Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001583 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001583
Unique NameTCONS_00001583
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3325

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001583 ID=TCONS_00001583|Name=TCONS_00001583|organism=Clytia hemisphaerica|type=transcript|length=3325bp
ATAATGGCAGACGATGTATTGAACGACTTACTGAATggagaaatgaaaga
aaatgttgTTTTGTCTGCGTTATCCTCCAATACCTACATTCTAtataAAG
GCAATGATGTCTCCATATCAGAATTTATCCCTCATTTCATGGCCTTCTTA
CGTGCTCGATTACTCCAAAACACAGATCAAAGTAATAGCCACACTCCTTA
TTTCTCACCAAGACAAAAAGAAGAACAACGAAAAGCTGAGAGAAGTAAAA
TCAAGAACAAATCTAATAACAATGGTGGAAAAACAGCTCGCCTCAGTCTC
CAATATGCAAGTTCACCTCTAAAAACTGTCAACAAAAACAATGAGAATCG
AAATTTGAACAACCAATTACATTCTGGCATTTATGGGATTTCACCAATCA
AAGGCATTGAAACAAAGCGCGGGAAATCTGGCAAACATAAGAGGTTGAAT
AAGAAagatatttctgacattaaaacattttttcttagCAATTTAGTGTA
CCTATTTTTCTACGGTTATAAGTNCGGTACCTGTTGTGAAACCTACCAAG
TTTGAGTTGGATAGCATGGATGATTTTCCAATCCCCGGAGAATCACAGCA
ACAACAGTCGgtacaatcaaaacaaacaaaacaccACAGCGTATCGAAAC
CTCTAATTCCACACACTTTACTTCTCAGCAGTCCACCNTAACACCACAGC
GTATCGAAACCTCCAATTCCACACACTTTACTTCTCAGCAGTCCACCTCT
TTTAACGGTAACCAAACCTCGTTCCTCGAAGAATCGAACTTCGAAGCGCA
AAACGTGGATCCGTCGTTCGATAACATTTTCCAAGGCGATACCTCAAGAT
TTGCAACTAACTTGACAACGAAAACAACCAAGAAACTCGATTTCCCAAAC
GATTTTGATATGGACTCACTGTCATTGAGAAACAGTCGCTTAGACCGAAC
CATGACTACACCTACTAAACCATCAACGGAAATTCTAAATCTAGACAAAG
TTGCTGAGAAGAAAACGTTAGATATGTTATCGGAGATTTACACTTACATT
TGCTTATGGAATATGGTACCTAACGTTACTTTAGAACTTTATTTCCTTTT
CACCGTATTAACCGTGCGATTATCAACTTCGGCTTTGGATAAACTTTTGC
ACCCTTTCCCGAATATTGAATGTCATATTTATTTTGCAGTCACTTGCATC
AATAAGATGAAAAACCTGTTCATTATTCTGGATCGAAAGGCATTGACGCT
GTTGTTCGAGAATTCTAGATTGCAGTTTTTCACGAAAGCTGACTTCTTAG
AGTACCTTGAACAAGAAATAGCTCTAGACGACAGCTTCAATTTGACCTCG
TCTTAtctaaattcaatgaaatcaccAAATACCGGTATAGCGTTTCAAAC
GGATTCTGATAACCGGAAAAGTTTCATTTCTGATCGGCATTTCTATTCAT
TTTCGAAGAAACGAGACGCGTTTTATTCCATCGTACGACATTGGGAGGAA
AATATTGGAGATCCTGAATGGAATATGACGACATTCCTTACAAAGAAAGT
TCACGAGTTCATGAAGTCGTCCCAAGATGGATTAAATAATGATTTACAGT
TTGCTCGCCTTTTCGTCGGTCAGCTCTTAGAAATGCATAAAAACCAAGTT
GGTGATAAAACTGAGGAACCAGATACTTCAGATGGTGTTTTAAAAGAATT
AAAGAAACGAGATCCGCTACGTTTTCAGAGCTTACAGAACCGTTTAACTG
GACCCTCATCGACATGTGATCCTTGTCCTAAACTGACTTTTACCAAAGTG
GAAGaattctttaaagattttatccGGATCGCTGATAGTTACACGTTCAA
TAAATGTCTTATTCACGTGTTTGTAACCAAGTTAAAAACATTGGATTCGA
ATACGTTTGGACTTCACCAACACATTAATACTGAGTTGAATCGGTCAGAT
TTTTCTGACACTCTATGGCAAGACATTAAAACAACAATCAGTGAATTGAG
ATTGTGTGCGAAGTTTCTTGGCTATATCATATTCTCACCTTACCATGTTA
TTACGGATACAAAGGAAATGGATAGCTCTAGGGAAATGCTTTCTGAATCG
CTACATTTGATATCATTTCTAGAGAATTCAGTACAAAATCATAGACTGTT
GGTAACACTGCCTTGGGTTGTAGATCTGCTCAGTATGGCGGATAAAAACG
CATTCCTTTTGGACTCCTATAAAGAACCTTTGATGTTCCTACTGCAAATT
TATAAGCAGTTGAGCCATTGTTTGCGCTCGAATACGTCTTTCCTACTGAA
TTTCACGTTAACATTGCACATTGGCTGGTTGTTTGATCAAAACCCGTCAT
ATCAGTTCGATTTTTACGAATCAACTTTCTCGTTACAAAAACCGATTGTT
AATTATAGTAGAAATTCAACGGTAAACACGATTGGGTTGGATGATATTGT
AGTTGTTGATAAATCGTTTGTGCACATGATATGTCCTTACCTAAAGGTGA
TCAAAAAGCCGCTCAGTGATTTCAAGAAGAAAGTTCGTCTTGATAATAGC
ACAGGAACGTTTCGCAAGATCACACCAGTTCGTTCAACAGATATACTCAC
AATCAGtgctaaatcaaaactcaagAATCAATTGTTGGACGGTTTTTTGA
AGTATGCTCCTAACCACGTCAAAGACTGCATCAATTACGTCACTGACAGA
CTGTTCATCAACCTGAAGCATTTCATTTGTGAGCATATATTTGTGCAGTG
TCAGCAAAATGCActagatgaaatgaaaaatgactttGTAACGTCACTGG
ATGAAAACGGTGAAATAAACAAAGATAATCTGAAGGTTGCAAATCAGAAG
GTATATGCTGATTGTTTGGAGAATAGCTTGTTACAAGTCAGGGATAAATG
TCAAGATTATATAAAACGCTATTTATCTGACACTGCGTACACCACGATGA
AATGTTTGCTTCCACAAGACACAAGTTCAAAGATGTTGGAAGTTTCACCG
AAAGTTGTCCGTCACAATGTTTGTAATAAAATACAAGAATGGTTGTCTAT
GAACCGCGAGTTGTTCGTTGCTGGTTTGGAGTCGTTATATAATCGCCATT
TGAATCACGTGATCAAAGCAAATAAAGAAGAAAGTTTGTTAGTTTTTGAT
GATGTCATGTTGACTAGGTAACATAAATTTGGGGTTGAGGCCATGAGGCA
GTTCctttttgtcgattttttttGCCCTGTAAAGTCTTTGGGTTTAATAc
agtttgaaaatgattttatgtttctaaaaatttgaaattgacaGCTTATT
ATGAAGTCAAGAAAAGTGGAAATTT
Run BLAST on NCBI

transcript from alignment at sc0000011:320619..362673+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001583 ID=TCONS_00001583|Name=TCONS_00001583|organism=Clytia hemisphaerica|type=transcript|length=42055bp|location=Sequence derived from alignment at sc0000011:320619..362673+ (Clytia hemisphaerica)
ATAATGGCAGACGATGTATTGAACGACTTACTGAATggagaaatgaaaga aaatgttgTTTTGTCTGCGTTATCCTCCAATACCTACATTCTAGTAAGTT GATTGCATGGTTTTAGAacgaataaaaaattttccgtcTTGAAATTTAGC AACAGTTGCTTGGGCTCATTTGTTTTAGAAAGTTTTTTCGTCAGAAACTA AAGTCTAtttgctttaagtgtgcactaatgTTTGTTTCGCTCAACCAATG CTTCAAATGTAATAAattatataccgttgaaaagataattcggAGCACTA TAATTGTTTACAATTtagaagatgaagatgaaaaatacatttccatattt tttcgaaatcgaaATCATCAAGCAGTCAATGACCGAAAGTCTTTTCTCTT TAACTTAAACTTAATTGGTTccgttcaaaaaaaaaagaagtgacCTAGAT TGATTTGTTCTGATCCATACTTTCTGGTCACACTGTATAATCTCTAATGC TTCAGGTACTTCTATATTGAACAATTATAATTTAttgcatttttatttta tttttcagtataAAGGCAATGATGTCTCCATATCAGAATTTATCCCTCAT TTCATGGCCTTCTTACGTGCTCGATTACTCCAAAACACAGATCAAAGTAA TAGCCACACTCCTTATTTCTCACCAAGACAAAAAGAAGAACAACGAAAAG CTGAGAGAAGTAAAATCAAGAACAAATCTAATAACAATGGTGGAAAAACA GCTCGCCTCAGTCTCCAATATGCAAGTTCACCTCTAAAAACTGTCAACAA AAACAATGAGAATCGAAATTTGAACAACCAATTACATTCTGGCATTTATG GGATTTCACCAATCAAAGGCATTGAAACAAAGCGCGGGAAATCTGGCAAA CATAAGAGGTTGAATAAGAAagatatttctgacattaaaacattttttct tagCAATTTAGTGTACCTATTTTTCTACGGTTATAAGTNCGGTACCTGTT GTGAAACCTACCAAGTTTGAGTTGGATAGCATGGATGATTTTCCAAGTAT GCAGAACAATCGAACCCAGGCCTCTAAAAAGTAGGTATTTCATTTGCCCA ATTATGAGGGATGTGTCTATGAAGAATGTGTTGATGACACGAAATGTTTC GTCTTCagtagtttaaaaaaaaaaattgatatcttTGAGTTGTTTTTTTA CACCGatgttatataattttaaaagcTTGTGTAATTTATCTCCTATCTGA GTCAGGATTTTTAACACGTTCACTGCCAACCCTTTTTAGAAATCGATAAA TTGACCTCTCAGACTTTCAGGGGCTCTTGTGGCCTCGATTTTGCTTTAAA TGCCTTCAAATTGTATACCAATCGACGCAGAATTTTACATAGATTTAATA GTTTTAATTAGCACATTCCCTGAGAAGCCTTTTTCAGAAATCGAAATTTC GACATCTTggacttttattgaaaaattgactttcaggGGCTCTTGTGGCC TGACTTTTGCTTTAAATACCTTCAACTTGTATACCAATCGACGCAGAATT TCGCATAGATTTTAAAagtgtaataaaaaaaaaaaacagaaatttcTGTA TCAAATGTTATGTCCCTTTGAAGTACTACCGGTATTTTGTCCCCCTCTTC TACGAGTATACTAGTATAGTAGTCGGCAGCAAACGTGTTAATTACTGTTT TACTGACACGCTATGCCAAGGAACAGCGAATTTTCAAAACactgattttt tattgttttcctGATTATAGTCCCCGGAGAATCACAGCAACAACAGTCGg tacaatcaaaacaaacaaaacaccACAGCGTATCGAAACCTCTAATTCCA CACACTTTACTTCTCAGCAGTCCACCNTAACACCACAGCGTATCGAAACC TCCAATTCCACACACTTTACTTCTCAGCAGTCCACCTCTTTTAACGGTAA CCAAACCTCGTTCCTCGAAGAATCGAACTTCGAAGCGCAAAACGTGGATC CGTCGTTCGATAACATTTTCCAAGGCGATACCTCAAGATTTGCAACTAAC TTGACAACGAAAACAACCAAGAAACTCGATTTCCCAAACGATTTTGATAT GGACTCACTGTCATTGAGAAACAGTCGCTTAGACCGAACCATGACTACAC