGTACTTCCATTCAACCTATcttattcattttgattgttttaac cctttgagcatcttcattttttaccaAAGATGCCAATTCACATTTTTTAT TGCACACTCGCAAAAATTCAAGTCAATTGGAAATAGTTCGAAAGTTCtca acaaattttcttttggaaagaAGGGGATATTAAAGGGTTAATAACTACAA GGAAGGATGCTGATTGTTTTTCGTTGTTACATTATTTTTGTGGTATTCTT TATTTCAGCCTCGTGCCGTGGCCGGTTTTCGTGGAACTGTCCGTTACGCT GCTATCACAGCTCATGAAAATAAAGTAAGAAATTCGGTCCATTTAATTGA TTTCATTTATTATAACACCAAAATGCAATATTTGTAATGAAAGAACTGTT GTATAAACATTTCGAGACATGTTAACTGatcaaatttcatcattttgagA CATTTTTTGAGATCATAAATTCCATTCGCTGTAATGGGCTTTCCGCCTCC CTTTCCCTTCTTTGGACATAAAGTATGCgtactgaaaatattaaattaat ATTATCTCGTAACAGTTATCATATCCTGTATTATCATGATTATATACATA TCGAGTAAGTCCAAATAAAAGTGACGCTTCTACCAGTAAAGATCAACACA CGTTGGAACCCTCTCccacaaaaatttgcgaaaacgTCATCCCCAGTGGA CAATAATACTCCAATATTTGTCCCcgataaaaataatcaaataaacaaat cctcactcgctgcaaaatgtttcactttttcctattcccactgaattttt ctGACTTCGTTTTGAagtggaattcaaatccccagccataaaaacatgtt aattaaTCCCCATCCAGTTTCAGTCCGCTTTTTTACCTCGATAGGCTGAA AGACCGACATAAACTTCAACTTCAGGTTATTTCAGAAATCCAAAAGTCGA AAAACAATTTgtaaaatgtataaaaattgTCTTGTTTATAGGAAATGGCA CGTCGTGACGATTTATGGTCTGTGTTTTACATGCTTGTTGAATTTGCTCA AGGAAGCCTTCCCTGGAGAAAATACAAAGATAAGGTATATCATtgcctct tttttttttctggcaAGTTTTCGCAAAGAGTTTTTATTAAATGATTTACG GCGTGTGTAGGTACTGCCAACATACCTAGAAAGTTTGTAGTACGTATTCA CCCCTCAGTTTTGAACTGTAATAGATAGAAACAAAAAACTCCAAATTTCT ATATTTTCTCTCAAacgcttttttaaatttcaggaAGAGGTTGGGAAATT CAAGAAAGCATACGAACATAAACAACTGTTGAAACACATGCCTGCAGAAT TCAAAGAGTTTCTTGATCATATCAAAGCATTGGAATACGCTGATAAGCCT GATTACGATGTAAGAACAACACTTTCATTTTCCTGCTCCTTTTCTTCCCA GATCTTTTAAAAGTAGCTAATATCCATAGCTTGTTCTATCCATAACCTGG GAGATTTTTGAATACCACTATAGGAAGGAATGCCAGCTCTATTCTCATTT GTATTCAGTCTTACCGCTAAGTCTATAGATTACTTGGTTACTTAGTTTAC TTTACAGTTCAATATTCTTCAATTTCATTTATAGGGCTTTTGCAGAAAAA CTTCGTTcatagggggtggaggatatattattttcctcaatgatctaccc ctggacattttgatttttcaccccctggacaagcatcaaatcgaccccct ggacactaaaatttacccctggacattagaaattcaccccatggacatgg cagtttttcaggattttttcgatacccctggacaatatatcctctaCCCC CTATGGAAGgctttttctggaagagcccattctatGGTGTCCCGCCAACT TTCATGTATTTCTGTATGTTAAATTCTCTTCATTGTCCTTTTTAACAGTT CTTACGCCAATGTTGCGAGAATGCACTCATGAAACGTGGTATCCGCCAAA CAGATCCGTTCGATTGGGAAAAATCTACAGTAGATGGCTCCCTTACCACA ACCACATCCAGCACTTCCAAATACATCGCTACTCCACAAGCTCTCAAACC TGACAACGCGCTCAATAATCCGTCCGACTTGCCGCGCTCGAATACCGTTC TAGCTGCAGGGGAGTTTAGTTTACAGTATGATGAAGAGGACCAGCAGCAA GGACCGATTAATGTTCAAGTGCCTGAAGGACGACAGCCcgaagtcattaa taaaaagGTATGTTCTTTCTacttctttctttcttctttctatcTACTCT ACTATTTACTGGAAAATTTCACCAGTTGGAGCGAAATTCCTCTTCGTTTC CTGAATTTCgtctttatttttgttattttattctAGCTTATCACAGTTTT CTATGAAACAGAGGGCTAAATATATATATAGACTTTCGTGAAcctttgaa taaaaaatattcatgtaACATGTGTTTTTTCAAGGTTACAATAGCACAcc gctatgcaaacgtcataattattacttttaacatttgaccgaaattcaat cttaccatccttttcatcttgattcgtaaTGTGTGCAAGTTACTTTGGTA TTTAGTCCTGTAGAATTTATAGTCGACCTAGAAAAAATTCAGataaaagg tttctatataccgttggaaagataattttattaGCTTTCGAATGAGGGGT ATAGTCACATTTTACACCTTGGGCAAAATAAGTTATTGACAAAATGGTGA CAGGTggtatttttgctaaattccgaaAATGAGCACTTCAAAGGCTTTTG AACAGTTCGCTATAAGTCAGGATTGGCTCATGATACAaccttgaaacttt gcaaaacttCTCTGAGAATGGTAAGGAGTatttagaaaattcaaaattta aaaaaaaaaatcgaaaaaaatgatgacgtcatcaaaaatgacaatttttg ttaaaaaaagcatgtttttCGACAAAATATAACTAAAACTGTTTTAATGC GAAGTAAGTTTATATTAAAATGACCTAATATTTTCTACACATTATCTGCT AATCATAAAACTGACATAAATTTAGTAAAATTTAGCCATAAACATCATCG ATGCTTCTCAAAAGATCGATTCTGAGCAAGGTTAGCTTATAACGAGTGAA TTAGATGGTAGATGTGAAAAGTTAAAGCAAACTCCAACGTGAGACTCGAT ACGACATTAATTCATTTTAAACTATTCGTAAAATCCTTAATAAAAAACAC TGACTGGAAGCATGAAAAACATAATTGCAAGAAACCTACTTATGAAGACG ACATTTCTAATAAAAAGTTGTACTGAGCTAAACAAAAATATCCATAAAGT TTCTATCTTCAAGATCTACGTCATAAATAGGAACATTGTCCTCATTATCA TTATCGATTTCGATATTTCTACACGATGTACCAAGACACTCTTTGCAAAA AGTGGTACATTTCAGACCTGATTTACGACAGGTACAACGATTGCTATCGC ATCCACTTTTGCAATTGTCAATAAGTGTAATTGAGTTGCAAAAGCAATTA ATTCAAAGAATGATGGGATTAAAAATCGGACAAAAAGTATTcttgatgtc tatttttagaatcactgCGGTATGTTATTGGCTCTCGCTAATTTGAAATG GAAAAATGTAATTTGTTCGAACTACAAAGGGAttcgagtttgaaaaaaaa ttaatgggTATTATTTCTTTACGGGGATTGAGTAGTTGTTCGGATTTTAA AGATTCGTCTCgtataaaagaaatttgaattagtGAGAGCATTGTATTAC TATCTCTTCATATTTTTAATCTAACTTGCATTTTCTGTTCCTTCGCACAG CAAAATAGTTTCTTAGAGGAGCTTATTACTGAAAGTACTTTCATTGAACT ATTTTTAGGAAGCATCATCGACTCCGGTGAAACTACCGAAAGCTTTCCTT CAAGCCATGAAAGAAAATATGTTAGCCGACGCTCGAACTAAAGATTTCAA ACCGTCTGCTGCTAATCACGacaagaaaaattcaaagataCCTGTTTTAA AGGGGAAGTTAGCTACAAAATCACAGAAACAACATGACTCAGGATCTACT AACCATGCTGGGAAAGTTGCAACTCAACCAACGCCCAAAACAGAGGATTG TCCAAACTTAGAGAAACGCATTTCTCCGGagattttgattgaaaatgtcG ATCAAAATGGACCGGCTGAGGGcgtttgtaaacaaactgaagTGGATTCG AAAAACGAAAACAACGTAGAACACAGTAATGATAGTAAAAGTAAAGAATC GAGCAGTCGAACTAAAACTTCAAAAACCGGGAAAATTGATGAGAATAACA CCAAAGAAACCaataagaaaatattgattCAAAAACAATTAGAGGAAGGA CCGTTCTTTGTTCCTACGAAAACAGAAGATGAGGTTTTCGACCCTGGTAA CGAAATGCTGGTTAACTTACTAGGCAATATtatggaaaataaaaacaaga aactatCTTTAAATCAAGAAGAAATTGTAGACACTGCAGATAATCCAAAT TGTAACGTAAATGAGGAACCTGCAAATATTTATAATGAGGAGATTAAAAT ATCAGCTGATTCTCCAAAGAGAAGCAACGACGAATCGCTACAACTTAAAT TACCGGAAAATTTACCGAAAAATAGTCAAGTCAATATTGCCGAACAAAAT ATCCCTGTTAAGGTAACCAAGAAAAACGAAATTAATATTTATCATGGCGA GATAAATAAAGAACTAAACCATGTAAATGATATACCAGAGGTCAAAGTAA GGACTTCCAATCAAATTGATGTAGCTGTTGAAAGTAAAGAAAATGTCCAA GATGTTCGGAAAAGGACTTCAAATCATAGTGATCACACGGTTGAAAGCAA AATAAAGGATTCTAAGATCGAAAACGACAaggacttgaaaacaaaagcaa cTATTGAAGTCAAATCAGATGCGAAACCATCTACCAACATTCACAAGTCC agttctttttcgtttttgaaCGCAAATCTTCTAGCAAACATAGAAGACCC TATAGAGCCAGAACACGTGATCGATGCTAATGAAACCAGtattaaacttt tgaaattagaACGGAACCCCTCATCAGAACATTCGAAAAATTCCTCAGTC TCGAAAAGCAAAGAAGAAGAAATGGTTGAAAAGCATTCAggagaatctga agttgaagatCCATCTTTGGAGAAACCGAAGTTGCTTCCACCAACACCAA CTCACAAACAAGACGCAAAGTCACACTACAATAATGATCAAACTGAAACT GACAATAACGATCTACAAAAAAGTGATCgattaaagatatttcaaacACC CATAGAAATTGGGAGGAAAATTGAACCAGCCAAACATCACGAAGAGATTG TTGACCGTGATGAACTTGAGGAGCGTGACTGTGCACTAGGCACCATTTAC AGTGATGATAAACTAACTTCTGGTTATTCGTCACATCACGAAAATCACCA AGCAAAGGAAAGCTTCCATAATCATCATCAACCCATTGTTTTGGACGCGA AACAAGATAAAAGATACTCTACAGACAACCTACCACAACCCTCTTTAGAG ATTCGACCAGGTAACCCTACCCCGAACCTAGACGACAACCTCCCTTCTTA CTACCCTAGGAACAACTCCCTACCCCCTAAGTATCTACCACCCACGCCAA GTAGAGCAGGACCCTCCAATAGTGTCGCTAAAACCAACAAGACTAATAAA GAAAGTAGGACAGTGTTTAATGTGCTTTCAAATATAGTCGATGATTTGAA ATTTCGTATACAAAACAAGGCGTTACGAACACGATATGGTAGTAGTTCGG ACCTGACAACCACTGTTGAACGTcgttctaaaaagaaaaagagaatgtAT AGAAGTTTATCAATGGACTGTTTAGATGCTCCTGGCGGCAATGACATTGG AATCCTTAGATCGTCATCAAGTAGCAATCGAATAGCAGGCGGCGCCTCTT CATCTAAGAtgaacaaaacattcgatttacAATCTAACTACATGGACTCG TGCATAGATACAAAGAATCGACGTAAAGCTGAAGTTTTAGCTGAAGATTC TATGGATGAAAATTCTGAAGGATTTCGTGGTGAACCACATGAGAATAAAT ACGTTGTTGAGAAAACTGAAAATATACATTATTTGGAAGATGCTTACACC GGTGAAAATCCTTCGTCGGGTATAGTACAAGATTCTTTCGAAGAACTTAA AGTTGGACCACGGTTTACTGATAAAGAGTATTCCAACGAAAGTCTCGATA GCCCAGAATTCAATACGAACGAAACAAAGAAAGATAGGCGAGGCAGTAAA TCCTCCTTAGCAGAGACGTTTATCAAACGGAAAAATTCGGCcagtaattt ttttaagaaagataagaaaaagGACAACTCGCCCGATTATAAGGCGAAAA ATGATAAACGACGTTTCGATGATATTCGCATGAACGCCGACCAATCAGAT CGTTCAGAAGAGTCGAGTAAAGCTGTGGTCCCTCAACCGCCGAGTGGTCG ACGCCGTGGTGCCAAGATCGAAGGGAGGTAAGTAGATGTTGTTCTCTTTA TCTATATTTCTACTACCGGTTGACCCAGAAATAAATATAAAGGTTTGATG GTTTACTTTGTCCATAATAATATgaatttttactctttttgtcaagagga aaggcaaacttaaaatttgacataaagctttttaaaatttgtaCAGTGGt tctcaagttataagcttgTGAAGTCGAAATTCgcttttgaaaaagtccaa aaacacATCAAAAAAGGATATCAAATTAAGCATCGTTTAacatttttcac taaaataatttattttttttgagaaattattcAGTGTTACTGTTGTCTTA TTTTTCGTCATAACTTTAGCGAGgataattgataaaaatcaGCTGAGATC ATTAATTGAGTTGTAAAAGTCATTAGGATATAGTGAAATATGAGGTTTTC TAAATATAATTGCGTTAATTTGATGgactttttcaaaatcaaacattttt ctGGGGCACCCGGTAGCAATGATATGACTTGTAGTAGGAAAATTCGGGTG TATCATCTTGAAATACTTCGAAATAGCATGGACGAAGTGTATAATTCCAA ATTTCACTCAAAGTAATTGATTATCATTGCTCAAGGTAACCAACTAGCCA GAcatgcggcccttaagggtgcttttttcaagctttccaaagtgcactgt aagggtcgaaatgggcaaagatgagaaaaagtgcaCTCCAAGGgtgtgaa atttgaaaatctgacCAAGTATTTTGccttaaattgctcaaaaattctCA ACCACCGTAAGCGTCGATCGCCCAAATTAtgtcaaatttggctaaatctt ctctgcactgtaagggtccgttTTCAAAGGCCAAGCTTTGGACCGCATGC TCGGTCGTCTTTGAATCGCGTGCTCCCCCCCCGGGTATACTTAAAACCTC CAAAAGATAAGGTCCCGTAAGATAAATGAATTGAGGCGTGCAAATTTAAA TGTAAATTCTTACGCAAAACGCTCTTGCCCAGATAATGTTCTTAAAAGac gtaatttgtaaattttattgataattttgaGTACACCATCTTAAAAATGC CTCGTTTAGAGTCTAACTActaataaattttctttaaaaaaaaaaaattt tcatgagtTTATCAATTATTTTACTCTTTAccattaattttattttaagg tTTCGAAGATACAAGATGTATGCTGTCCGAAATCCCAAAGGAGGTGGAAA CTGACAAGTTAAATGAGATTCTaggtatatatttttcaatttttagtctT TTTACCTACTGTAATTCTTTTGATGAAATGCCATTATTGACAATAGATct atcttatcggagttttctaaaaaagtgatgcattgtggggttgtttcggg ggtattacaatagaaatacccccgaaacaatcccacaatgcatagctgtt ttagaaaaatccaaAACTCCGTAAGGTCTATTAGGCAAAGCCTTTAAGAA ATTTTGCTTACaagaaaatcttaattttcGCCGAATAAGATTCCTTATTT TTTACCGTCTTCGATTTTTAATCGGTTTTGATACTCGATTTAttttaaaa gtagatttttaggaaatactCGAGTTTAtagttttcttgattttaccaaa agatttttaaaatcctcttgattgatattttta