CTACTAAACCATCAACGGAAATTCTAAATCTAGACAAAGTTGCTGAGAAG AAAACGTTAGATATGTTATCGGAGATTTACACTTACATTTGCTTATGGAA TATGGTACCTAACGTTACTTTAGAACTTTATTTCCTTTTCACCGTATTAA CCGTGCGATTATCAACTTCGGCTTTGGATAAACTTTTGCACCCTTTCCCG AATATTGAATGTCATATTTATTTTGCAGTCACTTGCATCAATAAGATGAA AAACCTGTTCATTATTCTGGATCGAAAGGCATTGACGCTGTTGTTCGAGA ATTCTAGATTGCAGTTTTTCACGAAAGCTGACTTCTTAGAGTACCTTGAA CAAGAAATAGCTCTAGACGACAGCTTCAATTTGACCTCGTCTTAtctaaa ttcaatgaaatcaccAAATACCGGTATAGCGTTTCAAACGGATTCTGATA ACCGGAAAAGTTTCATTTCTGATCGGCATTTCTATTCATTTTCGAAGAAA CGAGACGCGTTTTATTCCATCGTACGACATTGGGAGGAAAATATTGGAGA TCCTGAATGGAATATGACGACATTCCTTACAAAGAAAGTTCACGAGTTCA TGAAGTCGTCCCAAGATGGATTAAATAATGATTTACAGTTTGCTCGCCTT TTCGTCGGTCAGCTCTTAGAAATGCATAAAAACCAAGTTGGTGATAAAAC TGAGGAACCAGATACTTCAGATGGTGTTTTAAAAGAATTAAAGAAACGAG ATCCGCTACGTTTTCAGAGCTTACAGAACCGTTTAACTGGACCCTCATCG ACATGTGATCCTTGTCCTAAACTGACTTTTACCAAAGTGGAAGaattctt taaagattttatccGGATCGCTGATAGTTACACGTTCAATAAATGTCTTA TTCACGTGTTTGTAACCAAGTTAAAAACATTGGATTCGAATACGTTTGGA CTTCACCAACACATTAATACTGAGTTGAATCGGTCAGATTTTTCTGACAC TCTATGGCAAGACATTAAAACAACAATCAGTGAATTGAGATTGTGTGCGA AGTTTCTTGGCTATATCATATTCTCACCTTACCATGTTATTACGGATACA AAGGAAATGGATAGCTCTAGGGAAATGCTTTCTGAATCGCTACATTTGAT ATCATTTCTAGAGAATTCAGTACAAAATCATAGACTGTTGGTAACACTGC CTTGGGTTGTAGATCTGCTCAGTATGGCGGATAAAAACGCATTCCTTTTG GACTCCTATAAAGAACCTTTGATGTTCCTACTGCAAATTTATAAGCAGTT GAGCCATTGTTTGCGCTCGAATACGTCTTTCCTACTGAATTTCACGTTAA CATTGCACATTGGCTGGTTGTTTGATCAAAACCCGTCATATCAGTTCGAT TTTTACGAATCAACTTTCTCGTTACAAAAACCGATTGTTAATTATAGTAG AAATTCAACGGTAAACACGATTGGGTTGGATGATATTGTAGTTGTTGATA AATCGTTTGTGCACATGATATGTCCTTACCTAAAGGTGATCAAAAAGCCG CTCAGTGATTTCAAGAAGAAAGTTCGTCTTGATAATAGCACAGGTAAGCT CCCGACTTCCACATTTGAGTACTAAGTTTTGTTATAGAGTGGAGCCTGTT CAACTCGAACCTCTGCAATTCGAATGCTCCATAACTCAACAAGTATTCTG GTCTATTCAGTTAACAACGCCTCATAAACCTTGCTCCTTCATTGAAAttc ccttaactcgaacaaatttgcgatccccgtgcgtgttcaagTTATAGAGA CTACGCTGTACTAAATTATGATGTCGCATGAtatatttcaatagaaacaa ataAAAGGCTTTTACTAAAAATGAACAAACTTCAGAATTGATCGATTTAA AAGTGACCttaaaaagcttttatttttacataagtgttcccgtttcatgt cagacacatatttcatatcagtctgcttattgttatattattatgctgat ataagcataaaatgtttttcttttcctctttctgaccaatcttgttcCAC ACCCGTGTCagttcaatgtgaaaaagcttgtgaatcaaaattgatgagta tgcaaacgatatcactcttattaaaaAGCAAAATCTTAAATGCTGTTCAA TACTAATCTTAATGATAATGATTTATGAGAATGTGTTTCTTTTCCAGGAA CGTTTCGCAAGATCACACCAGTTCGTTCAACAGATATACTCACAATCAGt gctaaatcaaaactcaaggtttgtcaaaaatttgtttGGATATTTTTACA TTCTTGATTTTACGTTTTCGTTTCTCATTCTATGGTTGGTTAATTTGTGG TTTCAATCAAAGTTATAATTTGCAAAATCTCAAAGTGTTTTAACTTAATT CGGGGATGTATTTTAATATAGACTTAAGCCTTAGGGTCTCAGGGTCTACG AATATAATACTGGAATACAATCGAAATATCCAATAAAACCNGTTTAATAT AGACTTAAGCCTTGGGGTCTCAGGGTCTACGAATATAATACTGGAATACA ATCGAAATATCCAATGAAACGTCACGTCTCTCTGACTTTCTTGAAAACCA TAATCAAATCTACTCTCGACAATTTGGTTCTCTACTGAGCATACACTCAT TAATATTGTCGAACGTATCCGAAACTACTTGACAATGGTGGGTTTGCCTG TGGTGTATTTGTCGATCTACAAAAGGCTTTCGACACAGTTGATCACgaaa ttttacttgaaaaactCGATCACTACGNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTACTTGAAAAACGCGA TCACTACGGAGTCAGAGGCATTGTTAATGACTGGTTCCGATCTTACCTCA CTAACCGCTCCCAGTATGTTTCTCTCTCaggctcaaattcccttttaaaa tctattaatcaTGGAGTTCCTCAGGGTTCAGTCTTGGGTCCTCTGCTGTT CTTGTTGTATATAAACGATCTTCTCCGCTGTATAAGAACCTCTGAAACAt atcattttgctgatgatactcatttactaaatttttcaaaaaccgtATGG AGTCTTTGTGGGAGGGTAAATACTGATCTCAGAGTTTTAGTCAGCTGGCT TTATAatgccaacaaaatttctttgaatgctagcaaaactgagtttgtta tttttcgttCCCCTTGGAGGCAGATGGACTTATGCTAAGAATTAAGCTTT GCGGGAAAATTCTATCACCAAGTAAGAGTGTGAAGTATTTGGGTGTTCAC CTTGACAATCATCTAAACTGGAAGGTTCATACTTCTTTCGTTGNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAACCAAGTAGCAAGGCTG GAATCGCTGTCCTCTTCCGAACTTCAGATTCTGAAACACGATAAAATACT CAGAACTCCCAACATATTTTGACCTTGATTATATGCCTTGATTTTTTATC AgaacagaacaattttataagaataacggGGATCAAATGtgtccaaaaat taagaacattgataattgttttataaataagtaaaattatggtaaaaaaa aaatgtgaatgATTTTACTCCATTACAAAATACGACTTAAGGCTCAAAAT GTTTGTAAATTAAGAACGGTCTGATAGAACAGAGCTTTGACTCCATTTCG GCAAATTTACTCTGTACACAATGTATTGCGCTCACAGCAGACTATAAAAC ATATGTGTATAGGCAACAACAGTAATAAACacgaaataatttaatttaat tgtttgtaattttctttctttggatggaaactgaaaattttacaaaaact aTTGATGACTGGATAGATGTTGTTTCCTTCCGCTCCTTTGTTGATGTTCT CAGAGCTTCAATGATCTTGAAGACGGGCTAGGTATTTTTTCCGTCTTTCG CTGCACAGGCCGTACCGGATTCAAGCTTGACCGATAGAAGGAATCTAGAT GGTGTTCCTCCTGACCTGACATCAAATTTTCTCCACAAACTCAAATCAAG TGTTCGTTCGATTCAGCTGCAAGGTGTGTTTCAACACCGGAGAGGATGTC GCTTTCGAACATAGCGCTGATGCTTTTCACTAACTCCTGACTTTGGCTCA AACGACGAAGACTAGAGAAAACACGAGATTGAAATTTTCCTTCTTGGTGC TTCTCCAAGTTTTTTAGCTTGAGAAGGATTTTTCTCTCACGTACTTGGAA GCGAGATTTGAAGTCTTCATACATTTTGATTGTGTTTTGTTGTTGGAACA CGGTCACCTTCGATTCGTTGATCAACTTGGTGGTTTTGGCTGATTTCTTT TCAGTGGTTTTGCAAGTTTTCTTGAGGTCTTGGACCTGTTGCGAGAGCTC CTTATTGATGAATGACTTTTGCGTAAGATAGTCAGCTTGTTGATCAATGC GAGATTCCAAAGATTGGATCTTGCGATCAGCTTTGTCTAATTCGTCCAAC ATTTCGGCGCTCAATGCTGTCACTTTTTTGACGCGTTCTTCTTGCTTTTG GCATTCTTGTGTCACTTCGACAATCTTTCGTTCACTTTCTACTTGCTTCT GTTCCAAGTTACTCGCTTTTTGAGTttgtttttgaagttttttttccaaa acttccgtgttgttttgactttttgcaAACTTTTGTGTCATTTCGGCAAG TTGTTTGCGCAAATATTCAATGGTTGTTTGTTGGTCTTCATTgaccaatt tcaattttttgttttgatctacTTCATGTAGATACATCAAATGATATTCC TCAGAGGAATTGATACGATAATCTGCAAAATTTCTCATTATAAATCAATA TTTCGatcaaaatattcacaaaagttGACAATAGTAACTTCTGCCGCACT tgacaaaagttttttaaaaggcGAATGGATAGCaaaatattatttgacgt cagttttatcaaaaatctatttgtgcttgcataaaacataaaaaaatcat aaatgatCTCACAAATTTGTAAAAGCGTCGCTTATGGNATATTTGGTGAC GTAACTTTTGGACGTGAACTTTGTTTTAGGCATTGAGAATACATAACAAC AAAACTCAAATTCATAGGTTGTCCTAGTTCTAGTTTTGTGCTtgcataaa acataaaaaaaatcataaatgatCTCACAAATTTGTAAAAGCGTCGCTTA TGGAATTCTTAACTCTTAAAAGCTGACCAGATTTTACACTAGCACTTGTA AAAGAACCGCCCTCTCCCACCTGGTTAAAAATTTAGCCAACTGTATAGGA ATTCACCCCCGAGATGGTCGAGTACCTACCCCCATACTGGTTAAGAATCT CCCCGACATGACAATGGACTTTCCCATACTGTTTAAGAATCCAACCGACC TGACGTGTGATTTGTGGGcaattttcgttatttttgcgtgacgaataaat tttaaaaactaatGACGCGATGCGGGGTGCTGATCGGGGGCCTCTTTTCC TGTTCAATATTTTTAACGTGAAAGCGTCCCAAACCATCTTGACGGCTCCC GTCGTGTAATAACACTTGAACTGAATTTAAAGTATTTTACTTTGACTTTT AGAGGGCTCTAAGAGCATAAATATGCTAAATAATTAatgttttttaagat ttaaaagtattgtgatttcgatttttttaaggaaattttctCGCGCATAA ACTATCGCGAATCGGCAATCGACTTGTTAAAGATTTTCACAGACATTAAC TTTCATGAAAACGAAAACACTTTCTGGTCGTCAAAGTTTGTACATCTTAA GATTTTTCACGCTTCTTTAATTCATTTTGACCAAAGAGATGTAAGCTGTG ATTCGTACTTTTTGGATGataatatttggaaaatctcaAAAGACACTGCC TTATGTAAAGCAcaaaaaactttgaacattTACATCATataagtcaaatt ttagctagAATATTCGGAGTGAAACCTCAACCTTGAATTGGCATAAAAGC CTGTAGCTTGAGACTTTGGAACCATTAGGAAAGTATTGTATACTCCCTCT AAAAACATCAGTGCCTATATATAATGCTCTTTAAAGTCAAGTTATCAGGA GCTTTAAACCTAAGCCAAGTCTACTGACGTGTGAAACACTCATCCAACAA GTGACGCTTTGTACAGTAGATCATGTGACGAAATTACTTTTCTATACCGT GAACATCACAATTTGGTTTTCACTGAAAAAATAACCTTTGAGGACAgttt gtatatattttattgCGCATTCCTTGATTTTATTACCATTCAAAGAATTA AGGCAAAGCATATCCCTCCCGGCTTCACCCGGAATGACTTGAAGCATAGT TCgtcccccctttcttaaggggggatgacaccttccgaaAAGTTTAAGAA GAGGGGGGGGGTcagaaatttttatgaaaaaggtGGGGGGTAGCAAGGAA GGGGGTAGCAAGGAAGGGGGGTAGTTTTAGAAGAGAGGGCTCacatatat attgtagattattttcaagcacaggTTATAAAGTTTGGTCTTCATGAAAT GAAGTTTTCTGTTANAAGGGGGgatagtttaagaagggggggcttacata tatattgtagattattttcaagcacaggttatgaaatttggtcttcacga aaggaagttttctgttagagtagtctgagtcaagaagaagaaacaagttt attatttcgctttctctctAAGATATTTCACCATATATTTGTTAGCtgtt tttgtccaaaatccttgggggataggcatttttaaaggttaggggggatg ccaagaaagGGGGATCAGACCCTTTTCCGCACTATGACTTGTCGATTAGT TTGCTGGGTTACacgtcattttttataagattatACTTATAGAATATTTG TGATGAAATTGGCCCaagaattaagaatatggtaagaataccaCCATAAT GGAATTTTGCAACTGAgcctaaaaatgccatttttaaagcattttaccat taaattgccaatttttccccagcaatgctaaaaggtttcaaatttttgct tgaggtatgtattacatgctACATTTTGGCTGGGTTTAGATTCAAACCTa ggaatactgtaagaatatttcaggatgattttttccaaaaagttaagaat attcatgatgaattgaaatcgatttttttcaaacaatgaCTTAATTTACT TTCTTGtatatcataaaaaatataaaaactagccTTTGTCTTTTATTCGC Tatgcaaaatctttaaaaaacaatcttttctttcatttcccaatgaaaat gaccaaaagcaATCTTGTATTTGTCAAAGGAAATAagtaatcttttgttt tatcaaGGGATATTTCTGAATGCAATCTCTGTAttctattctcaacttca gttgagctagattCTGAcaatctgtctgtctgtctatcTGTCTCTCAcaa aaaactttagggcaggctggagacttcaaacaaaaaatggtTGGATTCGC TGAAATTAGAGAAACTTGTTCCTTATGTGAATATCTTGTTCCTTATGTGA ATATCTTGttccttggattttttttcaataagtttGATGTTTGGGGGCTG AGGACGAGCTTTTCACCCAAACGAGGCTAACACGTTGaagcagcctggag acttcaaaaattgtcagaTTTGCCTGTTCCTTCGGtgcattttttcattt ttcaaaaatttgaattttcgagGCCTGGACACGAttattttggtttgttt tgctaTAATCGGgtctatgaataatttgaagccactgaagttgattCCAG TGCGTTGCGTATGTTCGACCTATATTTTCCAAGGATACAGTTCCTTGAAT TTTTCATCAATTAATTTTtacgtttaaaaaaatttcatttaagaAAACAG AtttcacaattaaaaaaaatccaaaaacaggAATTTTAGGAAATGGCTAT AGTGTTCTCAAGGATCTCTTCCCCTCAATTAAATAGTAGTAGACACGAAG ACATTTTAttcgtttttgtaattttctttctttggatggaaaactgaaaa tttctacAAAAATTATTGACGGTAAGATAGATGTTGTTTCCGCCTGCTCT TTGATGTTCTCAGAGCTTCAATGATCTTGAAGACGGGCTTGGTGTTGTTT CCGTCTTTTGCTTCACAGGTTGTACCGGATTTCAGCTTGACCGATAGCAG GGATCTAGATGGTTTTCCTCCTGACCTGACATCAAATGTGTTTTATAAAC TCAAATCAAGCGTTCGTTCGATTCAGCTGCAAGGTGTGCTTCAACGCCGG AGAGGATGTCGCTTTCGAACATAGCGCTGATGCTTTTCACTAACTCCTGA CTTTGGCTCAAACGATGAAGACTAGAGAAAACATGAGATTGAAATTTTCC TTCTTGGTGCTTCTCCAAGTTTTCTAACTTGAGAAGGATTTTTCTCTCAC GTGCTTGGAAGCGAGATTTGAAGTCTTCATACATTTTGATTGTGTTTTGT TGTTGGAACACGGTCACCTTCAATTCGGGGATCAACTTGGTGGTTTTGGC TGATTTTATTTCAGCGGCTTTGTAAGTTTTCTTGAGGTCTTGGACCTGTT GTGAGAGCTCCTTATTGATGAATGACTTTTGCGTAATNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCcggtcagctc gcaaccctagtacccccccccccggggttatTCTGGTTCTAGTTTTGTGT TTCCATAAGACCCaataaattcataaaaaaaaatctcacaGTCGTTAAAG TGTTATGAAAAATCCATGGGTCACTTGTTGAATTCTCAACCAGCTTCCAA AGTTGGTAAAGAATCAGCCAAAGTTCATTTAACTTGCCAGGTTTTACACT AGCATTTGTAAAGGAACCGCCTTCTTCCAGCTGGTTAAGAATCCGCCCCA CCTGTTAAAGAAGTTTCTCCATCCTGGTTAAGAATCCCCTGACTTAGCAA TAAAGGACTCTCCCAATAATTGTTTAAGAATCCACCTGACCTGGTAAAGG ACTTTCCCCATTCTTGTTAACAGTCCGCCCAACCTAGTATAGAACTCTCT AGTCTTTGTACTGGTGAAGTTTGTCCGACCCATTAAAGAAATATCCTCAT ACTAGTTAAGAACCCGCCCAACCTGGTAAAGAATTCTCTCTCGTAATGGT TAAAAACCTGCCCAACATGGTAAAGAACTCTCCCTCGTAATGGTTTAGAA TCTGCCCGACCCATTTAAGAACTCTCCCCCATACTGGTTAAGAATCCACC TGACCTGACGCGTCATTTTGGGGCAATTTTTCACTACTTTTGCGTGACGA AtaaattttgactattttcatGTTCGTGATGAGAGCAAAAGAAATTGCAA TAGGGCGTGATGTGGGGTGCCGCTCGGGAGCCTTGGTTGATTCGTCTTCA ATATCTATAACGTGAAAGCGTTCAAAATTAAGTAGACGGCTCCCGTTGTA TAGTAATAATAGTTTGACTAAACTTAAAGGGTTTTCATTCGGCTTTCAGA AGGCTCTAAGAGCTTTAAATATGCTAAAAGATTAGTGCGATTTCgacttt tttaatgaaatttttcgtgagcataaactttcgcgaatcggaAATCGCct tgttaaaaaatttcatagATATCAACCATAGCGAATAAGGTTTAAAATGC GCAAAAGCTTCTGGTCGTGAAAGCTTATACACCTTagattttttatgttt ctttaGTAGAGGTTGATCAGAGAGACAGTTCACTGTAAGCTTGGATCTAA AATTCACATCTTTTGATTATGTTTTGAAACACTGCCTTATGTAAAGCACA AAAAGCTTTGAACATTTACAACATATGAGTCAAATTTTAGCTAGAATATT CAGTGTGAAACCTCAACCATGAATTGGCATAAAAGCCTGTAGCTCGGGTG TTAAACATCTATTTTGGTACCATTAGAAAGATATTTTATTCTCCGTTTAA AAACATCGGTGCACATAATGCCCTTTAAAGGCAAGTTGTCAGGAGCTTCA GGCATAGGTCAACTCCATTGACGTGTGAAACATTCATCCAACAAGCGGCA CTTTATGCAGTAGATCACGTGACGAAATNTTGACGTGTGAAACATTCATC CAACAAGCGGCACTTTGTGCAGTAGATCACGTGACGAAATCACTTTTCTA TACCGTGAACATCACAATTTGGTTTTCACTGAATAATAACCTTTAAGGAC AGTTTGTATACATTTTATCGCGCATTGCTTCAGGGTAGCCAAAAATGATT TCGCTGAAATTAGCCACACCTGTTTCTTGGATGAATATCTCAGGGgacat atttttaatttttcaaatttgatttccAGGCCTGGGCACTAATCTTTTGG TTAGTTTTGCTACAATTGGatctatgaataatttgaatctATTGAAGTTG TGCCCAGTGCGTTGAGCACGTACGATCTGTCTTTCCCAAGGATACAGCTC CTTGTATTTTTCATCAATGAATTTTCACGtttaagaaaatttcatttaag aAACACAGATTTTAgacttaaaaaaaatcaaaaacaggAGCCTAAAGAGG TATAGTGTTCTCAAGGATCTCTTCCCCTCAATTAAATAGTAGTAGACACG AAGACATTTTATTCGTTTTagtaattttctttctttggaTGGAAAACTGA AAGGTTTTATTGACGGTAAGATAGATGTTGTTTCCGTCCGCTCTTTTGAT GTTCTTAGAGCTTCAATGATCTTGAAGACGGGCTAGGTGTTGTTTTCGTC TTTTGCTGCACAGGTTGTATCGGATTCAAGCTTGACCAATAGCAGGGATC TAGATGGTGTTCCTCCTGACCTGACATCAAATTTGTTTTGCAAACTCAAA TCAAGCGTTCGTTCGATTCAGCTGCAAGGTGTGCTTCAACGCCGGAGAGG ATGTTGCCCTCGAACAAAGCGCTTATGCTTTTCACTAACTCCTGACTTTG GCTCAAACGATGAAGACTAGAGAAAACACGAGATTGAAATTTTCCTTCTT GGTGCTTCTCCAAGTTTTCTAGCTTGAGAAGGATTTTTCTCTCACGTACT TGGAAGCGAGATTTGAAGTCTTCATACATTTTGATCGTGTTTTGTTGTTG GAACACGGTCACCTTCGATTCGTTGATCAACTTGGTGGTTTTGGCTGATT TTATTTCAGCGGCTTTGTAAGTTTTCTTGAGGTCTTGGACCTGTTGTGAG AGCTCCTTATTGATGAATGACTTTTGCGTAATGAAGTCAGCTTGTTGATC AATGCGAGATTCCAAAGATCGAATCTTGTGATCAGCTTTGTCTAATTCGT CCAACATTTCAGCGCTCAATGCTTTCACCTTGTTGACGCGTTCTTCTTGC TTTTGGCATTCTTGTTTCGATTCAACAATCTTTCGTTCACTTTCTACCTG CTTCTGTTCCAAGTTACTCGCTTTTTGAGTttgtttttgaagtttttctt ccAAAACTTCCATGTTGTTCTGACTTTTGGCAAACTTTTCCGTCATCTCG ACAAGTTGTTTGCGCAAGTCTTCAATGGTTGTTTGTTGGTCTTCATTgac caattttaattttttgtttcgatCTACTTCATGTAGATACATCAAACGAT ATTCCTTAGAGAAATTGATACGataatcagcaaaatttctcatttttaat cAATATTTCGACGATAATATAgataaaattcacaaaattcacCTTTTGCT GCACTAGAGACAAAAGTTTTAAAGGCGATTGAATGGTaaaatattatttg acgtcagttttatccaaaaagttttttttgacgtcattttttcaCGTGAA CTGGAATTGATGGGTtgttctagttctagttttgTGTTTCCATAAGACCC AATAAATTCATAAATAATCTCACAGTCGTTAAAGTGTTATGAAAAATCAA TGGGTCGCTTGTTGAATTCTCAACCAGCTTTCAAAGTTGGTAAAGAATCA GCCAAAGTTCATTTAACTTGCCAGGTTTTACACTAGCATTTGTAAAGGAA CCGCCCTTTTCCAGCTGGTTAAGAATCCGCCCCACCTGTTAAAGAAGTTT CTCCATCCTGGTTAAGAATCCCCTGACTTAGTAATAAAGGACTCTCCCAA TAACTGTTTAAAAATCCACCTGACCTGGTAAAGGACTTTCCCCATTCTTA TTAACATTCCGTCCAACCTAGTATAGAACTCATTATTCTTTGTACTGGTG AAGTTTGTCCGACCCAATAAAGAAATATCCTCATACTAGTTAAGAACCCG