Coding sequence (CDS) from alignment at sc0000011:633542..645024+

>TCONS_00001590 ID=TCONS_00001590|Name=TCONS_00001590|organism=Clytia hemisphaerica|type=CDS|length=42516bp|location=Sequence derived from alignment at sc0000011:633542..645024+ (Clytia hemisphaerica)
ATGGTGGCATCTACAGATGATACTCCTGACCTTCTTCGTATTGGCGAATA
CGTTAAACAACGTTGGAAGATTGTGAAAAAAGTAGGTGGAGGAGGTTTTG
GTGAAATCTATCAAGGTCATGACACAGTCACTCATGAAATGGTGGCTCTC
AAATTGGAATCAGCCAACACTTCAAAGCAAGTCTTAAAGATGGAAGTTGC
TGTGCTGAAGAAACTTCAAGGGAGAGATCACGTGTGTCAGTTTGTAGCTT
GTGGACGCAACGATAGATTCAATTATGTCGTCATGTCGTTGGTCGGACAA
AACCTAGCGGAATTGCGACGTAGTCAATCTAGGGGTGCATTTTCTATTGG
AACTATGCTGAGATTGGGAGTGCAGATCTTGAATGGAATAGAGGCTATAC
ATGACTGTGGATTCTTACATCGAGATGTCAAGCCTtcaaattttGCAATG
GGTAATACGAAACAAACAAATCGGATCGTTTATATGTTGGACTTTGGTCT
TGCCAGGCAATACATCAACAATGAAGGAAATGTCAGAGCACCTCGTGCCG
TGGCCGGTTTTCGTGGAACTGTCCGTTACGCTGCTATCACAGCTCATGAA
AATAAAGAAATGGCACGTCGTGACGATTTATGGTCTGTGTTTTACATGCT
TGTTGAATTTGCTCAAGGAAGCCTTCCCTGGAGAAAATACAAAGATAAGg
aAGAGGTTGGGAAATTCAAGAAAGCATACGAACATAAACAACTGTTGAAA
CACATGCCTGCAGAATTCAAAGAGTTTCTTGATCATATCAAAGCATTGGA
ATACGCTGATAAGCCTGATTACGATTTCTTACGCCAATGTTGCGAGAATG
CACTCATGAAACGTGGTATCCGCCAAACAGATCCGTTCGATTGGGAAAAA
TCTACAGTAGATGGCTCCCTTACCACAACCACATCCAGCACTTCCAAATA
CATCGCTACTCCACAAGCTCTCAAACCTGACAACGCGCTCAATAATCCGT
CCGACTTGCCGCGCTCGAATACCGTTCTAGCTGCAGGGGAGTTTAGTTTA
CAGTATGATGAAGAGGACCAGCAGCAAGGACCGATTAATGTTCAAGTGCC
TGAAGGACGACAGCCcgaagtcattaataaaaagGAAGCATCATCGACTC
CGGTGAAACTACCGAAAGCTTTCCTTCAAGCCATGAAAGAAAATATGTTA
GCCGACGCTCGAACTAAAGATTTCAAACCGTCTGCTGCTAATCACGacaa
gaaaaattcaaagataCCTGTTTTAAAGGGGAAGTTAGCTACAAAATCAC
AGAAACAACATGACTCAGGATCTACTAACCATGCTGGGAAAGTTGCAACT
CAACCAACGCCCAAAACAGAGGATTGTCCAAACTTAGAGAAACGCATTTC
TCCGGagattttgattgaaaatgtcGATCAAAATGGACCGGCTGAGGGcg
tttgtaaacaaactgaagTGGATTCGAAAAACGAAAACAACGTAGAACAC
AGTAATGATAGTAAAAGTAAAGAATCGAGCAGTCGAACTAAAACTTCAAA
AACCGGGAAAATTGATGAGAATAACACCAAAGAAACCaataagaaaatat
tgattCAAAAACAATTAGAGGAAGGACCGTTCTTTGTTCCTACGAAAACA
GAAGATGAGGTTTTCGACCCTGGTAACGAAATGCTGGTTAACTTACTAGG
CAATATtatggaaaataaaaacaagaaactatCTTTAAATCAAGAAGAAA
TTGTAGACACTGCAGATAATCCAAATTGTAACGTAAATGAGGAACCTGCA
AATATTTATAATGAGGAGATTAAAATATCAGCTGATTCTCCAAAGAGAAG
CAACGACGAATCGCTACAACTTAAATTACCGGAAAATTTACCGAAAAATA
GTCAAGTCAATATTGCCGAACAAAATATCCCTGTTAAGGTAACCAAGAAA
AACGAAATTAATATTTATCATGGCGAGATAAATAAAGAACTAAACCATGT
AAATGATATACCAGAGGTCAAAGTAAGGACTTCCAATCAAATTGATGTAG
CTGTTGAAAGTAAAGAAAATGTCCAAGATGTTCGGAAAAGGACTTCAAAT
CATAGTGATCACACGGTTGAAAGCAAAATAAAGGATTCTAAGATCGAAAA
CGACAaggacttgaaaacaaaagcaacTATTGAAGTCAAATCAGATGCGA
AACCATCTACCAACATTCACAAGTCCagttctttttcgtttttgaaCGCA
AATCTTCTAGCAAACATAGAAGACCCTATAGAGCCAGAACACGTGATCGA
TGCTAATGAAACCAGtattaaacttttgaaattagaACGGAACCCCTCAT
CAGAACATTCGAAAAATTCCTCAGTCTCGAAAAGCAAAGAAGAAGAAATG
GTTGAAAAGCATTCAggagaatctgaagttgaagatCCATCTTTGGAGAA
ACCGAAGTTGCTTCCACCAACACCAACTCACAAACAAGACGCAAAGTCAC
ACTACAATAATGATCAAACTGAAACTGACAATAACGATCTACAAAAAAGT
GATCgattaaagatatttcaaacACCCATAGAAATTGGGAGGAAAATTGA
ACCAGCCAAACATCACGAAGAGATTGTTGACCGTGATGAACTTGAGGAGC
GTGACTGTGCACTAGGCACCATTTACAGTGATGATAAACTAACTTCTGGT
TATTCGTCACATCACGAAAATCACCAAGCAAAGGAAAGCTTCCATAATCA
TCATCAACCCATTGTTTTGGACGCGAAACAAGATAAAAGATACTCTACAG
ACAACCTACCACAACCCTCTTTAGAGATTCGACCAGATGCTCCTGGCGGC
AATGACATTGGAATCCTTAGATCGTCATCAAGTAGCAATCGAATAGCAGG
CGGCGCCTCTTCATCTAAGAtgaacaaaacattcgatttacAATCTAACT
ACATGGACTCGTGCATAGATACAAAGAATCGACGTAAAGCTGAAGTTTTA
GCTGAAGATTCTATGGATGAAAATTCTGAAGGATTTCGTGGTGAACCACA
TGAGAATAAATACGTTGTTGAGAAAACTGAAAATATACATTATTTGGAAG
ATGCTTACACCGGTGAAAATCCTTCGTCGGGTATAGTACAAGATTCTTTC
GAAGAACTTAAAGTTGGACCACGGTTTACTGATAAAGAGTATTCCAACGA
AAGTCTCGATAGCCCAGAATTCAATACGAACGAAACAAAGAAAGATAGGC
GAGGCAGTAAATCCTCCTTAGCAGAGACGTTTATCAAACGGAAAAATTCG
GCcagtaatttttttaagaaagataagaaaaagGACAACTCGCCCGATTA
TAAGGCGAAAAATGATAAACGACGTTTCGATGATATTCGCATGAACGCCG
ACCAATCAGATCGTTCAGAAGAGTCGAGTAAAGCTGTGGTCCCTCAACCG
CCGAGTGGTCGACGCCGTGGTGCCAAGATCGAAGGGAGgtTTCGAAGATA
CAAGATGTATGCTGTCCGAAATCCCAAAGGAGGTGGAAACTGAATGGTGG
CATCTACAGATGATACTCCTGACCTTCTTCGTATTGGCGAATACGTTAAA
CAACGTTGGAAGATTGTGAAAAAAGTAGGTGGAGGAGGTTTTGGTGAAAT
CTATCAAGGTCATGACACAGTCACTCATGAAATGGTGGCTCTCAAATTGG
AATCAGCCAACACTTCAAAGCAAGTCTTAAAGATGGAAGTTGCTGTGCTG
AAGAAACTTCAAGGGAGAGATCACGTGTGTCAGTTTGTAGCTTGTGGACG
CAACGATAGATTCAATTATGTCGTCATGTCGTTGGTCGGACAAAACCTAG
CGGAATTGCGACGTAGTCAATCTAGGGGTGCATTTTCTATTGGAACTATG
CTGAGATTGGGAGTGCAGATCTTGAATGGAATAGAGGCTATACATGACTG
TGGATTCTTACATCGAGATGTCAAGCCTtcaaattttGCAATGGGTAATA
CGAAACAAACAAATCGGATCGTTTATATGTTGGACTTTGGTCTTGCCAGG
CAATACATCAACAATGAAGGAAATGTCAGAGCACCTCGTGCCGTGGCCGG
TTTTCGTGGAACTGTCCGTTACGCTGCTATCACAGCTCATGAAAATAAAG
AAATGGCACGTCGTGACGATTTATGGTCTGTGTTTTACATGCTTGTTGAA
TTTGCTCAAGGAAGCCTTCCCTGGAGAAAATACAAAGATAAGgaAGAGGT
TGGGAAATTCAAGAAAGCATACGAACATAAACAACTGTTGAAACACATGC
CTGCAGAATTCAAAGAGTTTCTTGATCATATCAAAGCATTGGAATACGCT
GATAAGCCTGATTACGATTTCTTACGCCAATGTTGCGAGAATGCACTCAT
GAAACGTGGTATCCGCCAAACAGATCCGTTCGATTGGGAAAAATCTACAG
TAGATGGCTCCCTTACCACAACCACATCCAGCACTTCCAAATACATCGCT
ACTCCACAAGCTCTCAAACCTGACAACGCGCTCAATAATCCGTCCGACTT
GCCGCGCTCGAATACCGTTCTAGCTGCAGGGGAGTTTAGTTTACAGTATG
ATGAAGAGGACCAGCAGCAAGGACCGATTAATGTTCAAGTGCCTGAAGGA
CGACAGCCcgaagtcattaataaaaagGAAGCATCATCGACTCCGGTGAA
ACTACCGAAAGCTTTCCTTCAAGCCATGAAAGAAAATATGTTAGCCGACG
CTCGAACTAAAGATTTCAAACCGTCTGCTGCTAATCACGacaagaaaaat
tcaaagataCCTGTTTTAAAGGGGAAGTTAGCTACAAAATCACAGAAACA
ACATGACTCAGGATCTACTAACCATGCTGGGAAAGTTGCAACTCAACCAA
CGCCCAAAACAGAGGATTGTCCAAACTTAGAGAAACGCATTTCTCCGGag
attttgattgaaaatgtcGATCAAAATGGACCGGCTGAGGGcgtttgtaa
acaaactgaagTGGATTCGAAAAACGAAAACAACGTAGAACACAGTAATG
ATAGTAAAAGTAAAGAATCGAGCAGTCGAACTAAAACTTCAAAAACCGGG
AAAATTGATGAGAATAACACCAAAGAAACCaataagaaaatattgattCA
AAAACAATTAGAGGAAGGACCGTTCTTTGTTCCTACGAAAACAGAAGATG
AGGTTTTCGACCCTGGTAACGAAATGCTGGTTAACTTACTAGGCAATATt
atggaaaataaaaacaagaaactatCTTTAAATCAAGAAGAAATTGTAGA
CACTGCAGATAATCCAAATTGTAACGTAAATGAGGAACCTGCAAATATTT
ATAATGAGGAGATTAAAATATCAGCTGATTCTCCAAAGAGAAGCAACGAC
GAATCGCTACAACTTAAATTACCGGAAAATTTACCGAAAAATAGTCAAGT
CAATATTGCCGAACAAAATATCCCTGTTAAGGTAACCAAGAAAAACGAAA
TTAATATTTATCATGGCGAGATAAATAAAGAACTAAACCATGTAAATGAT
ATACCAGAGGTCAAAGTAAGGACTTCCAATCAAATTGATGTAGCTGTTGA
AAGTAAAGAAAATGTCCAAGATGTTCGGAAAAGGACTTCAAATCATAGTG
ATCACACGGTTGAAAGCAAAATAAAGGATTCTAAGATCGAAAACGACAag
gacttgaaaacaaaagcaacTATTGAAGTCAAATCAGATGCGAAACCATC
TACCAACATTCACAAGTCCagttctttttcgtttttgaaCGCAAATCTTC