CCTAACCTGGTAAAGAATTCTCTCTCGTAATGGTTAAAAACCTGCCCAAC ATGGTAAAGAACTCTCCCTCGTAATGGTTTAGAATCTACCCGACCCGTTT AAGAACTCTCCCCCCATACTGGTTAAGATTCTACCTGACCTGAAGCGTCA TTTTGGGGCAATTTTTCACTACTTTTGCGTGACGAAtaaattttgactat tttttcaTGTTCGGGATGAGAGCAAAAGAAATTGCATAACGGCGTGATGC GGGGTGCCGCTCGGGAGCCTCAATTGATTATTCTTCAATATCTATAACGT GAAAGCGTTCTAAATTAAGTAGACGGCTCCCGTTGTATAGTAATAATAGT TTGACTAAACTTCAAGGGTTTTTCTTCGGCTTTTAGAAGGCTCTAAGAGC TTTAAATATGCTAAAAGATTAGTGCGATTTCgacttttttaatgaaattt ttcgtgagcataaactttcgcgaatcgggAATCGCcttgttaaaaaattt catagATATCAACCATAGCGAATAAGGTTTAacattcgcaaaattttctg gtcGTGAAAGCTTATACGCCTTAGATTTTTCATGTTTCTTTAGTAGAGGT TGATCAGAGAAACAGTTCACTGTAAGCTTGGATCTAAAATTCACATCTTT TGatgatgttttgaaaattttaagaaacactGCCTTatgtaaaagataaa aaaaactttgaacattTGCACCATATGAGTCAAATTTTAGCTAGAATATT CAGAGTGAAACCTCACCCTTGAATTGGCATAAAAGCCTGTAGCTCAGGTG TTAAACAACTATTTTGGTACCATTAGAAAGATATTTTATTCTTCGTCTAA AAACATCGGTGCACATAATGCCCTTTAAAGGCAAGTTGTCAGGAGCTTCA GGCATAGGTCAACTCCATTGACGTGTGAAACATTCATCCAACAAGCGGCA CTTTATGCAGTAGATCACGTGACGAAATTACTTTTCTATACCGTGAAAAT AAATCACTGTTTGGCTTTCACTGAATAATAACCTTTGAGGACAGTTTGTA TAGATTTCATCATGCATTGCTTCAGGGTAGGCAAAAATGATTTCGCTGAA ATTAGGCACACCTgtttcttgggtgaatatctcaggggacatttttttaa tttttcaaatttgatttccTGGCCTGGGCACTAatcttttggtttgtttt gctaCAATTGGgtctatgaataatttgaatctATTGAAGTTGTGCCCAGT GCGTTGAGCACGTACGATCTGTCTTTCCCAAGGATACAGCTCCTTGTATT TTTCATCGATGAATTTTTACGtttaagaaaatttcatttaagaAACACAG ATTTCacactttaaaaaaatcaaaaacaggACCCTAAAGAGCTATAGTGT TCTCAAGGATCTCATCCCCTCAATTAAATAGTAGTAGACACGAAGACATC TTAtttgtttttgtaattttcttttttgaatggaaaactaaaatatatta caaaaacTATTTACAACGGGATAGATGTTGTTCCGTCCGCTCTTTTGATG TTCTTAGAGCTCGATGATTTTGAAGACGGGCTAGGTGTTGTTTCCGTCTT TCGCTGCACAGGTTGTATCGGATTCAAGCTTGACCGATAGCAGGGATCTA GATGGTGCTCCTCCTGACCTGACATCAAATTTGTTTTGTAAACTCAAATC AAGCGTTCGTTCGATTCAGCTGCAAGGTGTGTTTCAACGCCGGAGAGGAT GTTGCTCTCGAACAAAGCGCTGATGCTTTTCACTAACTCCTGGCTTTGGC TCCAACGACGAAGACTGGAGAAAACACGAGATTGAAATTTTCCTTCTTGG TGCTTGTCCAAGTTTTCAAGCTTGAGAAGGACTTTCCTCTCACGTGCTTG GAAGCGTGATTTGAAGTCTTCATACATTTTGATTGTGTTTTGTTGTTGGA ACACGGTCACCTTCAATTCGTGGATCAACTTGGTGGATTTGGCTGATTTC TTTTCAGCGGCTTTGCAAGTTTTCTTGAGGAGTTGGACCTGTTGCGAGAG CTCCTTATTGATGAATGACTTTTTTCTAATGAAGTCAGCTTGTTGATCAA CACGAGATTCCAAAGATTGGATCTTGCGATCAGCTTTGTCTAATTCGTCC AACATCTCGGTGCTCAATgctttcacttttttgacaCGTTCTTTTTGCTT TTGGCATTCCTGTGTCGCTTCGACAATCTTTCGTTCACTTTCTGACTGCT TCTGTTCCAAGTTACTCGCTTTTTGAGTttgtttttgaagtttttcttcc AAAACTTCCGtgttgttttgactttttgcaAACTTTTCCGTCATTTCGGC AAGTTGTTTGCGCAAGTCTTCAATGGTTGTTTGTTGGTCTTCATTgacca atttcaattttttgttttgatctacTTCATGTAGATACATCAAACGATAT TCCTCAGAGGAATTGAAACGATAATCTGCAAAATTTCTCATTATTAATca atattttgatcaaaatattcacaaaaattCACAATATTCACTTCTGCCGC ACTTGACAAAAGTTTAAGGCGAATGGATAGCaaaatattatttgacgtca cttttattGGAAGTTTTTCTTGACGTCAATTTTTCCTTTGGAGAAATGat gaaattaaatcaaaatatctCCCTAAGAGATACGGAATCATATGAATACG AGATGCAGTCTCTCGAGAATGACGGAAAAGTTtgcaaaaagtcaaaacaa caCGGaagttttggaagaaaaataggcgttgtggtatagtggacatcaac cttgattcctgtacaggcgaccaaggttcgattcccactcacaacggttc acttggcaagtgaacaaaccttcgcccgggtcaacccatgccatgtgagg ggaattgggtagtcagttcaaggtgctgacaggatgcttactcaaagcat ctatagttgcgagaatgggctcccagagcctcctgtaactcaaccataat tAGCCACATTCCGTAAAAGGGCCTGGTAACTAGCTGTAGGGACTTTTTCG AAGATATGCGCCATCTTGCGAAAATTCCAAACCAAAACAAGCCAAGATTG AGAGGAAAAGTTAGAGAAGACTGAAATTTTTAGCAGATTGGAGTTGTTTT CACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNTATGTTCTGACCATTGGAGTTTGTTTCAGATCAT CTTCTAATGATTTACCAGATGTTATAGTTCCTGAATCCCAATACAAACTG ATCAAGAAAATTAAGTATCAACGAGTAAAGAAGCGTTGGGTTTTTTATCT GGAATTCTATCAGTTTCAAGAACAATGACGTGAACAATGCTATGGAGAAA TAAGCAAGCAGTACATAATCGAAACCCTAACAACAACCAGGAGGTTGACC ATCaggagatttcttttgatagttgctcacttagctttgttttggtttta gtTTTGGTCTTGGCTTTGTTGAACACTTTACTGACAGCTCGATGTTTAAT AGCAAATAGTATATACGAAGGGtacaaacacatcaaaggtCATGCTTCAA GGATGAGGTTGCAGAAGACATTATTTATGTGCTGGCTTGAAAATTAATGC CAATAATGGAATATAATGGACGTCTTTATAGAACTGAATTCTGaggttca taaaaaaattacatatacaAACAATATGAGGGTCCTCAAGATTATTGTag tcaatcagtcaatcacGGTATGAATTCTCCACCCCTAGTTTTGAATTCAG GATgtgtattatattattttcatttgcgTAGTCGTAAaactttgcataca attcaatccCACTGTGGACTGAGACAGCGAGATTGAGCCTATGGTCACAC TGATCAAATTACAACATGGGATTTACagttaaatgacattttttttatGG AACTCTTGGAATTCaagattgcaaaataaatttcaaaacagacaaaatat ttttttgtatcaacAAGAATTTCTATTTGGTGGGattgtttgtaatatat ttgtaggtatatatgtaatatctttaaaatgtaattcatggaaaatattt tatgactttaatatttaaaaaaacaaatttgaaagaagATCTTTCTCACT CTATACTGCCCTCTTTACACACTTTTCTTGTTATACAAAGTACTAATAga taaaactctcaaattttttttgctcttttgctgtttgcttttcattaaat atttatacggtttctcttttatttggtCTTGTTATTATTATACAGAGAAA ATAACGATTTTGTTTAAATTACTGTACTGAAAATTAATGGTTTTTATGAG AGAAAGCAAAGGACACACTTTTCATACTAATTCCGACTAAAATTTTAATG TAAACCTGATAAAAAGGTTTAGTTGTTGCATGGTACCCTCAAAATCCTAG ATCCGCCCCTGATTCCTCAGCTTCTTCTTTGCTAaatctgtttatttttc ttatagtaCCTTATAGTGCTCAGATTTGCTCAGATCCATAAGCCGCCTAA CTGAAAACGAAAGACATTTGGCTAaagcttcagatgcatccggctGGACT TAGagtttttttcaagttgaataGTGACCAAAGGGGGTCTCGAACCGGGA ACCTATAGTTTCCGAAACCAATGCCCTATCCACTGGGCCAAACCGGCTGC CGAAAATCCGTTATTTGGGGTTACTTATACGAAGGTCTAagtactatata tatatataagtctgactgacgagttaggctaactgttatgatcGCCATTA CTCCAAAGAAGCCACCACACGTGTGCACCGCCGGCCGGGTGAGGGGTTAG GGATGTGCACCAGGGTGGCTTCGCCACCCTGGTGCAAATCCCTAACCCTA TGCGACGCGCTACGCGCGTCGCGTAGTATACGCGCGTGCTCCGCGCGGTA TATGCACGCGTCCCGCGCGTccggatgcatctgaagcatTAGCCGAATCT aagcccactttcggcagccatctttttctaaatactttcgcaatattatc gaaatccagataatccgtttttattNAACGAAAGtgaaatctaccatttt gaaaaatttatcactACACGCCAATTCGACGGAGAGAGTTATatcggatc acccaaagttaccttcatttttttatttttcatttttttatttttttatc cacggatcgctgatagtcacctttccggGGGNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNaaactcagaaactcagacagtcagaaaagagagagac aggatcagagataagaaaataaaaaaaaaacatgagggTACTTTGGGTGA TCCGATGTAACTCCTTCCCAATTCGACCGCGTCCGCGGAATGTGGctaat agaaatagaaatagaatagAGAGATCAAATACTTCGGCTCTGTCGGAAAG TCCTGGTAGGATCTTCTAGTTTAGGCTCTTGCATcattgttcaaaaaaga tatctTATTAACTGTttagtctctataactcgaacacgcacggggaacac aaatctgttcgagttaagaaaacTTCGAgctatggagtaaggtttataag gcattgttaaatCAAGGGacaataaaacttgttcgagttaaggatacatt cgagttatagaggttcgaattattcTTCTGCTGTCGCCATCTTCTCCTCC ACTGCCACCACCGCTGCCGCCTAGAATGACCATCTATTCTATTAACAAAT TTCACTCCCTGTACAAAATTGAAGATAgtttagaaaatattaaaaagctG ACTTCATGAGTTTTAGCTGATTTGAGCGAGATAAACCGGGAAAGCCGGAG AATTATGGCTGTGAACAAACAGCTGCAATTCAGGTTATATCAACTTGAAA AAGACACAATGGACATTGAATTGATGTCTATTGTTTACaaaaagtgttta caattgggccttccaCTTTCACACctatactgaagttgagcccagtgctt taGCAAGTTACAGTGATATAAcgcataccttatcgggggaaaaaaatgtc ggagttttaattagtcggggttttttttcgtcggggaaagcctttgtcac ctagaggcattttcgtcactttccttTCCCcagaccaaaatttcaaattc gtcacttttcccctaccaaatttttttaatgtgGTTTCCAACAAAATATA gagcataagaaaaaattatcaaaattgttAGTAATGCTCATTACAACATT GAATTACTGCTACAAACTACTACCTTTTCTTGCTGCCAAAAATGCCCAGA ATTGAGGgacattttcataaaaactttgttaatatttggattttttaaaG ACTTGACCGACGACCGACATTGTGTTactattgatattttttatcagACC ATTGTAGTTTTAACTTAGCTTGTTGTGTTTATCGGGCAAAAGAACTTGTT TGAAAAagtcattttaatttttctgttaagaaacATCCCTGGAAACGTTT ACAATGGAAAACTACGATAGTAATCCTTTTTTCTGTTGAAATTCGGTGGA AAATCTTGGTCGGGGATTAAAAAACTGGTTAAAAGTTTTGGACGGAGGGG GGGGAtcaggtaaaagttttggtcggggataaaaaagtTGGGTCAAAGTT TTGGTcagttgataaaatatcgggggaAAATAATTCGTCGGGGGGAAATT TCGTCAGCCCCTCAAAAGTTTCGTCACTTTCCCGACATTtctttccccga taaggtatacacATATATACATAAGTATATATGTAATAAATACATATACG TGCCGTGGTATAATGCTCATCAACCTTGATCCCTGTACCGGAGAgcaagg ttcgattcccactcgcggTGATTCACTCGGCAAGTGAACGAACCTTCGCC ctggtcaacccatgccatgtgaggggaattgggtagacaATTCAAGTTTG CTGACAGGACCTAATAgacggggggtttggaataagcaggggggggttgg aaagaatctcaaaacttaataagcggggggggagttggaataaaaaatgt gctggctggaaaattttcgaaaatgagACTAATACAGCAGacttagggaa aaagaggtaactttcaaaaaatcaataagcgggggggggggggggNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNgggggggggggggttggaataagaattc ctgggtggaaaattaatTATCGCCCcccggctattaagtacccgagagta aaccAAATAGATGGATTCAATCTATCGATAAGTTGTTTCTAACCTCGCAA ACCTACTgggaaatttgatgaaaagaaGTAAATAGAAAGTACCTTATTTC TATAGAGTAAATATTTTCAGtgcttttattttattaattaggctttaaaa agaacaataacattataagATTTGATTCCCCTCTAAGAAAACTACAAATA TTACTTAGGTCTATGGTATTCCTTTGACGTTATGCACATAATCGGTAGAA AATTCACCggcaaaaagtaacaaaaagaTTGCTTTAGGACGAAACTTTTC atctaaaaatgttttcttcgacgaattttcatccGATCAGGTTTCAGCTA GGAAGCATAATGTACGGTATATTTATTTAGACAGGTATTTGTATGTAGCC ACTGAGTACAGTAGGTCCGTTGGTCTTGGTTCGTTGAGAATGGCGAATCC ATGTAGGTTTTGGGTTTCCTCTGTAGCCGATGATGGAATGCGAGCCACGA TAACCGGATGAATAGCTAGCTCCAATAAGCGCCAGAGCGTTTTTACAATC ATTGTTGAACTTGCTATTTGCTTCATCTTGGATGGCTCCCAACACAATTG TCCTGTAAGAAACGGGGGTATAGATACAGTGGCTGATCATTGGGGTGCTC AAAATTTATCACGGTGAGATTTTATTTCCTTATTTATAAGGATTATGGAT TAAAGAAACACTCTCTGTCataaatagatcttatcggagttttagatttt tctaaaaaaaaatagaattcactcgaggaattcctaagagatttcttttG TAATACTCCCggaacaatcccacaatgcagcgcttttttagaaaaataaa aaactccgataagatctattttgAACCCTCCTTATACCTGCTACTGAAGT AGTTATTGATTTTGACAATATCCTTTCTAAATGTATGGCCATGAAATTAT TATGAGCTTGTCAGGATGCCTCAATCACTAGATACTTGTGAGTTTAACCT TTTTTGTGTCAGAATTGTGTCAGATAATGGTGTTTTGGGAATACATTTCG AATGTGTAAATGTTATTGAGAGTAATTATTCTATTCGAAAACGAGGCCCA CAATAATTCtgagaaaatctcgaaaatAATGTATTTGTTTAAAGAAGATT CGTTGGGGGACTGGGTATGGGTATTGCCATGTTGAGCTTGGAATTATGTG TATACTATGAAGAGTATTGAGTTTTTATTCACTATTTAGATGCATTGTTA AGATATTTTTGACTTACTGTGGGTTGAGTGCTTTGATCCAGTCATACATT CTCTTACAGTTGATGGAACAGCAAAAGGTGTCAAATGAACGGCTCTCCAA TACCAATCCTTAGAAAAGAGTACGATATTTGATTATATTCTCAACCTTGA CAAAAAAacggaatcagcaccctcaaatttaGTAAAAAAACATATCTAAA AGTCAGTGACagacattttgataaaaactaaaaaggCCACGGACTAGAAT CCGAAAAGTGAAAGAGCAGAATGAGAGTTTGCTACCACCATTTTGTTTCG TACCTGATTTCGAGTTGATAGCAACGAAATTGTATCCACGTCCTCTTGGT GCGAGATTGGTGGCGAATTGGTTGTTCAAGTTGATTCTGGCAACTCCACA TGTCCCTGAAGGGATGCCAGGATCTTCACAGCCTTGTGAAAAGACNAACT CCACATGTTCCTGAAGGGATGCCAGGATCTTCACAGCCTTGTGAAAAGAC ACGATAACTGATTCCACCTGTAAACGAGATAGAGAGGTGTGGAGATGAAT ATTTCTATTTCTTCTAATGCCTTTCCTTCATTTCGTGCCTTTGATATCGC TTAATAGTTGTGCTTAACCATGATTTNGTGCCTTTCCTTCATTTCATGCC TTTGATATCGCTTAGTAGTTGTGCTTAACCATGATTTTGATCAGGTTTTG TTTTAGTCATGAGTAAAATggattttcagtcattttccgGGGTTATAAAC TATAATCACGATGTtttgaatttataaaatttaacCTTAGCTGTGACTAT GTATACTATGATATTTGATTAAGGAAAATTCACATTGGGGTAACAATCGC TCTCCACTTACCAACTGGTATTTGTACAAAGCCGCTCATCCTCAATGGCC CTTCACTAGACAGTAATTTCTGTTGACGAGCCCAGTATGGTTTAGGGAGT CCTCGATAACCAGCGATAGCAAAACTACCACGATATTGCCTTTGGAATGG TTTTTGACCACCGATCAATTCTAAAGCTTTATCACAATAGCCTGgaacga actgaactgatcctTCGTCTTGGATTGCACCCAACACAACAGTTCTAAAG AAACAAATTACATTTTCGGGTTACTGTAGGATAATTAATGGTGGTCTCCC GTTTATAAAAGCCTGGCATAGTACCTTTTTGTGTTACAATCGCTATCTAG ATATTGTGGGTATTGTCTTGTATTCACATCTAAACACTTTCAATTACAGT AGACCCCCTCTCCATAACTCTAACGTCGAGGGGTAAAATCAGAAATCGCT CGAATGGTTTCAGTTAGAAATGTATATTATTAATTTAGGTCATAAACTCA CTGTGTTGGTCGGGATCTGATCCAATTGTACATTTGACGACATGCATCTT TGTTTGCAAATGTATCAAAAGATGCCCGAGAATGGTAATTGCCTGAAAGG ATATGtaaatgaatgaatatttttaaccCCTGAGTTGCCGGTGAATAGCT ATAAAACTATAGCTCATTAGATTACGCTCGTTACTGAAATAGTTTTTCGT GTGACACGCATATAAGAAGCATACTAGCAGCCGGTTAAGTCAAATGTCAC TGTAAAGTTTTGGTTTGATAAGAACCttagtgagaaaaaaaaatgaaagt actTGATTGAACAAACCTGTTACGGAACTGAAAGCCACGAAATTATATCC ACGTCGTCTAAGAGACAACTGTCCACCATTTCTATAGATGGAAGCCAATC CACAACCTGCCACTTTACGGTCATTGCATCCTTCAGATAATATCGAGTAT GTGAACCCGACTGttgaagaaaaggaaaaattgtATTCTGTAATCGTGAC ATGATTTCATAAAAAGGAAACTATTTCGCAAATCTTAATTATTTGCCTGT Tttaaggcgtacaaacttttgcgattttcgcgaattttggcctttttcgc aaaagttaatgtctttgaaaattcttaacagggtaatttgcgaaagttta agctcgtgaaattttctttagaaaattgaaaatctataaaacttcgaaat cgtaataaacataaaaattttcagcatATTTCTAGCCTTTGACGCCTTCT GTAAAGTCAAAGAATAACCGTTTTTATCGGATtcatagtctagcaagcta gacgactaatttatacatagtagaaataaagcaaaaagtaatgaatggaa caattttagtcgtctagaaacctttgtgcacNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagcccctg tatctataaggctggaacaccggattcttccagtcgtttatacaaactaa atcccgtattattattattagtattggtattattagtattactaggcttc tgctcatcctctagcgaaaaaagtttcttctttCTAGTTTCTATATAGga gatatatctatagaggtttgcgaatcaaactatagtattacacgcattat aaacgactccagtctatcgGATTCAAGgaattttcgtttaaaaattctca tttttaaccAATGATTTGCGAAAGTCTAttctcgcgaaaaatattttttc ctgaaattcgcgaaagtaaatgtcgtgaatttcgcgatttttgaacttcg cgaaagtttctgctctcgaaagtttgtacgcttaaAGTATTACTTTTGCT TGTGATGATATGTCAGAGATGTGGGAAAATGTCAGTTGTTATCATTAACG GAGTGTGATGGCTTTACATATTTAGAACTTAATGGTTAGGCGAATGAGCA GTTGGCACCCCtaagaaatatgaaaatacGGGAGTTTTTTACCCCTAACC CCTACCCCCGCTATCATCCTATTGATCTTCGcttacacgtctttttttac aagaacatccaacaaaatttttaaagccttcggatgttcttattttcatc attttttgagcatctttgtccattttcctaagaaattgagtattttagag tcctcaaagccttaaaatattctcaacttgttcctaacattttggccatc gaatccttacgtttttatgtagtttgttcttataaaaaaatgaggaTACT CACGTGGTACATTCTGTGTGTTGACCACAACCAAACAAGccaataacaaa caaacaaacagattCATCTCTTCTTTCTGAAATGGAGAAAGTGTATTGCG ATCTTCCAGAAAATCTTTGTACAttgggtggaggatatattggatatttt gtccgaggggggggggggggggggacggaAAAATTTGCCTTCTTTTAGGG GCAAGCTTGCTCTGATTaagggtgattttgaatgtctggggggtcaactg atgcttgtccggggggagatccgggggtaaatttccattTTTCTGCTGGT TCCTCCTCCTGCAATAAAGGTGAATTGCGGAGATTGTAATGACTCCCACA TGATTCTCTTCGATTTACACAAagtttcgaattacagagagtattttaca CGACTTTTCAGCTGAGAGGACTTATTCGAAGTacataaatatttgaaaaa tagagGTTCAAATTTATAGAGAGTTTCCTGTAGCAATCGTCAGTAATGGT CATTGGAGACTTAAATGTgtcattttaagaaaaatagcTTCACTTACCTT GGATCAATGATGATGTTCGTCTGTGAagtttattgaatatttatgaTTCC ATAGTTAGTTTCTTTTCGATTTGCACCTTTTATACCCCTTTCAAAAAcgc ttttttttgaaataaccaTTTTAATGACTTCCTGGTTGCTGTGAGCACAC