TAGCAAACATAGAAGACCCTATAGAGCCAGAACACGTGATCGATGCTAAT
GAAACCAGtattaaacttttgaaattagaACGGAACCCCTCATCAGAACA
TTCGAAAAATTCCTCAGTCTCGAAAAGCAAAGAAGAAGAAATGGTTGAAA
AGCATTCAggagaatctgaagttgaagatCCATCTTTGGAGAAACCGAAG
TTGCTTCCACCAACACCAACTCACAAACAAGACGCAAAGTCACACTACAA
TAATGATCAAACTGAAACTGACAATAACGATCTACAAAAAAGTGATCgat
taaagatatttcaaacACCCATAGAAATTGGGAGGAAAATTGAACCAGCC
AAACATCACGAAGAGATTGTTGACCGTGATGAACTTGAGGAGCGTGACTG
TGCACTAGGCACCATTTACAGTGATGATAAACTAACTTCTGGTTATTCGT
CACATCACGAAAATCACCAAGCAAAGGAAAGCTTCCATAATCATCATCAA
CCCATTGTTTTGGACGCGAAACAAGATAAAAGATACTCTACAGACAACCT
ACCACAACCCTCTTTAGAGATTCGACCAGATGCTCCTGGCGGCAATGACA
TTGGAATCCTTAGATCGTCATCAAGTAGCAATCGAATAGCAGGCGGCGCC
TCTTCATCTAAGAtgaacaaaacattcgatttacAATCTAACTACATGGA
CTCGTGCATAGATACAAAGAATCGACGTAAAGCTGAAGTTTTAGCTGAAG
ATTCTATGGATGAAAATTCTGAAGGATTTCGTGGTGAACCACATGAGAAT
AAATACGTTGTTGAGAAAACTGAAAATATACATTATTTGGAAGATGCTTA
CACCGGTGAAAATCCTTCGTCGGGTATAGTACAAGATTCTTTCGAAGAAC
TTAAAGTTGGACCACGGTTTACTGATAAAGAGTATTCCAACGAAAGTCTC
GATAGCCCAGAATTCAATACGAACGAAACAAAGAAAGATAGGCGAGGCAG
TAAATCCTCCTTAGCAGAGACGTTTATCAAACGGAAAAATTCGGCcagta
atttttttaagaaagataagaaaaagGACAACTCGCCCGATTATAAGGCG
AAAAATGATAAACGACGTTTCGATGATATTCGCATGAACGCCGACCAATC
AGATCGTTCAGAAGAGTCGAGTAAAGCTGTGGTCCCTCAACCGCCGAGTG
GTCGACGCCGTGGTGCCAAGATCGAAGGGAGgtTTCGAAGATACAAGATG
TATGCTGTCCGAAATCCCAAAGGAGGTGGAAACTGAATGGTGGCATCTAC
AGATGATACTCCTGACCTTCTTCGTATTGGCGAATACGTTAAACAACGTT
GGAAGATTGTGAAAAAAGTAGGTGGAGGAGGTTTTGGTGAAATCTATCAA
GGTCATGACACAGTCACTCATGAAATGGTGGCTCTCAAATTGGAATCAGC
CAACACTTCAAAGCAAGTCTTAAAGATGGAAGTTGCTGTGCTGAAGAAAC
TTCAAGGGAGAGATCACGTGTGTCAGTTTGTAGCTTGTGGACGCAACGAT
AGATTCAATTATGTCGTCATGTCGTTGGTCGGACAAAACCTAGCGGAATT
GCGACGTAGTCAATCTAGGGGTGCATTTTCTATTGGAACTATGCTGAGAT
TGGGAGTGCAGATCTTGAATGGAATAGAGGCTATACATGACTGTGGATTC
TTACATCGAGATGTCAAGCCTtcaaattttGCAATGGGTAATACGAAACA
AACAAATCGGATCGTTTATATGTTGGACTTTGGTCTTGCCAGGCAATACA
TCAACAATGAAGGAAATGTCAGAGCACCTCGTGCCGTGGCCGGTTTTCGT
GGAACTGTCCGTTACGCTGCTATCACAGCTCATGAAAATAAAGAAATGGC
ACGTCGTGACGATTTATGGTCTGTGTTTTACATGCTTGTTGAATTTGCTC
AAGGAAGCCTTCCCTGGAGAAAATACAAAGATAAGgaAGAGGTTGGGAAA
TTCAAGAAAGCATACGAACATAAACAACTGTTGAAACACATGCCTGCAGA
ATTCAAAGAGTTTCTTGATCATATCAAAGCATTGGAATACGCTGATAAGC
CTGATTACGATTTCTTACGCCAATGTTGCGAGAATGCACTCATGAAACGT
GGTATCCGCCAAACAGATCCGTTCGATTGGGAAAAATCTACAGTAGATGG
CTCCCTTACCACAACCACATCCAGCACTTCCAAATACATCGCTACTCCAC
AAGCTCTCAAACCTGACAACGCGCTCAATAATCCGTCCGACTTGCCGCGC
TCGAATACCGTTCTAGCTGCAGGGGAGTTTAGTTTACAGTATGATGAAGA
GGACCAGCAGCAAGGACCGATTAATGTTCAAGTGCCTGAAGGACGACAGC
CcgaagtcattaataaaaagGAAGCATCATCGACTCCGGTGAAACTACCG
AAAGCTTTCCTTCAAGCCATGAAAGAAAATATGTTAGCCGACGCTCGAAC
TAAAGATTTCAAACCGTCTGCTGCTAATCACGacaagaaaaattcaaaga
taCCTGTTTTAAAGGGGAAGTTAGCTACAAAATCACAGAAACAACATGAC
TCAGGATCTACTAACCATGCTGGGAAAGTTGCAACTCAACCAACGCCCAA
AACAGAGGATTGTCCAAACTTAGAGAAACGCATTTCTCCGGagattttga
ttgaaaatgtcGATCAAAATGGACCGGCTGAGGGcgtttgtaaacaaact
gaagTGGATTCGAAAAACGAAAACAACGTAGAACACAGTAATGATAGTAA
AAGTAAAGAATCGAGCAGTCGAACTAAAACTTCAAAAACCGGGAAAATTG
ATGAGAATAACACCAAAGAAACCaataagaaaatattgattCAAAAACAA
TTAGAGGAAGGACCGTTCTTTGTTCCTACGAAAACAGAAGATGAGGTTTT
CGACCCTGGTAACGAAATGCTGGTTAACTTACTAGGCAATATtatggaaa
ataaaaacaagaaactatCTTTAAATCAAGAAGAAATTGTAGACACTGCA
GATAATCCAAATTGTAACGTAAATGAGGAACCTGCAAATATTTATAATGA
GGAGATTAAAATATCAGCTGATTCTCCAAAGAGAAGCAACGACGAATCGC
TACAACTTAAATTACCGGAAAATTTACCGAAAAATAGTCAAGTCAATATT
GCCGAACAAAATATCCCTGTTAAGGTAACCAAGAAAAACGAAATTAATAT
TTATCATGGCGAGATAAATAAAGAACTAAACCATGTAAATGATATACCAG
AGGTCAAAGTAAGGACTTCCAATCAAATTGATGTAGCTGTTGAAAGTAAA
GAAAATGTCCAAGATGTTCGGAAAAGGACTTCAAATCATAGTGATCACAC
GGTTGAAAGCAAAATAAAGGATTCTAAGATCGAAAACGACAaggacttga
aaacaaaagcaacTATTGAAGTCAAATCAGATGCGAAACCATCTACCAAC
ATTCACAAGTCCagttctttttcgtttttgaaCGCAAATCTTCTAGCAAA
CATAGAAGACCCTATAGAGCCAGAACACGTGATCGATGCTAATGAAACCA
GtattaaacttttgaaattagaACGGAACCCCTCATCAGAACATTCGAAA
AATTCCTCAGTCTCGAAAAGCAAAGAAGAAGAAATGGTTGAAAAGCATTC
AggagaatctgaagttgaagatCCATCTTTGGAGAAACCGAAGTTGCTTC
CACCAACACCAACTCACAAACAAGACGCAAAGTCACACTACAATAATGAT
CAAACTGAAACTGACAATAACGATCTACAAAAAAGTGATCgattaaagat
atttcaaacACCCATAGAAATTGGGAGGAAAATTGAACCAGCCAAACATC
ACGAAGAGATTGTTGACCGTGATGAACTTGAGGAGCGTGACTGTGCACTA
GGCACCATTTACAGTGATGATAAACTAACTTCTGGTTATTCGTCACATCA
CGAAAATCACCAAGCAAAGGAAAGCTTCCATAATCATCATCAACCCATTG
TTTTGGACGCGAAACAAGATAAAAGATACTCTACAGACAACCTACCACAA
CCCTCTTTAGAGATTCGACCAGATGCTCCTGGCGGCAATGACATTGGAAT
CCTTAGATCGTCATCAAGTAGCAATCGAATAGCAGGCGGCGCCTCTTCAT
CTAAGAtgaacaaaacattcgatttacAATCTAACTACATGGACTCGTGC
ATAGATACAAAGAATCGACGTAAAGCTGAAGTTTTAGCTGAAGATTCTAT
GGATGAAAATTCTGAAGGATTTCGTGGTGAACCACATGAGAATAAATACG
TTGTTGAGAAAACTGAAAATATACATTATTTGGAAGATGCTTACACCGGT
GAAAATCCTTCGTCGGGTATAGTACAAGATTCTTTCGAAGAACTTAAAGT
TGGACCACGGTTTACTGATAAAGAGTATTCCAACGAAAGTCTCGATAGCC
CAGAATTCAATACGAACGAAACAAAGAAAGATAGGCGAGGCAGTAAATCC
TCCTTAGCAGAGACGTTTATCAAACGGAAAAATTCGGCcagtaatttttt
taagaaagataagaaaaagGACAACTCGCCCGATTATAAGGCGAAAAATG
ATAAACGACGTTTCGATGATATTCGCATGAACGCCGACCAATCAGATCGT
TCAGAAGAGTCGAGTAAAGCTGTGGTCCCTCAACCGCCGAGTGGTCGACG
CCGTGGTGCCAAGATCGAAGGGAGgtTTCGAAGATACAAGATGTATGCTG
TCCGAAATCCCAAAGGAGGTGGAAACTGAATGGTGGCATCTACAGATGAT
ACTCCTGACCTTCTTCGTATTGGCGAATACGTTAAACAACGTTGGAAGAT
TGTGAAAAAAGTAGGTGGAGGAGGTTTTGGTGAAATCTATCAAGGTCATG
ACACAGTCACTCATGAAATGGTGGCTCTCAAATTGGAATCAGCCAACACT
TCAAAGCAAGTCTTAAAGATGGAAGTTGCTGTGCTGAAGAAACTTCAAGG
GAGAGATCACGTGTGTCAGTTTGTAGCTTGTGGACGCAACGATAGATTCA
ATTATGTCGTCATGTCGTTGGTCGGACAAAACCTAGCGGAATTGCGACGT
AGTCAATCTAGGGGTGCATTTTCTATTGGAACTATGCTGAGATTGGGAGT
GCAGATCTTGAATGGAATAGAGGCTATACATGACTGTGGATTCTTACATC
GAGATGTCAAGCCTtcaaattttGCAATGGGTAATACGAAACAAACAAAT
CGGATCGTTTATATGTTGGACTTTGGTCTTGCCAGGCAATACATCAACAA
TGAAGGAAATGTCAGAGCACCTCGTGCCGTGGCCGGTTTTCGTGGAACTG
TCCGTTACGCTGCTATCACAGCTCATGAAAATAAAGAAATGGCACGTCGT
GACGATTTATGGTCTGTGTTTTACATGCTTGTTGAATTTGCTCAAGGAAG
CCTTCCCTGGAGAAAATACAAAGATAAGgaAGAGGTTGGGAAATTCAAGA
AAGCATACGAACATAAACAACTGTTGAAACACATGCCTGCAGAATTCAAA
GAGTTTCTTGATCATATCAAAGCATTGGAATACGCTGATAAGCCTGATTA
CGATTTCTTACGCCAATGTTGCGAGAATGCACTCATGAAACGTGGTATCC
GCCAAACAGATCCGTTCGATTGGGAAAAATCTACAGTAGATGGCTCCCTT
ACCACAACCACATCCAGCACTTCCAAATACATCGCTACTCCACAAGCTCT
CAAACCTGACAACGCGCTCAATAATCCGTCCGACTTGCCGCGCTCGAATA
CCGTTCTAGCTGCAGGGGAGTTTAGTTTACAGTATGATGAAGAGGACCAG
CAGCAAGGACCGATTAATGTTCAAGTGCCTGAAGGACGACAGCCcgaagt
cattaataaaaagGAAGCATCATCGACTCCGGTGAAACTACCGAAAGCTT
TCCTTCAAGCCATGAAAGAAAATATGTTAGCCGACGCTCGAACTAAAGAT
TTCAAACCGTCTGCTGCTAATCACGacaagaaaaattcaaagataCCTGT
TTTAAAGGGGAAGTTAGCTACAAAATCACAGAAACAACATGACTCAGGAT
CTACTAACCATGCTGGGAAAGTTGCAACTCAACCAACGCCCAAAACAGAG
GATTGTCCAAACTTAGAGAAACGCATTTCTCCGGagattttgattgaaaa
tgtcGATCAAAATGGACCGGCTGAGGGcgtttgtaaacaaactgaagTGG
ATTCGAAAAACGAAAACAACGTAGAACACAGTAATGATAGTAAAAGTAAA
GAATCGAGCAGTCGAACTAAAACTTCAAAAACCGGGAAAATTGATGAGAA
TAACACCAAAGAAACCaataagaaaatattgattCAAAAACAATTAGAGG
AAGGACCGTTCTTTGTTCCTACGAAAACAGAAGATGAGGTTTTCGACCCT
GGTAACGAAATGCTGGTTAACTTACTAGGCAATATtatggaaaataaaaa
caagaaactatCTTTAAATCAAGAAGAAATTGTAGACACTGCAGATAATC
CAAATTGTAACGTAAATGAGGAACCTGCAAATATTTATAATGAGGAGATT
AAAATATCAGCTGATTCTCCAAAGAGAAGCAACGACGAATCGCTACAACT
TAAATTACCGGAAAATTTACCGAAAAATAGTCAAGTCAATATTGCCGAAC
AAAATATCCCTGTTAAGGTAACCAAGAAAAACGAAATTAATATTTATCAT
GGCGAGATAAATAAAGAACTAAACCATGTAAATGATATACCAGAGGTCAA
AGTAAGGACTTCCAATCAAATTGATGTAGCTGTTGAAAGTAAAGAAAATG
TCCAAGATGTTCGGAAAAGGACTTCAAATCATAGTGATCACACGGTTGAA
AGCAAAATAAAGGATTCTAAGATCGAAAACGACAaggacttgaaaacaaa
agcaacTATTGAAGTCAAATCAGATGCGAAACCATCTACCAACATTCACA
AGTCCagttctttttcgtttttgaaCGCAAATCTTCTAGCAAACATAGAA
GACCCTATAGAGCCAGAACACGTGATCGATGCTAATGAAACCAGtattaa
acttttgaaattagaACGGAACCCCTCATCAGAACATTCGAAAAATTCCT