GTGAAACTGTTTCcatttaattaattttaataTCACGATATACTATAATT ATCCTCTTTTTCTTTGGATACTTTTCCTCGTTAAAGAAAGTGAAACCACT TTAGATTTTTGTTGCTAAATTTGCTCACTCATGTAGCTTGTTCATTTGTT TTCATTCGTTGGAATTTTAACGATCATTATAACGTGTTCTTGATTTATAC TCCTTTTTACAAGAATAAATGAATTATTGTTGATGCTCTGCTGTTCTTAT TGTTTGGTACTTTGAGCTCAAATTGTTCtcatcctgttcttatttttagg gcaaaaaattgaggtattttaggctttatacTGCTCTATTTATAATAGTT GTGACCATTAATTTGCCAGCAGAAATTCAGGTTCAGGGTTGTTCTAAAAT TGTCCTTATTATTCAGCCTTTTtttagcctcattgttcttataacattgt tctaataaaaaacaaagagtgTAACAGAATCTTCGTTCTCCAGACTTTTA TTATTAGAATCTTTTCACTATTCAGATTGTTGAACAGCCCAACAATATTT ATACCCCGGTGAGACCGTCGCCCCATTGGAAAGTttcgtccccagtggga aaaatatcctacaatttcagcccttCACTGGGAAATTGTGATTAGATTTA ATGATGGACAATTTCAAGTACTAAAATTCTTGGTATTAACTGATTGATGA TGGACAcgtttttttccttaaaatgtgcatctCCATTTGGCACACGTGGT TCATCATGGcatattttctgtcatggcgaAACAATCAAACCACATTATTA ATCCAAACTACCATAAAACATGTGTTTCGTTTATGGAACATTTCCTTCCT AATTAATTGTTACTACAATATTCTGATAATCTCTATTAAATGTTGTATTT TTTATGAAGAACGTCCTAATTTTTTacgccttaaaatgctcttaatcttC ACCATTTATTTAACcagtatttttgtgaaatttcctaaaaaatgaGTGTT TTAGAGACCGCAAAACATCGaaatgttctttatttgttCTTAATACTTCG TCAGTCGTAGAAGACTTGTGTTCTCAGATAGTTTGCTatttaaaattcaa atgaaaTGGAACGTTCTTGAGACGTTCCTGAACACTCGCGGACGATCATT TGTGTCCCATGGTCAATATTGAACTCAATAAGAACGTTGTTTTTGGAACG TTCACGAACActcttaaagatttttttataagagcatccaaaatttttga agctttcggctgttcttaactttttgggttttaagcctaaaaatgttctt aacttgttcttaacattttagccaacgaagccttattttcttatatagtt tgttcttataaaaaaacgtgtactagaCTATTGAATAAGGGGAAAGTTCG AAGAACGTTCGGTATCATTTGTTTTACAAGAACGTTCCATCTTatttctt gtttgttttttcgCTTGTGATGACACCTTTAATCAAACGAGTAAACCATT AGAAATTAACGGGTTTGTcggtaaaaaataaaagaaataaatcgcCAATA TTCAGGCATGGTAACTTTTCCAACATTTTAGTCTGTTAATAAATAGCAAC AATAGGTTACTccttaacaaaacaaaaagttaaactAGTTTATAGGTTCA TCGAGTTAAATCCCAAACTGGACTTTAAAGCTTTTCTGTTCAACTTTATT TCAGAATCAATTGTTGGACGGTTTTTTGAAGTATGCTCCTAACCACGTCA AAGACTGCATCAATTACGTCACTGACAGGTAGTTGATGTTCCTTTTCCTG AATGCAATGTTGACTAATATAATATAATGGTTAGGATTCTCAACATCAAT GGTTACAATTCTCAAACAATTTTAATTTAGCTGATGATTGTCGTCCATAC GGGCGGCATGAAAGTTCTGAACAATAAATCaaagtttctttcttttaatt tgaacaaGCTCTGATATCATCGAGCATTCTCGGCAGATAGAAGAAAATAG ACTTGAATTCTCAACATAAAAAATATCTGGCTGAgggttaaaaaatgttc ttaaaatgttcttatttttaccattttatgagtatttttgtgaagtttca aaaagccttaaaatgttctcaacttgttcttaatattttggccgtcAAAG CCTTatatcccgggggggggcactgggtttgcggactgacggtatgtgcg ggccaaaaattggcttttaaaattgcacccttacagtgcagcaaaaatca gtgaaaatcataNTTTGTTCATAGGGtgcgccaaaatcaaaattttctaa attgccTCCCAAGTTTGCCCGAATTTTGGTCGACCCACCACGCGCACCTG GTTCTAAACATGAAGAATCTCTCATGCGGACCATGGTAAATAAGGTTTGT TCAGTTCGTTACTATGGCTTATCTgcacgttcttttataagaacatccaa aaatcttTAAGCCCTTGGATGTTCTTTTTTAGTTTGAGTCTGAAAGTGGC AAGCTCGCAATGTATGGGCAAAGGAAATCGTCAGCCTTTTCAATACACGT CACGTTCTGaaagtgttcttaacatgttcctattctcacaattttttgag aatttttgtgTTTCTCTAAATTCAgatgttttacagtccgccgaGTCTTA AAATGATCTAActtcttttaatattttggccatcctgagccttatattct tttatagtttgttcttacaaaacgGTATGTATTTAAATGCCTAAATGGAA AACGATTTaggaaattttaatttaattataTTCACAATTTCAGACTGTTC ATCAACCTGAAGCATTTCATTTGTGAGCATATATTTGTGCAGTGTCAGCA AAATGCActagatgaaatgaaaaatgactttGTGTAAGTAACCTCTTTAT GTAGCGATGTTTGAAacaaactttttaaagtatgtggcccccaaaacgtc gatcaaatttaagatttctctcaaatctagaggaaaagacgttttacaga agtttttgctgcatgaaaaattttaacatctctactttatttcaattttc aatttcagcaatatttttcaatcgcttaaaaaTAGGTAGCTTTTTCTAAT GACCCCCAAAATggagatttgaaattttagcgatttctcgagatatcttt aagatatgaatacaaaattttgaccatagttttgaaatatggtttagagg gttttggacataaatttgtttgataaaatttttacagtatactcctggtt gtcaaaacgcaggtttggggcccccctCGTAGGTgtaattaaaatcaaat cattaagcccagtggtaatagggggagaaactacgaacatatttgtgttt tcctttaaatttacgacccgatggatgtaaaatttatgatttttataaaa tatttcaagattttcgatgatgcaaagtccaaactaaaaatttagaaatt ttcaaaatgacaattttgattttttaaacaacgtcttaatcaagtttttg aaaacctcttttgaaaatagttccattcatgtatggaatatgctgtgaaa attctctaaagtcacagatgtatctgcattttctgaaagacattaggtgt agaaagtttcctataccccactttcataatttattttcactatccaagga gctagagtgagttatatgcaatttttatcttaattttggtgttgaaatat gtccttcagacgcaaatatgttattttgaagctgtctcaaaccatcaaaa acatgctcatttttaagtatgaccatcattctttcaaaataaaaaaaaaa tcgtctaattctgataaatctacaggtcaaaatcctcattttaatgacga cctacgttttgggggccgtctccgttgtgggggccatatactgtactgTC TAAGAGGGAGAATAGATTTCTTCTTTGACTCTTTATCGGCTTGAATATTC AGCCATTCTAGACTTTTTTCCAATTGTTCTTACCGTTTGACATTTTTAGC CTCGTTGCTCTTATATATaatttaggcgtacaaacttttgcgaaaaCAAA GTTTCGTGAGGCCGAAAAATCGGGAATCTTTCGCGAGCATTAGTTTttgc ctttttcgcgaaaattagtgtATTCCTTCatattcgcaaaagtttattct cgcgaaaaatatttgaGAAGTAAATTATTTTACGTTCATTGTTCTTTTCA ACCATTAGAACGTCACTGGATGAAAACGGTGAAATAAACAAAGATAATCT GAAGGTATGTTGTTTTCTAACTTTCCTGGAATGATTTAAACCCAGTTTGC AATTTTTACATCTGTAGACGAAAATCTGCCCAGTTTAGATACaaatacat gattttttttttacatgatTTCCGTCTGCGCtgtgaaagatttttttatt caaatgtcCATCTACCTAAGCTTTCCATCCATACTCACAAGAGCTGTAAT AAATGGGtttaaaatgttaatttttatcatGGCAATATAATTAGATAAAG CAATTATAATGGTATGATTTTCGGTTGTTTTTTACGGTGGCCTTCATTTC GCTTGAAGTGACATCTCTATTAGTCGCTTTTCGTTGAAATAGCCTCTAGT GTTCTTACGAGGTTTGAAGACGATGATAAAACACGATTTtccatacaaaa acaacaaaatgacaATACAATTAAACAAAACCATCACACATTGAATGAAA TCTCTCTCAAAGACATCTCGAAAATGTGTGATCGGGAAACTTATGGCGAA TGTCATGGTAGTGATCATTGTACCATAAACTAAAGACATAGCATTGTTCA TTGGTCCAGGTAAATAACGTCCTCTAAAAGCTTGGATCAAACATAACAAT TGATAAACAATGAAAAGAATGAACAATAAGGTGGCGTGGTGTGAAGTATT GCAAAAGAACAATCTCTGATTCTGTTTATGGTTCAAAATATGTTCGATTC TTGGAGGTTCTTGCAGATAAAGAATCGATAAAATCACGTtcgaaaccaaa acaaaaaagaggactgtgaaaatttgaacagcCATTGTTCGTTTGACTTC GTTTGAATTCAGTCTGACGGTTGATAGGAATGCGTTCAATATTTTCTGTG ATTTCGTGAAAACGAGGCCAACATTCAAAGAATAGAGAATTGTCAAAACA AGGTTTCTTTGGATGCATATTTCACTGGTTTTGGAAGGGATGAGAGATAA TGCACAAGTTGAGCATAATGCTACAATGATTATGATCAGATGAAAGAAGG ATATGTTAGTATCGGCTACTTTGACTGTCggtgtttctttgtatttaatG AAGATCGCCAGAATTATGATTGCCAGGACCAATCCAAAAACTGTTAAAGT GAATATGGTATATTTTTCAGTCCCAGTGAAAACGAAATATTGATTTGTAT AAGGATCAACACATTTCAATCGTTGGCCATCATCAACATTACGAGCACCT GTACAAGGTATACAACCAGGACTTGATTCAGGATTTGGATTGACGTGGTT TGGTGGACACAATTGACATTTCCAACCATGCTGCTCAATGAACAGATCAC TGCTTTCGTTAAGTAAGCCATATATTTTCTCATAGCCTGGTCGGCAAGTC ACTTTCAAACATTCTAGACttgaagttttgtttttgagaaAAGAGTGGAA CAAATCTGACAGTCTGTTCTCGATAGAATGGGTCTCGTTTACCACTATTG TACGGTTGTTTATGATGTACAAAGAACTTCGTTTCTCAGTTTTACGGTGA AACCCCATTAGAATTTTATTCGAAATTGGATTTAGGAATGTTTTGGGGCT CTTTAAAAGTGAATATATTATTTTATCGAGATTGTTTTCAATGGTAAAAG TTTCCGAGAATTGTGTCCTTAAAAACAGCAAAGTGTACAGGAGGAAACTG ACACGGTATTGCATTTCTTCATGCTCTGACATGTGTAACTGATTATCGCT GACTGTTCTATAAGTAGATTGTAGTCTTGGTCTCAAGTTACTGTTGATGG TTATCCAGCTGGTATGAGAAATATTCAATCGACTCCCAAGATCATGCATG ATGAGGTTCTTCTGTTGGTGCTGGAGTCGTGTTAATATGAAGAGTATTAT ATTTCTTATGACAATGTCGGAACTAAAAACGACAAGAGCTGTTTGATTGG ATACTATCCGTTTCAAAAAGGGAACGACTTTTCGGACCACGTGTCTGATT ACCCCTCTCTTAACTGTGATATTAACGATTTTCTTGCGCAGACAAAATTT CTTGGTACTTTTCAATAGTTCATAACTGTTATCGAAATACTGTCTCATGG GAAACCTTCGATTAGGTCTTTCAATCAatagaaatgtcaaatttctcCAT TGTAACGTCTCGATCAACTCGGAGAGATATTTCGAATAATCCTGGGAAGA TTCAATCATGTAGTTTTCATCACAGCTCACAGGAGCACATAATTTCACAA ATTTGCTCAAACTGGTCATTTCTTGAATCGTTTTGGACATTTCCTTTGAT ACATAAGCatgcaaaagaaaaatattctgCTTCAATAAATTTGTATGTTT GCTTCTTCGGAAGAATGTTTCATTCAGGAGGATGTTTGTAAGAACGTTGA CCAATCGTNGTGAGTTTGTATATTCGCTTCGTCGGAAGAATGTTTCATTC AAGAGGATGTTTGTAAGAACGGTGACCAATCGTTCTGTGCTGTTGCAAAC GTCAAAGCTGATAAACTCGATATTGAGATATGGTTCTCGTTTGAAATCAT CCCTTATGTTTTGATATAATAATGGTGGTAGATCAGTAACTGCTGTCTTA TACTGCGACGCCTTAATATTGAAGTCAGATTGGTTTCTTTCATTTTCGCA AATAGAAAATATTCCGACTGAATTCAAAGTTTTTTCTTCTGCATCTTTGA GATAAATCAACAGCAGTAATATGAATGTCTTGTTCAGAAccataatgttt tgtttttgcacTGAAGTTTAATTGTTCTTGTTTTCTACAAAGTATTAAAG TATCTTTGGTGATAaacaaggaaaaaaataagTGAATCACTTGACGTCAG AAAAGACACTATACTTTAAACCTAATATTACAATATTATACTCCGACCAC TCTAAGACGTCAAATCCTAACTCATTTCCCCTGACCGATACCGCTGACTC TCGGATCACGTCTACGATATAACTTGGACTAGTATTTTATCCTTGTGTAT TGAAATAGAAATATCTTCtctgttttcaattaaaatttgTATTTGGATGT TTCTCAGTAAAGTgggtaaaaaattaattattttcacACTGAGGAAAGAA ATGGGAACCTTTGATTAATTAGATCGAACGCTATGTTTGTTTTCTCTTCt ggaaagtgaataaaaaagagaaaacgaaagttttGTGATTGTCGGGGTGT TTCTGAGATTGGACCTCCACTCTCCACTTATAGCACCAAATATATAAATT TACTTCCGACAAGTTAAAAGCTCTGAAGGTTGAAAGGATTTTCAGcctct ggaaggtttagattacagAATTTTGGCTGACCGCGCCAAGGATTTTGCAG CTGGAGGTCTAAACTCCAGCCCACACTTTGGGGAAGTGGGTACAAAGAGG GTGATAATCGCTTCTCTCCCATTTGGGGAAACTTTCCTCGAGATAAATTT GAACCATTGCCGGTCTTGTTATCATaactatttcaaaaaatattgagcCA TTCATTCTATGTTCATACAGGGAcgtttccagggggtaattcgAGCATAA ATTCCATGGGTCTAAAAgagtgtttttccatttttcaagaGGGTCGTCCA CCGTCACTTAAAGGTATTGAAAGAGAAGTTTtccaaaggttttttttttg caaattttgccgtTTTCTACTGAGTATCCACACATCTTTTTCTGATCCAc agttttttccgattttttctaATTTGCCTTGCTCCTTCAACAACTTTTCA ACTGACGATTTAGCTTCAGGAAATGACATTCCAGTAAGATATGTATTCAG TTTTCCACATCGCTTTTCGAATGTTGTGATTCGATTAAACAGGGACTGTC TAACATTGTCCAACGTtatgtttttggacctacctccgggtaccccggtg gaggtcctatgaattaaccgtcgttcgttcgttcgttcgttcgttcgttc gttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgt tcgctcgttcattcgttcgttcgttcgttcgtccgttcgttcgttcgttc gttcgctcgttcattcgttcgttcgttcgttcgttcgttcgttcgttcgt tcgttcgttcgttcgttcgtctgttaccagcttttctcgagattggctca ttagctttttctgatttttggcacaaagatgcaaaatagcAATGGCCAat atgtgacggagcccgattttcgaaaaaaaaatatatccggaaatatgccg gaaaaaccggtttttgacattttctcgaattttcatccttagttttttct gattgatgcgtattcgcaatgctcaaaacatggccgagttcgatttttaa gaaaaattttttccggttgaaaatgccggaaatcgccgtttttgcagatt ttcattggattttttccttatatttctatgtttttcacacaaaaacatta ttgataacaatgctcaccatcaagcatgattcaatagcgcttcgtcgtgc aaacgtcatgattattacttctctcatttgaccgaaattcaatctcACAA TCCATTtcgtcttaattcaaaagtcgtgaaagttattactttttctttgt aattgagtgtaatttgcgtgcaagcgtaataaacgcaaagggtgattgga ttgaatttcagtcaaacatgaaaatcaatgtctatttttagattcgcgac ggtatgctattgtcaataaaactgatttttgcgaccagaactttctattt ataacaatgcaacaaaatggcgaaaacttctgaaaatcttaacatggaaa tttcatcaaaatatggatCCTGCACCCCAAATGAATGctttataaatgaa ataatacgGGATAACGATGTCTTGCAGTGTAGGAAGTGTCAAAGATTTGT TCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNAACTGGATATATAAGGTTAGAGGAAGT CCTCGGACAAAACTCTACTTTAAGAAGATCTGTAACAAACCcgttactga aaatgaaatattgtaaagacGACTAGTTAAGAGGCTCACCGTGCGCCTAc aactgtaaaattgtaaaatgttaagcatgattatttcatagaggtcgata gacctgagaaatatattactgtaaattaatatacaaaaggaaaaaaaaca aatgagaAGATCGTGCACTTATTTATTCCCACATTTCAAGCAACTTTCAA GCAACAATGTGAAAACACCCTCACTGTcctttctcaaatcaaaaagaGTC TTATCATCTACGTTCAAGCGCATTAATCACAACTCCNgttgtgtattttc gctaaacgctatattatctgactgattttttcatttttctcctcgcattg ctatctaactttcatcatcaggtaggtccattcagcatctagcttgttat gTTATTTTATCAGGTTGCAAATCAGAAGGTATATGCTGATTGTTTGGAGA ATAGCTTGTTACAAGTCAGGGATAAATGTCAAGATTATATAAAACGGTAA GACCTTTTACAGAAAGTTCACTGTTGGATTTTTCCAggcggaagacattg caatgttttattttggaaattcGAATATTTAGAAGCGGTGATTCGAATGT TCGAATTTTCGAATgctttgctaaaatcaaaaacaaaaatattattatta ttatttgaaaAGTGAGCATTTGAAATTTGGCAAGTTGGATAAGTAATTCT TATTCATCGAACCTTTCTTGATTATAACTGAAAGATGTTGATTATCGAAT TCACTTTTATTGGAATGTACTTCATCTTAATGGTTTGCACAGGTATCAAG GTGCGTATTTTCTGTTTGCCTCGGAATCATTTGGACTTTAATTAAATCCC CGCATTCCTTATTCCACATATTACTTTGCTTCTTTCAGCTATTTATCTGA CACTGCGTACACCACGATGAAATGTTTGCTTCCACAAGACACAAGTTCAA AGGTTTGTGAAATATTTCTTCCCAGTCATATTGCCTGTGGCTATTTCCCA ATACCTACTATTTACGTCTGCTACCTACGAAATACATTGTGTTGGCTTCG catttaaaataatattttttcagcAACAATAGATCTTTCTCAATAATAAC TTTTCAAACTATCACGACTGTTGTTGGTTTTGAACTGACTTTCTTACTGG GGCCCTGATTTGATGTTTGACTGAAATGTTGTTGGTTTTGGACCTAGACA GAAGACAAAATTTTACATGAGTAtcgaaaaatcttcaaatattttcgaaa tattttcccTCTAAGATAGGTCTAAGAATCGAAGTTTGTTCAGACTCACT TGGACTTTAGTTTTCACATAACCAAAACGGGATGAGcttgagtttttaca agatacttaactaattggtcatttaaagtgatagagatgacgcgttcttt agaaaaagtaatgagattcttttattacatcttaacgaccaaccaaatca aataagaGCTTGTAAAAACTCCAGCTTGTCCCAACCAAAACAGGGAAATC GAACAGCTTCTATCGTTTATATACTTTCTTTATTTCCAGATGTTGGAAGT TTCACCGAAAGTTGTCCGTCACAATGTTTGTAATAAAATACAAGAATGGT TGTCTATGAACCGTGAGTCTAAAAAACCCTTTTCATTTAATGTATGTGGT GTACATAGGTCTCCCTATTTTTACACATACCAAACACCTTTTTTGATTTC TCAGATATCCAGTCAAGGGAAAAAGATCAGGAATATTTATACAATGAATC AACACaacctttttcaattttcgtccACATTTTAGGCGAGTTGTTCGTTG CTGGTTTGGAGTCGTTATATAATCGCCATTTGAATCACGTGATCAAAGCA AATAAAGAAGAAAGTTTGTTAGTTTTTGATGATGTCATGTTGACTAGGTA ACATAAATTTGGGGTTGAGGCCATGAGGCAGTTCctttttgtcgattttt tttGCCCTGTAAAGTCTTTGGGTTTAATAcagtttgaaaatgattttatg tttctaaaaatttgaaattgacaGCTTATTATGAAGTCAAGAAAAGTGGA AATTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000826XLOC_000826Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001583-exon-sc0000011-1491911889:320619..320711TCONS_00001583-exon-sc0000011-1491911889:320619..320711Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:320619..320711TCONS_00001583-exon-sc0000011-1510915933:320619..320711Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:320619..320711TCONS_00001583-exon-sc0000011-1575043694:320619..320711Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:321177..321664TCONS_00001583-exon-sc0000011-1491911889:321177..321664Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:321177..321664TCONS_00001583-exon-sc0000011-1510915933:321177..321664Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:321177..321664TCONS_00001583-exon-sc0000011-1575043694:321177..321664Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:322389..324361TCONS_00001583-exon-sc0000011-1491911889:322389..324361Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