CAGTCTCGAAAAGCAAAGAAGAAGAAATGGTTGAAAAGCATTCAggagaa
tctgaagttgaagatCCATCTTTGGAGAAACCGAAGTTGCTTCCACCAAC
ACCAACTCACAAACAAGACGCAAAGTCACACTACAATAATGATCAAACTG
AAACTGACAATAACGATCTACAAAAAAGTGATCgattaaagatatttcaa
acACCCATAGAAATTGGGAGGAAAATTGAACCAGCCAAACATCACGAAGA
GATTGTTGACCGTGATGAACTTGAGGAGCGTGACTGTGCACTAGGCACCA
TTTACAGTGATGATAAACTAACTTCTGGTTATTCGTCACATCACGAAAAT
CACCAAGCAAAGGAAAGCTTCCATAATCATCATCAACCCATTGTTTTGGA
CGCGAAACAAGATAAAAGATACTCTACAGACAACCTACCACAACCCTCTT
TAGAGATTCGACCAGATGCTCCTGGCGGCAATGACATTGGAATCCTTAGA
TCGTCATCAAGTAGCAATCGAATAGCAGGCGGCGCCTCTTCATCTAAGAt
gaacaaaacattcgatttacAATCTAACTACATGGACTCGTGCATAGATA
CAAAGAATCGACGTAAAGCTGAAGTTTTAGCTGAAGATTCTATGGATGAA
AATTCTGAAGGATTTCGTGGTGAACCACATGAGAATAAATACGTTGTTGA
GAAAACTGAAAATATACATTATTTGGAAGATGCTTACACCGGTGAAAATC
CTTCGTCGGGTATAGTACAAGATTCTTTCGAAGAACTTAAAGTTGGACCA
CGGTTTACTGATAAAGAGTATTCCAACGAAAGTCTCGATAGCCCAGAATT
CAATACGAACGAAACAAAGAAAGATAGGCGAGGCAGTAAATCCTCCTTAG
CAGAGACGTTTATCAAACGGAAAAATTCGGCcagtaatttttttaagaaa
gataagaaaaagGACAACTCGCCCGATTATAAGGCGAAAAATGATAAACG
ACGTTTCGATGATATTCGCATGAACGCCGACCAATCAGATCGTTCAGAAG
AGTCGAGTAAAGCTGTGGTCCCTCAACCGCCGAGTGGTCGACGCCGTGGT
GCCAAGATCGAAGGGAGgtTTCGAAGATACAAGATGTATGCTGTCCGAAA
TCCCAAAGGAGGTGGAAACTGAATGGTGGCATCTACAGATGATACTCCTG
ACCTTCTTCGTATTGGCGAATACGTTAAACAACGTTGGAAGATTGTGAAA
AAAGTAGGTGGAGGAGGTTTTGGTGAAATCTATCAAGGTCATGACACAGT
CACTCATGAAATGGTGGCTCTCAAATTGGAATCAGCCAACACTTCAAAGC
AAGTCTTAAAGATGGAAGTTGCTGTGCTGAAGAAACTTCAAGGGAGAGAT
CACGTGTGTCAGTTTGTAGCTTGTGGACGCAACGATAGATTCAATTATGT
CGTCATGTCGTTGGTCGGACAAAACCTAGCGGAATTGCGACGTAGTCAAT
CTAGGGGTGCATTTTCTATTGGAACTATGCTGAGATTGGGAGTGCAGATC
TTGAATGGAATAGAGGCTATACATGACTGTGGATTCTTACATCGAGATGT
CAAGCCTtcaaattttGCAATGGGTAATACGAAACAAACAAATCGGATCG
TTTATATGTTGGACTTTGGTCTTGCCAGGCAATACATCAACAATGAAGGA
AATGTCAGAGCACCTCGTGCCGTGGCCGGTTTTCGTGGAACTGTCCGTTA
CGCTGCTATCACAGCTCATGAAAATAAAGAAATGGCACGTCGTGACGATT
TATGGTCTGTGTTTTACATGCTTGTTGAATTTGCTCAAGGAAGCCTTCCC
TGGAGAAAATACAAAGATAAGgaAGAGGTTGGGAAATTCAAGAAAGCATA
CGAACATAAACAACTGTTGAAACACATGCCTGCAGAATTCAAAGAGTTTC
TTGATCATATCAAAGCATTGGAATACGCTGATAAGCCTGATTACGATTTC
TTACGCCAATGTTGCGAGAATGCACTCATGAAACGTGGTATCCGCCAAAC
AGATCCGTTCGATTGGGAAAAATCTACAGTAGATGGCTCCCTTACCACAA
CCACATCCAGCACTTCCAAATACATCGCTACTCCACAAGCTCTCAAACCT
GACAACGCGCTCAATAATCCGTCCGACTTGCCGCGCTCGAATACCGTTCT
AGCTGCAGGGGAGTTTAGTTTACAGTATGATGAAGAGGACCAGCAGCAAG
GACCGATTAATGTTCAAGTGCCTGAAGGACGACAGCCcgaagtcattaat
aaaaagGAAGCATCATCGACTCCGGTGAAACTACCGAAAGCTTTCCTTCA
AGCCATGAAAGAAAATATGTTAGCCGACGCTCGAACTAAAGATTTCAAAC
CGTCTGCTGCTAATCACGacaagaaaaattcaaagataCCTGTTTTAAAG
GGGAAGTTAGCTACAAAATCACAGAAACAACATGACTCAGGATCTACTAA
CCATGCTGGGAAAGTTGCAACTCAACCAACGCCCAAAACAGAGGATTGTC
CAAACTTAGAGAAACGCATTTCTCCGGagattttgattgaaaatgtcGAT
CAAAATGGACCGGCTGAGGGcgtttgtaaacaaactgaagTGGATTCGAA
AAACGAAAACAACGTAGAACACAGTAATGATAGTAAAAGTAAAGAATCGA
GCAGTCGAACTAAAACTTCAAAAACCGGGAAAATTGATGAGAATAACACC
AAAGAAACCaataagaaaatattgattCAAAAACAATTAGAGGAAGGACC
GTTCTTTGTTCCTACGAAAACAGAAGATGAGGTTTTCGACCCTGGTAACG
AAATGCTGGTTAACTTACTAGGCAATATtatggaaaataaaaacaagaaa
ctatCTTTAAATCAAGAAGAAATTGTAGACACTGCAGATAATCCAAATTG
TAACGTAAATGAGGAACCTGCAAATATTTATAATGAGGAGATTAAAATAT
CAGCTGATTCTCCAAAGAGAAGCAACGACGAATCGCTACAACTTAAATTA
CCGGAAAATTTACCGAAAAATAGTCAAGTCAATATTGCCGAACAAAATAT
CCCTGTTAAGGTAACCAAGAAAAACGAAATTAATATTTATCATGGCGAGA
TAAATAAAGAACTAAACCATGTAAATGATATACCAGAGGTCAAAGTAAGG
ACTTCCAATCAAATTGATGTAGCTGTTGAAAGTAAAGAAAATGTCCAAGA
TGTTCGGAAAAGGACTTCAAATCATAGTGATCACACGGTTGAAAGCAAAA
TAAAGGATTCTAAGATCGAAAACGACAaggacttgaaaacaaaagcaacT
ATTGAAGTCAAATCAGATGCGAAACCATCTACCAACATTCACAAGTCCag
ttctttttcgtttttgaaCGCAAATCTTCTAGCAAACATAGAAGACCCTA
TAGAGCCAGAACACGTGATCGATGCTAATGAAACCAGtattaaacttttg
aaattagaACGGAACCCCTCATCAGAACATTCGAAAAATTCCTCAGTCTC
GAAAAGCAAAGAAGAAGAAATGGTTGAAAAGCATTCAggagaatctgaag
ttgaagatCCATCTTTGGAGAAACCGAAGTTGCTTCCACCAACACCAACT
CACAAACAAGACGCAAAGTCACACTACAATAATGATCAAACTGAAACTGA
CAATAACGATCTACAAAAAAGTGATCgattaaagatatttcaaacACCCA
TAGAAATTGGGAGGAAAATTGAACCAGCCAAACATCACGAAGAGATTGTT
GACCGTGATGAACTTGAGGAGCGTGACTGTGCACTAGGCACCATTTACAG
TGATGATAAACTAACTTCTGGTTATTCGTCACATCACGAAAATCACCAAG
CAAAGGAAAGCTTCCATAATCATCATCAACCCATTGTTTTGGACGCGAAA
CAAGATAAAAGATACTCTACAGACAACCTACCACAACCCTCTTTAGAGAT
TCGACCAGATGCTCCTGGCGGCAATGACATTGGAATCCTTAGATCGTCAT
CAAGTAGCAATCGAATAGCAGGCGGCGCCTCTTCATCTAAGAtgaacaaa
acattcgatttacAATCTAACTACATGGACTCGTGCATAGATACAAAGAA
TCGACGTAAAGCTGAAGTTTTAGCTGAAGATTCTATGGATGAAAATTCTG
AAGGATTTCGTGGTGAACCACATGAGAATAAATACGTTGTTGAGAAAACT
GAAAATATACATTATTTGGAAGATGCTTACACCGGTGAAAATCCTTCGTC
GGGTATAGTACAAGATTCTTTCGAAGAACTTAAAGTTGGACCACGGTTTA
CTGATAAAGAGTATTCCAACGAAAGTCTCGATAGCCCAGAATTCAATACG
AACGAAACAAAGAAAGATAGGCGAGGCAGTAAATCCTCCTTAGCAGAGAC
GTTTATCAAACGGAAAAATTCGGCcagtaatttttttaagaaagataaga
aaaagGACAACTCGCCCGATTATAAGGCGAAAAATGATAAACGACGTTTC
GATGATATTCGCATGAACGCCGACCAATCAGATCGTTCAGAAGAGTCGAG
TAAAGCTGTGGTCCCTCAACCGCCGAGTGGTCGACGCCGTGGTGCCAAGA
TCGAAGGGAGgtTTCGAAGATACAAGATGTATGCTGTCCGAAATCCCAAA
GGAGGTGGAAACTGAATGGTGGCATCTACAGATGATACTCCTGACCTTCT
TCGTATTGGCGAATACGTTAAACAACGTTGGAAGATTGTGAAAAAAGTAG
GTGGAGGAGGTTTTGGTGAAATCTATCAAGGTCATGACACAGTCACTCAT
GAAATGGTGGCTCTCAAATTGGAATCAGCCAACACTTCAAAGCAAGTCTT
AAAGATGGAAGTTGCTGTGCTGAAGAAACTTCAAGGGAGAGATCACGTGT
GTCAGTTTGTAGCTTGTGGACGCAACGATAGATTCAATTATGTCGTCATG
TCGTTGGTCGGACAAAACCTAGCGGAATTGCGACGTAGTCAATCTAGGGG
TGCATTTTCTATTGGAACTATGCTGAGATTGGGAGTGCAGATCTTGAATG
GAATAGAGGCTATACATGACTGTGGATTCTTACATCGAGATGTCAAGCCT
tcaaattttGCAATGGGTAATACGAAACAAACAAATCGGATCGTTTATAT
GTTGGACTTTGGTCTTGCCAGGCAATACATCAACAATGAAGGAAATGTCA
GAGCACCTCGTGCCGTGGCCGGTTTTCGTGGAACTGTCCGTTACGCTGCT
ATCACAGCTCATGAAAATAAAGAAATGGCACGTCGTGACGATTTATGGTC
TGTGTTTTACATGCTTGTTGAATTTGCTCAAGGAAGCCTTCCCTGGAGAA
AATACAAAGATAAGgaAGAGGTTGGGAAATTCAAGAAAGCATACGAACAT
AAACAACTGTTGAAACACATGCCTGCAGAATTCAAAGAGTTTCTTGATCA
TATCAAAGCATTGGAATACGCTGATAAGCCTGATTACGATTTCTTACGCC
AATGTTGCGAGAATGCACTCATGAAACGTGGTATCCGCCAAACAGATCCG
TTCGATTGGGAAAAATCTACAGTAGATGGCTCCCTTACCACAACCACATC
CAGCACTTCCAAATACATCGCTACTCCACAAGCTCTCAAACCTGACAACG
CGCTCAATAATCCGTCCGACTTGCCGCGCTCGAATACCGTTCTAGCTGCA
GGGGAGTTTAGTTTACAGTATGATGAAGAGGACCAGCAGCAAGGACCGAT
TAATGTTCAAGTGCCTGAAGGACGACAGCCcgaagtcattaataaaaagG
AAGCATCATCGACTCCGGTGAAACTACCGAAAGCTTTCCTTCAAGCCATG
AAAGAAAATATGTTAGCCGACGCTCGAACTAAAGATTTCAAACCGTCTGC
TGCTAATCACGacaagaaaaattcaaagataCCTGTTTTAAAGGGGAAGT
TAGCTACAAAATCACAGAAACAACATGACTCAGGATCTACTAACCATGCT
GGGAAAGTTGCAACTCAACCAACGCCCAAAACAGAGGATTGTCCAAACTT
AGAGAAACGCATTTCTCCGGagattttgattgaaaatgtcGATCAAAATG
GACCGGCTGAGGGcgtttgtaaacaaactgaagTGGATTCGAAAAACGAA
AACAACGTAGAACACAGTAATGATAGTAAAAGTAAAGAATCGAGCAGTCG
AACTAAAACTTCAAAAACCGGGAAAATTGATGAGAATAACACCAAAGAAA
CCaataagaaaatattgattCAAAAACAATTAGAGGAAGGACCGTTCTTT
GTTCCTACGAAAACAGAAGATGAGGTTTTCGACCCTGGTAACGAAATGCT
GGTTAACTTACTAGGCAATATtatggaaaataaaaacaagaaactatCTT
TAAATCAAGAAGAAATTGTAGACACTGCAGATAATCCAAATTGTAACGTA
AATGAGGAACCTGCAAATATTTATAATGAGGAGATTAAAATATCAGCTGA
TTCTCCAAAGAGAAGCAACGACGAATCGCTACAACTTAAATTACCGGAAA
ATTTACCGAAAAATAGTCAAGTCAATATTGCCGAACAAAATATCCCTGTT
AAGGTAACCAAGAAAAACGAAATTAATATTTATCATGGCGAGATAAATAA
AGAACTAAACCATGTAAATGATATACCAGAGGTCAAAGTAAGGACTTCCA
ATCAAATTGATGTAGCTGTTGAAAGTAAAGAAAATGTCCAAGATGTTCGG
AAAAGGACTTCAAATCATAGTGATCACACGGTTGAAAGCAAAATAAAGGA
TTCTAAGATCGAAAACGACAaggacttgaaaacaaaagcaacTATTGAAG
TCAAATCAGATGCGAAACCATCTACCAACATTCACAAGTCCagttctttt
tcgtttttgaaCGCAAATCTTCTAGCAAACATAGAAGACCCTATAGAGCC
AGAACACGTGATCGATGCTAATGAAACCAGtattaaacttttgaaattag
aACGGAACCCCTCATCAGAACATTCGAAAAATTCCTCAGTCTCGAAAAGC
AAAGAAGAAGAAATGGTTGAAAAGCATTCAggagaatctgaagttgaaga
tCCATCTTTGGAGAAACCGAAGTTGCTTCCACCAACACCAACTCACAAAC
AAGACGCAAAGTCACACTACAATAATGATCAAACTGAAACTGACAATAAC
GATCTACAAAAAAGTGATCgattaaagatatttcaaacACCCATAGAAAT
TGGGAGGAAAATTGAACCAGCCAAACATCACGAAGAGATTGTTGACCGTG
ATGAACTTGAGGAGCGTGACTGTGCACTAGGCACCATTTACAGTGATGAT
AAACTAACTTCTGGTTATTCGTCACATCACGAAAATCACCAAGCAAAGGA
AAGCTTCCATAATCATCATCAACCCATTGTTTTGGACGCGAAACAAGATA
AAAGATACTCTACAGACAACCTACCACAACCCTCTTTAGAGATTCGACCA
GATGCTCCTGGCGGCAATGACATTGGAATCCTTAGATCGTCATCAAGTAG
CAATCGAATAGCAGGCGGCGCCTCTTCATCTAAGAtgaacaaaacattcg
atttacAATCTAACTACATGGACTCGTGCATAGATACAAAGAATCGACGT
AAAGCTGAAGTTTTAGCTGAAGATTCTATGGATGAAAATTCTGAAGGATT
TCGTGGTGAACCACATGAGAATAAATACGTTGTTGAGAAAACTGAAAATA
TACATTATTTGGAAGATGCTTACACCGGTGAAAATCCTTCGTCGGGTATA
GTACAAGATTCTTTCGAAGAACTTAAAGTTGGACCACGGTTTACTGATAA
AGAGTATTCCAACGAAAGTCTCGATAGCCCAGAATTCAATACGAACGAAA
CAAAGAAAGATAGGCGAGGCAGTAAATCCTCCTTAGCAGAGACGTTTATC
AAACGGAAAAATTCGGCcagtaatttttttaagaaagataagaaaaagGA
CAACTCGCCCGATTATAAGGCGAAAAATGATAAACGACGTTTCGATGATA
TTCGCATGAACGCCGACCAATCAGATCGTTCAGAAGAGTCGAGTAAAGCT
GTGGTCCCTCAACCGCCGAGTGGTCGACGCCGTGGTGCCAAGATCGAAGG
GAGgtTTCGAAGATACAAGATGTATGCTGTCCGAAATCCCAAAGGAGGTG
GAAACTGAATGGTGGCATCTACAGATGATACTCCTGACCTTCTTCGTATT
GGCGAATACGTTAAACAACGTTGGAAGATTGTGAAAAAAGTAGGTGGAGG
AGGTTTTGGTGAAATCTATCAAGGTCATGACACAGTCACTCATGAAATGG
TGGCTCTCAAATTGGAATCAGCCAACACTTCAAAGCAAGTCTTAAAGATG
GAAGTTGCTGTGCTGAAGAAACTTCAAGGGAGAGATCACGTGTGTCAGTT
TGTAGCTTGTGGACGCAACGATAGATTCAATTATGTCGTCATGTCGTTGG
TCGGACAAAACCTAGCGGAATTGCGACGTAGTCAATCTAGGGGTGCATTT
TCTATTGGAACTATGCTGAGATTGGGAGTGCAGATCTTGAATGGAATAGA
GGCTATACATGACTGTGGATTCTTACATCGAGATGTCAAGCCTtcaaatt
ttGCAATGGGTAATACGAAACAAACAAATCGGATCGTTTATATGTTGGAC
TTTGGTCTTGCCAGGCAATACATCAACAATGAAGGAAATGTCAGAGCACC
TCGTGCCGTGGCCGGTTTTCGTGGAACTGTCCGTTACGCTGCTATCACAG
CTCATGAAAATAAAGAAATGGCACGTCGTGACGATTTATGGTCTGTGTTT
TACATGCTTGTTGAATTTGCTCAAGGAAGCCTTCCCTGGAGAAAATACAA
AGATAAGgaAGAGGTTGGGAAATTCAAGAAAGCATACGAACATAAACAAC
TGTTGAAACACATGCCTGCAGAATTCAAAGAGTTTCTTGATCATATCAAA
GCATTGGAATACGCTGATAAGCCTGATTACGATTTCTTACGCCAATGTTG
CGAGAATGCACTCATGAAACGTGGTATCCGCCAAACAGATCCGTTCGATT
GGGAAAAATCTACAGTAGATGGCTCCCTTACCACAACCACATCCAGCACT
TCCAAATACATCGCTACTCCACAAGCTCTCAAACCTGACAACGCGCTCAA
TAATCCGTCCGACTTGCCGCGCTCGAATACCGTTCTAGCTGCAGGGGAGT
TTAGTTTACAGTATGATGAAGAGGACCAGCAGCAAGGACCGATTAATGTT
CAAGTGCCTGAAGGACGACAGCCcgaagtcattaataaaaagGAAGCATC
ATCGACTCCGGTGAAACTACCGAAAGCTTTCCTTCAAGCCATGAAAGAAA
ATATGTTAGCCGACGCTCGAACTAAAGATTTCAAACCGTCTGCTGCTAAT
CACGacaagaaaaattcaaagataCCTGTTTTAAAGGGGAAGTTAGCTAC
AAAATCACAGAAACAACATGACTCAGGATCTACTAACCATGCTGGGAAAG
TTGCAACTCAACCAACGCCCAAAACAGAGGATTGTCCAAACTTAGAGAAA
CGCATTTCTCCGGagattttgattgaaaatgtcGATCAAAATGGACCGGC
TGAGGGcgtttgtaaacaaactgaagTGGATTCGAAAAACGAAAACAACG
TAGAACACAGTAATGATAGTAAAAGTAAAGAATCGAGCAGTCGAACTAAA
ACTTCAAAAACCGGGAAAATTGATGAGAATAACACCAAAGAAACCaataa
gaaaatattgattCAAAAACAATTAGAGGAAGGACCGTTCTTTGTTCCTA
CGAAAACAGAAGATGAGGTTTTCGACCCTGGTAACGAAATGCTGGTTAAC
TTACTAGGCAATATtatggaaaataaaaacaagaaactatCTTTAAATCA
AGAAGAAATTGTAGACACTGCAGATAATCCAAATTGTAACGTAAATGAGG
AACCTGCAAATATTTATAATGAGGAGATTAAAATATCAGCTGATTCTCCA
AAGAGAAGCAACGACGAATCGCTACAACTTAAATTACCGGAAAATTTACC
GAAAAATAGTCAAGTCAATATTGCCGAACAAAATATCCCTGTTAAGGTAA
CCAAGAAAAACGAAATTAATATTTATCATGGCGAGATAAATAAAGAACTA
AACCATGTAAATGATATACCAGAGGTCAAAGTAAGGACTTCCAATCAAAT
TGATGTAGCTGTTGAAAGTAAAGAAAATGTCCAAGATGTTCGGAAAAGGA
CTTCAAATCATAGTGATCACACGGTTGAAAGCAAAATAAAGGATTCTAAG
ATCGAAAACGACAaggacttgaaaacaaaagcaacTATTGAAGTCAAATC
AGATGCGAAACCATCTACCAACATTCACAAGTCCagttctttttcgtttt
tgaaCGCAAATCTTCTAGCAAACATAGAAGACCCTATAGAGCCAGAACAC
GTGATCGATGCTAATGAAACCAGtattaaacttttgaaattagaACGGAA
CCCCTCATCAGAACATTCGAAAAATTCCTCAGTCTCGAAAAGCAAAGAAG
AAGAAATGGTTGAAAAGCATTCAggagaatctgaagttgaagatCCATCT
TTGGAGAAACCGAAGTTGCTTCCACCAACACCAACTCACAAACAAGACGC
AAAGTCACACTACAATAATGATCAAACTGAAACTGACAATAACGATCTAC
AAAAAAGTGATCgattaaagatatttcaaacACCCATAGAAATTGGGAGG
AAAATTGAACCAGCCAAACATCACGAAGAGATTGTTGACCGTGATGAACT
TGAGGAGCGTGACTGTGCACTAGGCACCATTTACAGTGATGATAAACTAA
CTTCTGGTTATTCGTCACATCACGAAAATCACCAAGCAAAGGAAAGCTTC
CATAATCATCATCAACCCATTGTTTTGGACGCGAAACAAGATAAAAGATA
CTCTACAGACAACCTACCACAACCCTCTTTAGAGATTCGACCAGATGCTC
CTGGCGGCAATGACATTGGAATCCTTAGATCGTCATCAAGTAGCAATCGA
ATAGCAGGCGGCGCCTCTTCATCTAAGAtgaacaaaacattcgatttacA
ATCTAACTACATGGACTCGTGCATAGATACAAAGAATCGACGTAAAGCTG
AAGTTTTAGCTGAAGATTCTATGGATGAAAATTCTGAAGGATTTCGTGGT
GAACCACATGAGAATAAATACGTTGTTGAGAAAACTGAAAATATACATTA
TTTGGAAGATGCTTACACCGGTGAAAATCCTTCGTCGGGTATAGTACAAG
ATTCTTTCGAAGAACTTAAAGTTGGACCACGGTTTACTGATAAAGAGTAT
TCCAACGAAAGTCTCGATAGCCCAGAATTCAATACGAACGAAACAAAGAA
AGATAGGCGAGGCAGTAAATCCTCCTTAGCAGAGACGTTTATCAAACGGA
AAAATTCGGCcagtaatttttttaagaaagataagaaaaagGACAACTCG
CCCGATTATAAGGCGAAAAATGATAAACGACGTTTCGATGATATTCGCAT
GAACGCCGACCAATCAGATCGTTCAGAAGAGTCGAGTAAAGCTGTGGTCC
CTCAACCGCCGAGTGGTCGACGCCGTGGTGCCAAGATCGAAGGGAGgtTT
CGAAGATACAAGATGTATGCTGTCCGAAATCCCAAAGGAGGTGGAAACTG
AATGGTGGCATCTACAGATGATACTCCTGACCTTCTTCGTATTGGCGAAT
ACGTTAAACAACGTTGGAAGATTGTGAAAAAAGTAGGTGGAGGAGGTTTT
GGTGAAATCTATCAAGGTCATGACACAGTCACTCATGAAATGGTGGCTCT
CAAATTGGAATCAGCCAACACTTCAAAGCAAGTCTTAAAGATGGAAGTTG
CTGTGCTGAAGAAACTTCAAGGGAGAGATCACGTGTGTCAGTTTGTAGCT
TGTGGACGCAACGATAGATTCAATTATGTCGTCATGTCGTTGGTCGGACA
AAACCTAGCGGAATTGCGACGTAGTCAATCTAGGGGTGCATTTTCTATTG
GAACTATGCTGAGATTGGGAGTGCAGATCTTGAATGGAATAGAGGCTATA
CATGACTGTGGATTCTTACATCGAGATGTCAAGCCTtcaaattttGCAAT
GGGTAATACGAAACAAACAAATCGGATCGTTTATATGTTGGACTTTGGTC
TTGCCAGGCAATACATCAACAATGAAGGAAATGTCAGAGCACCTCGTGCC
GTGGCCGGTTTTCGTGGAACTGTCCGTTACGCTGCTATCACAGCTCATGA
AAATAAAGAAATGGCACGTCGTGACGATTTATGGTCTGTGTTTTACATGC
TTGTTGAATTTGCTCAAGGAAGCCTTCCCTGGAGAAAATACAAAGATAAG
gaAGAGGTTGGGAAATTCAAGAAAGCATACGAACATAAACAACTGTTGAA
ACACATGCCTGCAGAATTCAAAGAGTTTCTTGATCATATCAAAGCATTGG
AATACGCTGATAAGCCTGATTACGATTTCTTACGCCAATGTTGCGAGAAT
GCACTCATGAAACGTGGTATCCGCCAAACAGATCCGTTCGATTGGGAAAA
ATCTACAGTAGATGGCTCCCTTACCACAACCACATCCAGCACTTCCAAAT
ACATCGCTACTCCACAAGCTCTCAAACCTGACAACGCGCTCAATAATCCG
TCCGACTTGCCGCGCTCGAATACCGTTCTAGCTGCAGGGGAGTTTAGTTT
ACAGTATGATGAAGAGGACCAGCAGCAAGGACCGATTAATGTTCAAGTGC
CTGAAGGACGACAGCCcgaagtcattaataaaaagGAAGCATCATCGACT
CCGGTGAAACTACCGAAAGCTTTCCTTCAAGCCATGAAAGAAAATATGTT
AGCCGACGCTCGAACTAAAGATTTCAAACCGTCTGCTGCTAATCACGaca
agaaaaattcaaagataCCTGTTTTAAAGGGGAAGTTAGCTACAAAATCA
CAGAAACAACATGACTCAGGATCTACTAACCATGCTGGGAAAGTTGCAAC
TCAACCAACGCCCAAAACAGAGGATTGTCCAAACTTAGAGAAACGCATTT
CTCCGGagattttgattgaaaatgtcGATCAAAATGGACCGGCTGAGGGc
gtttgtaaacaaactgaagTGGATTCGAAAAACGAAAACAACGTAGAACA
CAGTAATGATAGTAAAAGTAAAGAATCGAGCAGTCGAACTAAAACTTCAA
AAACCGGGAAAATTGATGAGAATAACACCAAAGAAACCaataagaaaata
ttgattCAAAAACAATTAGAGGAAGGACCGTTCTTTGTTCCTACGAAAAC
AGAAGATGAGGTTTTCGACCCTGGTAACGAAATGCTGGTTAACTTACTAG
GCAATATtatggaaaataaaaacaagaaactatCTTTAAATCAAGAAGAA
ATTGTAGACACTGCAGATAATCCAAATTGTAACGTAAATGAGGAACCTGC
AAATATTTATAATGAGGAGATTAAAATATCAGCTGATTCTCCAAAGAGAA
GCAACGACGAATCGCTACAACTTAAATTACCGGAAAATTTACCGAAAAAT
AGTCAAGTCAATATTGCCGAACAAAATATCCCTGTTAAGGTAACCAAGAA
AAACGAAATTAATATTTATCATGGCGAGATAAATAAAGAACTAAACCATG
TAAATGATATACCAGAGGTCAAAGTAAGGACTTCCAATCAAATTGATGTA
GCTGTTGAAAGTAAAGAAAATGTCCAAGATGTTCGGAAAAGGACTTCAAA
TCATAGTGATCACACGGTTGAAAGCAAAATAAAGGATTCTAAGATCGAAA
ACGACAaggacttgaaaacaaaagcaacTATTGAAGTCAAATCAGATGCG
AAACCATCTACCAACATTCACAAGTCCagttctttttcgtttttgaaCGC
AAATCTTCTAGCAAACATAGAAGACCCTATAGAGCCAGAACACGTGATCG
ATGCTAATGAAACCAGtattaaacttttgaaattagaACGGAACCCCTCA
TCAGAACATTCGAAAAATTCCTCAGTCTCGAAAAGCAAAGAAGAAGAAAT
GGTTGAAAAGCATTCAggagaatctgaagttgaagatCCATCTTTGGAGA
AACCGAAGTTGCTTCCACCAACACCAACTCACAAACAAGACGCAAAGTCA