:322389..324361TCONS_00001583-exon-sc0000011-1510915933:322389..324361Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:322389..324361TCONS_00001583-exon-sc0000011-1575043694:322389..324361Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:324966..325036TCONS_00001583-exon-sc0000011-1491911889:324966..325036Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:324966..325036TCONS_00001583-exon-sc0000011-1510915933:324966..325036Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:324966..325036TCONS_00001583-exon-sc0000011-1575043694:324966..325036Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:352473..352546TCONS_00001583-exon-sc0000011-1491911889:352473..352546Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:352473..352546TCONS_00001583-exon-sc0000011-1510915933:352473..352546Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:352473..352546TCONS_00001583-exon-sc0000011-1575043694:352473..352546Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:353562..353651TCONS_00001583-exon-sc0000011-1491911889:353562..353651Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:353562..353651TCONS_00001583-exon-sc0000011-1510915933:353562..353651Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:353562..353651TCONS_00001583-exon-sc0000011-1575043694:353562..353651Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:354977..355022TCONS_00001583-exon-sc0000011-1491911889:354977..355022Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:354977..355022TCONS_00001583-exon-sc0000011-1510915933:354977..355022Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:354977..355022TCONS_00001583-exon-sc0000011-1575043694:354977..355022Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:361032..361114TCONS_00001583-exon-sc0000011-1491911889:361032..361114Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:361032..361114TCONS_00001583-exon-sc0000011-1510915933:361032..361114Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:361032..361114TCONS_00001583-exon-sc0000011-1575043694:361032..361114Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:361507..361570TCONS_00001583-exon-sc0000011-1491911889:361507..361570Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:361507..361570TCONS_00001583-exon-sc0000011-1510915933:361507..361570Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:361507..361570TCONS_00001583-exon-sc0000011-1575043694:361507..361570Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:362158..362230TCONS_00001583-exon-sc0000011-1491911889:362158..362230Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:362158..362230TCONS_00001583-exon-sc0000011-1510915933:362158..362230Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:362158..362230TCONS_00001583-exon-sc0000011-1575043694:362158..362230Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1491911889:362404..362673TCONS_00001583-exon-sc0000011-1491911889:362404..362673Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1510915933:362404..362673TCONS_00001583-exon-sc0000011-1510915933:362404..362673Clytia hemisphaericaexon
TCONS_00001583-exon-sc0000011-1575043694:362404..362673TCONS_00001583-exon-sc0000011-1575043694:362404..362673Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:320619..362673 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.58577 3.22673 2.22455 1.51677 0 0 0.2827 0 0.845135 1.12432 0.261245 0.128589 0.265149 0.0997115 0.576546 0.519286 0.567528 1.16073 0.463481 0.461621 1.0202 1.16985 2.33387 1.93806 0 0 0.244422 0.47339 1.20891 1.77157
Blast
BLAST of TCONS_00001583 vs. Swiss-Prot (Human)
Match: CDAN1 (Codanin-1 OS=Homo sapiens GN=CDAN1 PE=1 SV=4)

HSP 1 Score: 249.595 bits (636), Expect = 6.449e-68
Identity = 200/736 (27.17%), Postives = 333/736 (45.24%), Query Frame = 1
Query:  979 EILNLDKVAEKKTLDMLSEIYTYICLWNMVPNVTLELYFLFTVLTVR-----------LSTSALDKLLHP-FPNIECHIYFAVTCINKMKNLFIILDRKALTLLFENSRLQFFTKADFLEYLEQEIALDDSFNLTSSYLNSMKSPNT-GIAFQTDSDNRKSFISDRHFYSFSKKRDAFYSIVRHWEENIGDPEWNMTTFLTKKVHEFMKSSQDGLNNDLQFARLFVGQLLEMHKNQVGDKT----EEPDTSDGVLKELKKRDPLRFQSLQNRLTGPSSTCDPCPKLTFTKVEEFFKDFIRIADSYTFNKCLIHVFVTKLKTLDSNTFGLHQHINTELNRSDF-SDTLWQDIKTTIS----ELRLCAKFLGYIIFSPYHVI--TDTKEMDSS----REMLSESLHLISFLENSVQNHRLLVTLPWVVDLLSMADKNAFLLDSYKEPLMFLLQIYKQL--------SHCLRXXXXXXXXXXXXXHIG------WLFDQNPSYQFDFYESTFSLQKPIVNYSRNSTVNTIGLDDIVVVDKSFVHMICPYLKVIKKPLSDFKKKVRLDNSTGTFRKITPVRSTDILTISAKS--KLKNQLLDGFLKYAPNHVKDCINYVTDRLFINLKHFICEHIFVQCQQNALDEMKNDFVTSLDENGEINKDNLKVANQKVYADCLENSLLQVRDKCQDYIKRYLSDTAYTTMKCLLPQDTSSKMLEVSPKVVRHNVCNKIQEWLSMN 3054
            E  +  +V+ ++ L++++ +Y+     N+VPN+ LEL+F+F +LT R           LS + LD L  P F +I   ++FAV  +     +   LD+  L LL EN RL  F+ A        +  L  ++  + + ++ +  P+T  ++FQ ++DNR +F SDR F++F K+RD FY ++R WE++  +P W+    L  ++   M       ++   F RLF  QLL+M ++  G       E PD    VL  L      R   LQ RL  P S+  PCP  TF   + FF+DFI  A S+ FN+ L+     K++ L  N   L QH   E N  D  SD  WQ  +   +     LRL AKFLG++ F PY       T E+  S    R  +   L + + L+  +Q  R ++T+PW+V+ LS AD    LL+ Y++    LL++++ L          C  +    L        I       +  ++ PSY F+                 ++     GLD+  VVD+  ++  CPY+  ++K L+ +       +     RKITP  +T +    +++   L+ QL   F    P  ++  + +V +R+  N    I   +     + A   ++   VT  +E G+  +    + +Q         +L   R+ CQ          +   ++ LLP++T + +L  +  +       K   WLS N
Sbjct:  289 EPADPARVSSRQRLELVALVYSSCIAENLVPNLFLELFFVFQLLTARRMVTAKDSDPELSPAVLDSLESPLFQSIHDCVFFAVQVLECHFQVLSNLDKGTLKLLAENERLLCFSPA-------LQGRLRAAYEGSVAKVSLVMPPSTQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPGWDFEKGLGSRIRAMMGQLSAACSHS-HFVRLFQKQLLQMCQSPGGAGGTVLGEAPD----VLSMLGADKLGRLWRLQERLMAPQSSGGPCPPPTFPGCQGFFRDFILSASSFQFNQHLMDSLSLKIQEL--NGLALPQH---EPNDEDGESDVDWQGERKQFAVVLLSLRLLAKFLGFVAFLPYRGPEPPPTGELQDSILALRSQVPPVLDVRTLLQRGLQARRAVLTVPWLVEFLSFADHVVPLLEYYRDIFTLLLRLHRSLVLSQESEGKMCFLNKLLLLAVLGWLFQIPTVPEDLFFLEEGPSYAFEV----------------DTVAPEHGLDNAPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGG-FMRKITPTTTTSLGAQPSQTSQGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQEQLVTQGEEGGDPAQLLEILCSQLCPHGA--QALALGREFCQR--------KSPGAVRALLPEETPAAVLSSAENIAVGLATEKACAWLSAN 980          
The following BLAST results are available for this feature:
BLAST of TCONS_00001583 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CDAN16.449e-6827.17Codanin-1 OS=Homo sapiens GN=CDAN1 PE=1 SV=4[more]
back to top