CACTACAATAATGATCAAACTGAAACTGACAATAACGATCTACAAAAAAG
TGATCgattaaagatatttcaaacACCCATAGAAATTGGGAGGAAAATTG
AACCAGCCAAACATCACGAAGAGATTGTTGACCGTGATGAACTTGAGGAG
CGTGACTGTGCACTAGGCACCATTTACAGTGATGATAAACTAACTTCTGG
TTATTCGTCACATCACGAAAATCACCAAGCAAAGGAAAGCTTCCATAATC
ATCATCAACCCATTGTTTTGGACGCGAAACAAGATAAAAGATACTCTACA
GACAACCTACCACAACCCTCTTTAGAGATTCGACCAGATGCTCCTGGCGG
CAATGACATTGGAATCCTTAGATCGTCATCAAGTAGCAATCGAATAGCAG
GCGGCGCCTCTTCATCTAAGAtgaacaaaacattcgatttacAATCTAAC
TACATGGACTCGTGCATAGATACAAAGAATCGACGTAAAGCTGAAGTTTT
AGCTGAAGATTCTATGGATGAAAATTCTGAAGGATTTCGTGGTGAACCAC
ATGAGAATAAATACGTTGTTGAGAAAACTGAAAATATACATTATTTGGAA
GATGCTTACACCGGTGAAAATCCTTCGTCGGGTATAGTACAAGATTCTTT
CGAAGAACTTAAAGTTGGACCACGGTTTACTGATAAAGAGTATTCCAACG
AAAGTCTCGATAGCCCAGAATTCAATACGAACGAAACAAAGAAAGATAGG
CGAGGCAGTAAATCCTCCTTAGCAGAGACGTTTATCAAACGGAAAAATTC
GGCcagtaatttttttaagaaagataagaaaaagGACAACTCGCCCGATT
ATAAGGCGAAAAATGATAAACGACGTTTCGATGATATTCGCATGAACGCC
GACCAATCAGATCGTTCAGAAGAGTCGAGTAAAGCTGTGGTCCCTCAACC
GCCGAGTGGTCGACGCCGTGGTGCCAAGATCGAAGGGAGgtTTCGAAGAT
ACAAGATGTATGCTGTCCGAAATCCCAAAGGAGGTGGAAACTGAATGGTG
GCATCTACAGATGATACTCCTGACCTTCTTCGTATTGGCGAATACGTTAA
ACAACGTTGGAAGATTGTGAAAAAAGTAGGTGGAGGAGGTTTTGGTGAAA
TCTATCAAGGTCATGACACAGTCACTCATGAAATGGTGGCTCTCAAATTG
GAATCAGCCAACACTTCAAAGCAAGTCTTAAAGATGGAAGTTGCTGTGCT
GAAGAAACTTCAAGGGAGAGATCACGTGTGTCAGTTTGTAGCTTGTGGAC
GCAACGATAGATTCAATTATGTCGTCATGTCGTTGGTCGGACAAAACCTA
GCGGAATTGCGACGTAGTCAATCTAGGGGTGCATTTTCTATTGGAACTAT
GCTGAGATTGGGAGTGCAGATCTTGAATGGAATAGAGGCTATACATGACT
GTGGATTCTTACATCGAGATGTCAAGCCTtcaaattttGCAATGGGTAAT
ACGAAACAAACAAATCGGATCGTTTATATGTTGGACTTTGGTCTTGCCAG
GCAATACATCAACAATGAAGGAAATGTCAGAGCACCTCGTGCCGTGGCCG
GTTTTCGTGGAACTGTCCGTTACGCTGCTATCACAGCTCATGAAAATAAA
GAAATGGCACGTCGTGACGATTTATGGTCTGTGTTTTACATGCTTGTTGA
ATTTGCTCAAGGAAGCCTTCCCTGGAGAAAATACAAAGATAAGgaAGAGG
TTGGGAAATTCAAGAAAGCATACGAACATAAACAACTGTTGAAACACATG
CCTGCAGAATTCAAAGAGTTTCTTGATCATATCAAAGCATTGGAATACGC
TGATAAGCCTGATTACGATTTCTTACGCCAATGTTGCGAGAATGCACTCA
TGAAACGTGGTATCCGCCAAACAGATCCGTTCGATTGGGAAAAATCTACA
GTAGATGGCTCCCTTACCACAACCACATCCAGCACTTCCAAATACATCGC
TACTCCACAAGCTCTCAAACCTGACAACGCGCTCAATAATCCGTCCGACT
TGCCGCGCTCGAATACCGTTCTAGCTGCAGGGGAGTTTAGTTTACAGTAT
GATGAAGAGGACCAGCAGCAAGGACCGATTAATGTTCAAGTGCCTGAAGG
ACGACAGCCcgaagtcattaataaaaagGAAGCATCATCGACTCCGGTGA
AACTACCGAAAGCTTTCCTTCAAGCCATGAAAGAAAATATGTTAGCCGAC
GCTCGAACTAAAGATTTCAAACCGTCTGCTGCTAATCACGacaagaaaaa
ttcaaagataCCTGTTTTAAAGGGGAAGTTAGCTACAAAATCACAGAAAC
AACATGACTCAGGATCTACTAACCATGCTGGGAAAGTTGCAACTCAACCA
ACGCCCAAAACAGAGGATTGTCCAAACTTAGAGAAACGCATTTCTCCGGa
gattttgattgaaaatgtcGATCAAAATGGACCGGCTGAGGGcgtttgta
aacaaactgaagTGGATTCGAAAAACGAAAACAACGTAGAACACAGTAAT
GATAGTAAAAGTAAAGAATCGAGCAGTCGAACTAAAACTTCAAAAACCGG
GAAAATTGATGAGAATAACACCAAAGAAACCaataagaaaatattgattC
AAAAACAATTAGAGGAAGGACCGTTCTTTGTTCCTACGAAAACAGAAGAT
GAGGTTTTCGACCCTGGTAACGAAATGCTGGTTAACTTACTAGGCAATAT
tatggaaaataaaaacaagaaactatCTTTAAATCAAGAAGAAATTGTAG
ACACTGCAGATAATCCAAATTGTAACGTAAATGAGGAACCTGCAAATATT
TATAATGAGGAGATTAAAATATCAGCTGATTCTCCAAAGAGAAGCAACGA
CGAATCGCTACAACTTAAATTACCGGAAAATTTACCGAAAAATAGTCAAG
TCAATATTGCCGAACAAAATATCCCTGTTAAGGTAACCAAGAAAAACGAA
ATTAATATTTATCATGGCGAGATAAATAAAGAACTAAACCATGTAAATGA
TATACCAGAGGTCAAAGTAAGGACTTCCAATCAAATTGATGTAGCTGTTG
AAAGTAAAGAAAATGTCCAAGATGTTCGGAAAAGGACTTCAAATCATAGT
GATCACACGGTTGAAAGCAAAATAAAGGATTCTAAGATCGAAAACGACAa
ggacttgaaaacaaaagcaacTATTGAAGTCAAATCAGATGCGAAACCAT
CTACCAACATTCACAAGTCCagttctttttcgtttttgaaCGCAAATCTT
CTAGCAAACATAGAAGACCCTATAGAGCCAGAACACGTGATCGATGCTAA
TGAAACCAGtattaaacttttgaaattagaACGGAACCCCTCATCAGAAC
ATTCGAAAAATTCCTCAGTCTCGAAAAGCAAAGAAGAAGAAATGGTTGAA
AAGCATTCAggagaatctgaagttgaagatCCATCTTTGGAGAAACCGAA
GTTGCTTCCACCAACACCAACTCACAAACAAGACGCAAAGTCACACTACA
ATAATGATCAAACTGAAACTGACAATAACGATCTACAAAAAAGTGATCga
ttaaagatatttcaaacACCCATAGAAATTGGGAGGAAAATTGAACCAGC
CAAACATCACGAAGAGATTGTTGACCGTGATGAACTTGAGGAGCGTGACT
GTGCACTAGGCACCATTTACAGTGATGATAAACTAACTTCTGGTTATTCG
TCACATCACGAAAATCACCAAGCAAAGGAAAGCTTCCATAATCATCATCA
ACCCATTGTTTTGGACGCGAAACAAGATAAAAGATACTCTACAGACAACC
TACCACAACCCTCTTTAGAGATTCGACCAGATGCTCCTGGCGGCAATGAC
ATTGGAATCCTTAGATCGTCATCAAGTAGCAATCGAATAGCAGGCGGCGC
CTCTTCATCTAAGAtgaacaaaacattcgatttacAATCTAACTACATGG
ACTCGTGCATAGATACAAAGAATCGACGTAAAGCTGAAGTTTTAGCTGAA
GATTCTATGGATGAAAATTCTGAAGGATTTCGTGGTGAACCACATGAGAA
TAAATACGTTGTTGAGAAAACTGAAAATATACATTATTTGGAAGATGCTT
ACACCGGTGAAAATCCTTCGTCGGGTATAGTACAAGATTCTTTCGAAGAA
CTTAAAGTTGGACCACGGTTTACTGATAAAGAGTATTCCAACGAAAGTCT
CGATAGCCCAGAATTCAATACGAACGAAACAAAGAAAGATAGGCGAGGCA
GTAAATCCTCCTTAGCAGAGACGTTTATCAAACGGAAAAATTCGGCcagt
aatttttttaagaaagataagaaaaagGACAACTCGCCCGATTATAAGGC
GAAAAATGATAAACGACGTTTCGATGATATTCGCATGAACGCCGACCAAT
CAGATCGTTCAGAAGAGTCGAGTAAAGCTGTGGTCCCTCAACCGCCGAGT
GGTCGACGCCGTGGTGCCAAGATCGAAGGGAGgtTTCGAAGATACAAGAT
GTATGCTGTCCGAAATCCCAAAGGAGGTGGAAACTGAATGGTGGCATCTA
CAGATGATACTCCTGACCTTCTTCGTATTGGCGAATACGTTAAACAACGT
TGGAAGATTGTGAAAAAAGTAGGTGGAGGAGGTTTTGGTGAAATCTATCA
AGGTCATGACACAGTCACTCATGAAATGGTGGCTCTCAAATTGGAATCAG
CCAACACTTCAAAGCAAGTCTTAAAGATGGAAGTTGCTGTGCTGAAGAAA
CTTCAAGGGAGAGATCACGTGTGTCAGTTTGTAGCTTGTGGACGCAACGA
TAGATTCAATTATGTCGTCATGTCGTTGGTCGGACAAAACCTAGCGGAAT
TGCGACGTAGTCAATCTAGGGGTGCATTTTCTATTGGAACTATGCTGAGA
TTGGGAGTGCAGATCTTGAATGGAATAGAGGCTATACATGACTGTGGATT
CTTACATCGAGATGTCAAGCCTtcaaattttGCAATGGGTAATACGAAAC
AAACAAATCGGATCGTTTATATGTTGGACTTTGGTCTTGCCAGGCAATAC
ATCAACAATGAAGGAAATGTCAGAGCACCTCGTGCCGTGGCCGGTTTTCG
TGGAACTGTCCGTTACGCTGCTATCACAGCTCATGAAAATAAAGAAATGG
CACGTCGTGACGATTTATGGTCTGTGTTTTACATGCTTGTTGAATTTGCT
CAAGGAAGCCTTCCCTGGAGAAAATACAAAGATAAGgaAGAGGTTGGGAA
ATTCAAGAAAGCATACGAACATAAACAACTGTTGAAACACATGCCTGCAG
AATTCAAAGAGTTTCTTGATCATATCAAAGCATTGGAATACGCTGATAAG
CCTGATTACGATTTCTTACGCCAATGTTGCGAGAATGCACTCATGAAACG
TGGTATCCGCCAAACAGATCCGTTCGATTGGGAAAAATCTACAGTAGATG
GCTCCCTTACCACAACCACATCCAGCACTTCCAAATACATCGCTACTCCA
CAAGCTCTCAAACCTGACAACGCGCTCAATAATCCGTCCGACTTGCCGCG
CTCGAATACCGTTCTAGCTGCAGGGGAGTTTAGTTTACAGTATGATGAAG
AGGACCAGCAGCAAGGACCGATTAATGTTCAAGTGCCTGAAGGACGACAG
CCcgaagtcattaataaaaagGAAGCATCATCGACTCCGGTGAAACTACC
GAAAGCTTTCCTTCAAGCCATGAAAGAAAATATGTTAGCCGACGCTCGAA
CTAAAGATTTCAAACCGTCTGCTGCTAATCACGacaagaaaaattcaaag
ataCCTGTTTTAAAGGGGAAGTTAGCTACAAAATCACAGAAACAACATGA
CTCAGGATCTACTAACCATGCTGGGAAAGTTGCAACTCAACCAACGCCCA
AAACAGAGGATTGTCCAAACTTAGAGAAACGCATTTCTCCGGagattttg
attgaaaatgtcGATCAAAATGGACCGGCTGAGGGcgtttgtaaacaaac
tgaagTGGATTCGAAAAACGAAAACAACGTAGAACACAGTAATGATAGTA
AAAGTAAAGAATCGAGCAGTCGAACTAAAACTTCAAAAACCGGGAAAATT
GATGAGAATAACACCAAAGAAACCaataagaaaatattgattCAAAAACA
ATTAGAGGAAGGACCGTTCTTTGTTCCTACGAAAACAGAAGATGAGGTTT
TCGACCCTGGTAACGAAATGCTGGTTAACTTACTAGGCAATATtatggaa
aataaaaacaagaaactatCTTTAAATCAAGAAGAAATTGTAGACACTGC
AGATAATCCAAATTGTAACGTAAATGAGGAACCTGCAAATATTTATAATG
AGGAGATTAAAATATCAGCTGATTCTCCAAAGAGAAGCAACGACGAATCG
CTACAACTTAAATTACCGGAAAATTTACCGAAAAATAGTCAAGTCAATAT
TGCCGAACAAAATATCCCTGTTAAGGTAACCAAGAAAAACGAAATTAATA
TTTATCATGGCGAGATAAATAAAGAACTAAACCATGTAAATGATATACCA
GAGGTCAAAGTAAGGACTTCCAATCAAATTGATGTAGCTGTTGAAAGTAA
AGAAAATGTCCAAGATGTTCGGAAAAGGACTTCAAATCATAGTGATCACA
CGGTTGAAAGCAAAATAAAGGATTCTAAGATCGAAAACGACAaggacttg
aaaacaaaagcaacTATTGAAGTCAAATCAGATGCGAAACCATCTACCAA
CATTCACAAGTCCagttctttttcgtttttgaaCGCAAATCTTCTAGCAA
ACATAGAAGACCCTATAGAGCCAGAACACGTGATCGATGCTAATGAAACC
AGtattaaacttttgaaattagaACGGAACCCCTCATCAGAACATTCGAA
AAATTCCTCAGTCTCGAAAAGCAAAGAAGAAGAAATGGTTGAAAAGCATT
CAggagaatctgaagttgaagatCCATCTTTGGAGAAACCGAAGTTGCTT
CCACCAACACCAACTCACAAACAAGACGCAAAGTCACACTACAATAATGA
TCAAACTGAAACTGACAATAACGATCTACAAAAAAGTGATCgattaaaga
tatttcaaacACCCATAGAAATTGGGAGGAAAATTGAACCAGCCAAACAT
CACGAAGAGATTGTTGACCGTGATGAACTTGAGGAGCGTGACTGTGCACT
AGGCACCATTTACAGTGATGATAAACTAACTTCTGGTTATTCGTCACATC
ACGAAAATCACCAAGCAAAGGAAAGCTTCCATAATCATCATCAACCCATT
GTTTTGGACGCGAAACAAGATAAAAGATACTCTACAGACAACCTACCACA
ACCCTCTTTAGAGATTCGACCAGATGCTCCTGGCGGCAATGACATTGGAA
TCCTTAGATCGTCATCAAGTAGCAATCGAATAGCAGGCGGCGCCTCTTCA
TCTAAGAtgaacaaaacattcgatttacAATCTAACTACATGGACTCGTG
CATAGATACAAAGAATCGACGTAAAGCTGAAGTTTTAGCTGAAGATTCTA
TGGATGAAAATTCTGAAGGATTTCGTGGTGAACCACATGAGAATAAATAC
GTTGTTGAGAAAACTGAAAATATACATTATTTGGAAGATGCTTACACCGG
TGAAAATCCTTCGTCGGGTATAGTACAAGATTCTTTCGAAGAACTTAAAG
TTGGACCACGGTTTACTGATAAAGAGTATTCCAACGAAAGTCTCGATAGC
CCAGAATTCAATACGAACGAAACAAAGAAAGATAGGCGAGGCAGTAAATC
CTCCTTAGCAGAGACGTTTATCAAACGGAAAAATTCGGCcagtaattttt
ttaagaaagataagaaaaagGACAACTCGCCCGATTATAAGGCGAAAAAT
GATAAACGACGTTTCGATGATATTCGCATGAACGCCGACCAATCAGATCG
TTCAGAAGAGTCGAGTAAAGCTGTGGTCCCTCAACCGCCGAGTGGTCGAC
GCCGTGGTGCCAAGATCGAAGGGAGgtTTCGAAGATACAAGATGTATGCT
GTCCGAAATCCCAAAGGAGGTGGAAACTGAATGGTGGCATCTACAGATGA
TACTCCTGACCTTCTTCGTATTGGCGAATACGTTAAACAACGTTGGAAGA
TTGTGAAAAAAGTAGGTGGAGGAGGTTTTGGTGAAATCTATCAAGGTCAT
GACACAGTCACTCATGAAATGGTGGCTCTCAAATTGGAATCAGCCAACAC
TTCAAAGCAAGTCTTAAAGATGGAAGTTGCTGTGCTGAAGAAACTTCAAG
GGAGAGATCACGTGTGTCAGTTTGTAGCTTGTGGACGCAACGATAGATTC
AATTATGTCGTCATGTCGTTGGTCGGACAAAACCTAGCGGAATTGCGACG
TAGTCAATCTAGGGGTGCATTTTCTATTGGAACTATGCTGAGATTGGGAG
TGCAGATCTTGAATGGAATAGAGGCTATACATGACTGTGGATTCTTACAT
CGAGATGTCAAGCCTtcaaattttGCAATGGGTAATACGAAACAAACAAA
TCGGATCGTTTATATGTTGGACTTTGGTCTTGCCAGGCAATACATCAACA
ATGAAGGAAATGTCAGAGCACCTCGTGCCGTGGCCGGTTTTCGTGGAACT
GTCCGTTACGCTGCTATCACAGCTCATGAAAATAAAGAAATGGCACGTCG
TGACGATTTATGGTCTGTGTTTTACATGCTTGTTGAATTTGCTCAAGGAA
GCCTTCCCTGGAGAAAATACAAAGATAAGgaAGAGGTTGGGAAATTCAAG
AAAGCATACGAACATAAACAACTGTTGAAACACATGCCTGCAGAATTCAA
AGAGTTTCTTGATCATATCAAAGCATTGGAATACGCTGATAAGCCTGATT
ACGATTTCTTACGCCAATGTTGCGAGAATGCACTCATGAAACGTGGTATC
CGCCAAACAGATCCGTTCGATTGGGAAAAATCTACAGTAGATGGCTCCCT
TACCACAACCACATCCAGCACTTCCAAATACATCGCTACTCCACAAGCTC
TCAAACCTGACAACGCGCTCAATAATCCGTCCGACTTGCCGCGCTCGAAT
ACCGTTCTAGCTGCAGGGGAGTTTAGTTTACAGTATGATGAAGAGGACCA
GCAGCAAGGACCGATTAATGTTCAAGTGCCTGAAGGACGACAGCCcgaag
tcattaataaaaagGAAGCATCATCGACTCCGGTGAAACTACCGAAAGCT
TTCCTTCAAGCCATGAAAGAAAATATGTTAGCCGACGCTCGAACTAAAGA
TTTCAAACCGTCTGCTGCTAATCACGacaagaaaaattcaaagataCCTG
TTTTAAAGGGGAAGTTAGCTACAAAATCACAGAAACAACATGACTCAGGA
TCTACTAACCATGCTGGGAAAGTTGCAACTCAACCAACGCCCAAAACAGA
GGATTGTCCAAACTTAGAGAAACGCATTTCTCCGGagattttgattgaaa
atgtcGATCAAAATGGACCGGCTGAGGGcgtttgtaaacaaactgaagTG
GATTCGAAAAACGAAAACAACGTAGAACACAGTAATGATAGTAAAAGTAA
AGAATCGAGCAGTCGAACTAAAACTTCAAAAACCGGGAAAATTGATGAGA
ATAACACCAAAGAAACCaataagaaaatattgattCAAAAACAATTAGAG
GAAGGACCGTTCTTTGTTCCTACGAAAACAGAAGATGAGGTTTTCGACCC
TGGTAACGAAATGCTGGTTAACTTACTAGGCAATATtatggaaaataaaa
acaagaaactatCTTTAAATCAAGAAGAAATTGTAGACACTGCAGATAAT
CCAAATTGTAACGTAAATGAGGAACCTGCAAATATTTATAATGAGGAGAT
TAAAATATCAGCTGATTCTCCAAAGAGAAGCAACGACGAATCGCTACAAC
TTAAATTACCGGAAAATTTACCGAAAAATAGTCAAGTCAATATTGCCGAA
CAAAATATCCCTGTTAAGGTAACCAAGAAAAACGAAATTAATATTTATCA
TGGCGAGATAAATAAAGAACTAAACCATGTAAATGATATACCAGAGGTCA
AAGTAAGGACTTCCAATCAAATTGATGTAGCTGTTGAAAGTAAAGAAAAT
GTCCAAGATGTTCGGAAAAGGACTTCAAATCATAGTGATCACACGGTTGA
AAGCAAAATAAAGGATTCTAAGATCGAAAACGACAaggacttgaaaacaa
aagcaacTATTGAAGTCAAATCAGATGCGAAACCATCTACCAACATTCAC
AAGTCCagttctttttcgtttttgaaCGCAAATCTTCTAGCAAACATAGA
AGACCCTATAGAGCCAGAACACGTGATCGATGCTAATGAAACCAGtatta
aacttttgaaattagaACGGAACCCCTCATCAGAACATTCGAAAAATTCC
TCAGTCTCGAAAAGCAAAGAAGAAGAAATGGTTGAAAAGCATTCAggaga
atctgaagttgaagatCCATCTTTGGAGAAACCGAAGTTGCTTCCACCAA
CACCAACTCACAAACAAGACGCAAAGTCACACTACAATAATGATCAAACT
GAAACTGACAATAACGATCTACAAAAAAGTGATCgattaaagatatttca
aacACCCATAGAAATTGGGAGGAAAATTGAACCAGCCAAACATCACGAAG
AGATTGTTGACCGTGATGAACTTGAGGAGCGTGACTGTGCACTAGGCACC
ATTTACAGTGATGATAAACTAACTTCTGGTTATTCGTCACATCACGAAAA
TCACCAAGCAAAGGAAAGCTTCCATAATCATCATCAACCCATTGTTTTGG
ACGCGAAACAAGATAAAAGATACTCTACAGACAACCTACCACAACCCTCT
TTAGAGATTCGACCAGATGCTCCTGGCGGCAATGACATTGGAATCCTTAG
ATCGTCATCAAGTAGCAATCGAATAGCAGGCGGCGCCTCTTCATCTAAGA
tgaacaaaacattcgatttacAATCTAACTACATGGACTCGTGCATAGAT
ACAAAGAATCGACGTAAAGCTGAAGTTTTAGCTGAAGATTCTATGGATGA
AAATTCTGAAGGATTTCGTGGTGAACCACATGAGAATAAATACGTTGTTG
AGAAAACTGAAAATATACATTATTTGGAAGATGCTTACACCGGTGAAAAT
CCTTCGTCGGGTATAGTACAAGATTCTTTCGAAGAACTTAAAGTTGGACC
ACGGTTTACTGATAAAGAGTATTCCAACGAAAGTCTCGATAGCCCAGAAT
TCAATACGAACGAAACAAAGAAAGATAGGCGAGGCAGTAAATCCTCCTTA
GCAGAGACGTTTATCAAACGGAAAAATTCGGCcagtaatttttttaagaa
agataagaaaaagGACAACTCGCCCGATTATAAGGCGAAAAATGATAAAC
GACGTTTCGATGATATTCGCATGAACGCCGACCAATCAGATCGTTCAGAA
GAGTCGAGTAAAGCTGTGGTCCCTCAACCGCCGAGTGGTCGACGCCGTGG
TGCCAAGATCGAAGGGAGgtTTCGAAGATACAAGATGTATGCTGTCCGAA
ATCCCAAAGGAGGTGGAAACTGAATGGTGGCATCTACAGATGATACTCCT
GACCTTCTTCGTATTGGCGAATACGTTAAACAACGTTGGAAGATTGTGAA
AAAAGTAGGTGGAGGAGGTTTTGGTGAAATCTATCAAGGTCATGACACAG
TCACTCATGAAATGGTGGCTCTCAAATTGGAATCAGCCAACACTTCAAAG
CAAGTCTTAAAGATGGAAGTTGCTGTGCTGAAGAAACTTCAAGGGAGAGA
TCACGTGTGTCAGTTTGTAGCTTGTGGACGCAACGATAGATTCAATTATG
TCGTCATGTCGTTGGTCGGACAAAACCTAGCGGAATTGCGACGTAGTCAA
TCTAGGGGTGCATTTTCTATTGGAACTATGCTGAGATTGGGAGTGCAGAT
CTTGAATGGAATAGAGGCTATACATGACTGTGGATTCTTACATCGAGATG
TCAAGCCTtcaaattttGCAATGGGTAATACGAAACAAACAAATCGGATC
GTTTATATGTTGGACTTTGGTCTTGCCAGGCAATACATCAACAATGAAGG
AAATGTCAGAGCACCTCGTGCCGTGGCCGGTTTTCGTGGAACTGTCCGTT
ACGCTGCTATCACAGCTCATGAAAATAAAGAAATGGCACGTCGTGACGAT
TTATGGTCTGTGTTTTACATGCTTGTTGAATTTGCTCAAGGAAGCCTTCC
CTGGAGAAAATACAAAGATAAGgaAGAGGTTGGGAAATTCAAGAAAGCAT
ACGAACATAAACAACTGTTGAAACACATGCCTGCAGAATTCAAAGAGTTT
CTTGATCATATCAAAGCATTGGAATACGCTGATAAGCCTGATTACGATTT
CTTACGCCAATGTTGCGAGAATGCACTCATGAAACGTGGTATCCGCCAAA
CAGATCCGTTCGATTGGGAAAAATCTACAGTAGATGGCTCCCTTACCACA
ACCACATCCAGCACTTCCAAATACATCGCTACTCCACAAGCTCTCAAACC
TGACAACGCGCTCAATAATCCGTCCGACTTGCCGCGCTCGAATACCGTTC
TAGCTGCAGGGGAGTTTAGTTTACAGTATGATGAAGAGGACCAGCAGCAA
GGACCGATTAATGTTCAAGTGCCTGAAGGACGACAGCCcgaagtcattaa
taaaaagGAAGCATCATCGACTCCGGTGAAACTACCGAAAGCTTTCCTTC
AAGCCATGAAAGAAAATATGTTAGCCGACGCTCGAACTAAAGATTTCAAA
CCGTCTGCTGCTAATCACGacaagaaaaattcaaagataCCTGTTTTAAA
GGGGAAGTTAGCTACAAAATCACAGAAACAACATGACTCAGGATCTACTA
ACCATGCTGGGAAAGTTGCAACTCAACCAACGCCCAAAACAGAGGATTGT
CCAAACTTAGAGAAACGCATTTCTCCGGagattttgattgaaaatgtcGA
TCAAAATGGACCGGCTGAGGGcgtttgtaaacaaactgaagTGGATTCGA
AAAACGAAAACAACGTAGAACACAGTAATGATAGTAAAAGTAAAGAATCG
AGCAGTCGAACTAAAACTTCAAAAACCGGGAAAATTGATGAGAATAACAC
CAAAGAAACCaataagaaaatattgattCAAAAACAATTAGAGGAAGGAC
CGTTCTTTGTTCCTACGAAAACAGAAGATGAGGTTTTCGACCCTGGTAAC
GAAATGCTGGTTAACTTACTAGGCAATATtatggaaaataaaaacaagaa
actatCTTTAAATCAAGAAGAAATTGTAGACACTGCAGATAATCCAAATT
GTAACGTAAATGAGGAACCTGCAAATATTTATAATGAGGAGATTAAAATA
TCAGCTGATTCTCCAAAGAGAAGCAACGACGAATCGCTACAACTTAAATT
ACCGGAAAATTTACCGAAAAATAGTCAAGTCAATATTGCCGAACAAAATA
TCCCTGTTAAGGTAACCAAGAAAAACGAAATTAATATTTATCATGGCGAG
ATAAATAAAGAACTAAACCATGTAAATGATATACCAGAGGTCAAAGTAAG
GACTTCCAATCAAATTGATGTAGCTGTTGAAAGTAAAGAAAATGTCCAAG
ATGTTCGGAAAAGGACTTCAAATCATAGTGATCACACGGTTGAAAGCAAA
ATAAAGGATTCTAAGATCGAAAACGACAaggacttgaaaacaaaagcaac
TATTGAAGTCAAATCAGATGCGAAACCATCTACCAACATTCACAAGTCCa
gttctttttcgtttttgaaCGCAAATCTTCTAGCAAACATAGAAGACCCT
ATAGAGCCAGAACACGTGATCGATGCTAATGAAACCAGtattaaactttt
gaaattagaACGGAACCCCTCATCAGAACATTCGAAAAATTCCTCAGTCT
CGAAAAGCAAAGAAGAAGAAATGGTTGAAAAGCATTCAggagaatctgaa
gttgaagatCCATCTTTGGAGAAACCGAAGTTGCTTCCACCAACACCAAC
TCACAAACAAGACGCAAAGTCACACTACAATAATGATCAAACTGAAACTG
ACAATAACGATCTACAAAAAAGTGATCgattaaagatatttcaaacACCC
ATAGAAATTGGGAGGAAAATTGAACCAGCCAAACATCACGAAGAGATTGT
TGACCGTGATGAACTTGAGGAGCGTGACTGTGCACTAGGCACCATTTACA
GTGATGATAAACTAACTTCTGGTTATTCGTCACATCACGAAAATCACCAA
GCAAAGGAAAGCTTCCATAATCATCATCAACCCATTGTTTTGGACGCGAA
ACAAGATAAAAGATACTCTACAGACAACCTACCACAACCCTCTTTAGAGA
TTCGACCAGATGCTCCTGGCGGCAATGACATTGGAATCCTTAGATCGTCA
TCAAGTAGCAATCGAATAGCAGGCGGCGCCTCTTCATCTAAGAtgaacaa
aacattcgatttacAATCTAACTACATGGACTCGTGCATAGATACAAAGA
ATCGACGTAAAGCTGAAGTTTTAGCTGAAGATTCTATGGATGAAAATTCT
GAAGGATTTCGTGGTGAACCACATGAGAATAAATACGTTGTTGAGAAAAC
TGAAAATATACATTATTTGGAAGATGCTTACACCGGTGAAAATCCTTCGT
CGGGTATAGTACAAGATTCTTTCGAAGAACTTAAAGTTGGACCACGGTTT
ACTGATAAAGAGTATTCCAACGAAAGTCTCGATAGCCCAGAATTCAATAC
GAACGAAACAAAGAAAGATAGGCGAGGCAGTAAATCCTCCTTAGCAGAGA
CGTTTATCAAACGGAAAAATTCGGCcagtaatttttttaagaaagataag
aaaaagGACAACTCGCCCGATTATAAGGCGAAAAATGATAAACGACGTTT
CGATGATATTCGCATGAACGCCGACCAATCAGATCGTTCAGAAGAGTCGA
GTAAAGCTGTGGTCCCTCAACCGCCGAGTGGTCGACGCCGTGGTGCCAAG
ATCGAAGGGAGgtTTCGAAGATACAAGATGTATGCTGTCCGAAATCCCAA
AGGAGGTGGAAACTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000830XLOC_000830Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001590-exon-sc0000011-1491911889:633542..633720TCONS_00001590-exon-sc0000011-1491911889:633542..633720Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:633542..633720TCONS_00001590-exon-sc0000011-1510915933:633542..633720Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:633542..633720TCONS_00001590-exon-sc0000011-1575043694:633542..633720Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:634293..634320TCONS_00001590-exon-sc0000011-1491911889:634293..634320Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:634293..634320TCONS_00001590-exon-sc0000011-1510915933:634293..634320Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:634293..634320TCONS_00001590-exon-sc0000011-1575043694:634293..634320Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:634706..634825TCONS_00001590-exon-sc0000011-1491911889:634706..634825Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:634706..634825TCONS_00001590-exon-sc0000011-1510915933:634706..634825Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:634706..634825TCONS_00001590-exon-sc0000011-1575043694:634706..634825Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:635894..636108TCONS_00001590-exon-sc0000011-1491911889:635894..636108Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:635894..636108TCONS_00001590-exon-sc0000011-1510915933:635894..636108Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:635894..636108TCONS_00001590-exon-sc0000011-1575043694:635894..636108Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:636690..636794TCONS_00001590-exon-sc0000011-1491911889:636690..636794Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:636690..636794TCONS_00001590-exon-sc0000011-1510915933:636690..636794Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:636690..636794TCONS_00001590-exon-sc0000011-1575043694:636690..636794Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:637050..637115TCONS_00001590-exon-sc0000011-1491911889:637050..637115Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:637050..637115TCONS_00001590-exon-sc0000011-1510915933:637050..637115Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:637050..637115TCONS_00001590-exon-sc0000011-1575043694:637050..637115Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:637783..637875TCONS_00001590-exon-sc0000011-1491911889:637783..637875Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:637783..637875TCONS_00001590-exon-sc0000011-1510915933:637783..637875Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:637783..637875TCONS_00001590-exon-sc0000011-1575043694:637783..637875Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:638075..638200TCONS_00001590-exon-sc0000011-1491911889:638075..638200Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:638075..638200TCONS_00001590-exon-sc0000011-1510915933:638075..638200Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:638075..638200TCONS_00001590-exon-sc0000011-1575043694:638075..638200Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:638740..639048TCONS_00001590-exon-sc0000011-1491911889:638740..639048Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:638740..639048TCONS_00001590-exon-sc0000011-1510915933:638740..639048Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:638740..639048TCONS_00001590-exon-sc0000011-1575043694:638740..639048Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:640700..642401TCONS_00001590-exon-sc0000011-1491911889:640700..642401Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:640700..642401TCONS_00001590-exon-sc0000011-1510915933:640700..642401Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:640700..642401TCONS_00001590-exon-sc0000011-1575043694:640700..642401Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:642717..643368TCONS_00001590-exon-sc0000011-1491911889:642717..643368Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:642717..643368TCONS_00001590-exon-sc0000011-1510915933:642717..643368Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:642717..643368TCONS_00001590-exon-sc0000011-1575043694:642717..643368Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1491911889:644541..645024TCONS_00001590-exon-sc0000011-1491911889:644541..645024Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1510915933:644541..645024TCONS_00001590-exon-sc0000011-1510915933:644541..645024Clytia hemisphaericaexon
TCONS_00001590-exon-sc0000011-1575043694:644541..645024TCONS_00001590-exon-sc0000011-1575043694:644541..645024Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001590-proteinTCONS_00001590-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:633542..645024 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 2.14705e-07 0 1.29328 0.84015 0.539393 0.777992 0.158654 0 0.00260666 0.449181 0.537986 0.455029 0.632026 0.8619 0.0611973 0.329981 1.3476 0.949385 1.62373e-05 3.3725e-10 0.840891 0.799244 2.47397 1.98076 0.63031 0.212934 1.56841 1.22927
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
Blast
BLAST of TCONS_00001590 vs. Swiss-Prot (Human)
Match: TTBK2 (Tau-tubulin kinase 2 OS=Homo sapiens GN=TTBK2 PE=1 SV=2)

HSP 1 Score: 421.779 bits (1083), Expect = 5.905e-125
Identity = 214/335 (63.88%), Postives = 256/335 (76.42%), Query Frame = 3
Query:  135 DLLRIGEYVKQRWKIVKKVXXXXXXEIYQGHDTVTHEMVALKLESANTSKQVLKMEVAVLKKLQGRDHVCQFVACGRNDRFNYVVMSLVGQNLAELRRSQSRGAFSIGTMLRLGVQILNGIEAIHDCGFLHRDVKPSNFAMGNTKQTNRIVYMLDFGLARQYINNEGNVRAPRAVAGFRGTVRYAAITAHENKEMARRDDLWSVFYMLVEFAQGSLPWRKYKDKEEVGKFKKAYEHKQLLKHMPAEFKEFLDHIKALEYADKPDYDFLRQCCENALMKRGIRQTDPFDWEKXXXXXXXXXXXXXXXKYI---ATPQALKPDNALNNPSDLPRSNT 1130
            D+L +G  VK+RWK+++K+GGGGFGEIY   D +T E VALK+ESA   KQVLKMEVAVLKKLQG+DHVC+F+ CGRNDRFNYVVM L G+NLA+LRRSQSRG F+I T LRLG QIL  IE+IH  GFLHRD+KPSNFAMG    T R  YMLDFGLARQ+ N+ G+VR PRAVAGFRGTVRYA+I AH N+EM R DDLWS+FYMLVEF  G LPWRK KDKE+VG  K+ Y+H+ +LKH+P EF  FLDHI +L+Y  KPDY  L    +N++   G+ ++DPFDWEK+  DGSLTTTT+ST+  +    TP A+   NA   P DL R NT
Sbjct:    9 DILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKTGNDGSLTTTTTSTTPQLHTRLTPAAIGIANATPIPGDLLRENT 343          
The following BLAST results are available for this feature:
BLAST of TCONS_00001590 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TTBK25.905e-12563.88Tau-tubulin kinase 2 OS=Homo sapiens GN=TTBK2 PE=1... [more]
back to top