Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001571 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001571
Unique NameTCONS_00001571
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2555

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001571 ID=TCONS_00001571|Name=TCONS_00001571|organism=Clytia hemisphaerica|type=transcript|length=2555bp
GATGATGATCCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGA
TGGAAAATCACATACTCTGAATCATACATTTTTTGACGGCGCTGAAGTAT
TTGATACATCACCATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCC
TACTGCCCGAACCAGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGG
tgtttcagaaaatgcaaataagAGGATGAGATTGTTGATGAAGATTCTTG
CTGTCTCAGATGTTGTGATTTATCGTACAAGAGCAGAACGCCTACATTCT
GATATGTTTACTTTCTTGGGTGATGCTTCAGAAGCCTACatcaaatattt
cacaaaagaTCTTCAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTC
CCTTGTGTAGCTTAGGTCCCTCTATTGTTATCTTTCAAGAGACACATTAC
ACTACACCACTTGGTTTTGAAAATGATCCATCAGAACATGATAACAGTCC
AGAAGAGATTTTGAGatccaattttttcaacattggACGCAATCCAGCTG
CATTTAGTTCCATCAATTATGTTGGTACAAGAACGACTACCCAATCCACT
GATTTCTCTATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACAAGAC
CGTTCGTTCTGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATgTTTT
TGAATGACAAATTCGGTGATGATATCAATGACATCCTACCAAACAGTTTC
CCTGATGAATATTTTACATGTGTTTCAAAATGTTTATCATGCAGTGCTCG
ATGTGGAAAAAACATGAATCAtgagaaagaagagaaagaacatCGCTCAG
AACAAAAGTGTACATATCAAGCACAATTTGACAACAAAGTATATACGTGC
AAGGCATGCCATGAGAAAGGCGTTGAATCACTTGTGATACCCAAAACTGC
TGAAACTCAAGATTCTCCCTTGGTTGGTCTTGCAAAATATGCTTGGTCAG
GATATGTTCTTGAATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAA
TTTTGGTATGGCAATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAA
ACATGTCTGGCCAGGGACACGACTTCCAAACACTAGTCAAAATTCAGCAC
GACGCATTTTGGATGGTATGATGAACTTGGCAGATGCAATCACCAATGTT
AGTGCAAAACCTACTAAAGCTGTCACCAGTTGGGTTACTGATAAAGTTGC
TCCAACCTACTGGACACCTAACTATCTCATTATTGACTGTGCAAAATGTG
GCCATGATTTTGAAGAGACAGAGAAGAAACATCATTGTCGAGCCTGTGGT
CGAGGTTATTGTGACTCGTGTACACAACATAGGATTCCTGTACCGGACAG
AGGCTGGGGAGACACGCCCGTTCGTGTTTGTGATGATTGCTTCACTAAAT
CCGGACAAGTCGATCAATCGAGTGTGCAGAAGAATTCGATCGATATCAGT
GAGTTGTTGGAAGCGATTGATGATGACCCTGAAATCGATACAGGTGAAAT
GGTAGCCATCAAAACCGCCAAAAACATACCCACCCGCCACCCGCCTGAAG
TTCTCACAACACGGAAAGTAACCGAGCAAGTCCAGTCCACACTTTCATTC
CTATCAAGCTCTTTAGAATATCCCTTGGAGTATTTAGTGGATTCGGCCAG
ACCTGATTATTGGGTTCCAGATTCCAAGATTTTGAATTGCCACTCATGCG
AAATGGAATTCTCAAAAAAAGATTCTAAGCATCATTGTCGCAAGTGTGGA
AAGGGCTTTTGTGATCCATGCTCAAAGTCTAGAGTGCCGGTACCGAGTCG
TGGTTGGGATTATCCAGTTCGTGTTTGTAACGGATGTTCGTTGAAGAAAG
GTCCTTTGTAATGATTGAGGGTATGATGTCATCATTTATAATGATCTGTT
GATGGTTGGCTTTATTTGGCTttattatgttttgatttaactttctGCTT
AAAAAAAGATATCTACAACCTATGCTGTTGTTTTCCATATAACTTTATCG
TGATGCTCTTGAATGTAAAGTATCCACACATACTTGAagcttttttgaat
ttattcaaAGCTGTGTGAAGAGCATCTCGCTACTTTTCTTCATGTCTTTT
TTGTATCTCTAAACTTGTAACTAGAACTGTATGAATTGTCATCCCAAAGT
TGTTCGTTGTCCCCTAGGACCAGTTATGAATCCTAGTGGGACACTTCTTT
GGAAATGATGAAGTAGACTTAGCTTTTATATCCTAAATCATAATCATAAT
TTTTATCGCTGTACTGTActttactttcgtttttaacccTAGTTTCTAAG
GGTGCTTGTTCCTTATGTTGAGTTAAGTAGTTAGAGAATtgtgttgtttt
ttaattttttacatCACTTTGTGGCTACTGAAAGGTCCCGTCGAGTTTCT
TCAAGTTTTAACCAAATGGGGCCAGATCAAGGATCACAGacgggtcaaat
taaattctcttTACCTTATAATTACGAAGCGTTTCAGTTTCATTTTTGAG
ATGAC
Run BLAST on NCBI

transcript from alignment at sc0000011:147489..153715+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001571 ID=TCONS_00001571|Name=TCONS_00001571|organism=Clytia hemisphaerica|type=transcript|length=6227bp|location=Sequence derived from alignment at sc0000011:147489..153715+ (Clytia hemisphaerica)
GATGATGATCCTCGAGTGAAAGTTGTTTCAATCTTTGGAAACACAGGAGA TGGAAAATCACATACTCTGAATCATACATTTTTTGACGGCGCTGAAGTAT TTGATACATCACCATCCCAAAAATCATGTACCGTTGGTGTATGGGTTTCC TACTGCCCGAACCAGAAAGCCATCATCGTGGATACAGAAGGTCTGCTTGG tgtttcagaaaatgcaaataagAGGATGAGATTGTTGATGAAGATTCTTG CTGTCTCAGATGTTGTGATTTATCGTACAAGAGCAGAACGCCTACATTCT GATATGTTTACTTTCTTGGGTGATGCTTCAGAAGCCTACatcaaatattt cacaaaagaTCTTCAATCAGTTCAACAAAGAGGCCATATGGAGAATGTTC CCTTGTGTAGCTTAGGTCCCTCTATTGTTATCTTTCAAGAGACACATTAC ACTACACCACTTGGTTTTGAAAATGATCCATCAGAACAGTAAGTAAATTA TGACAGAAGGTCAATTTGTACTCTCTGGAAAGACTTCTTGAATTAATTCT ctccaaaaacttttaaaacttggCACNCTCTGGAAAGACTTCTTGAATTA TTTCTctccaaaaacttttaaaacttggCACTCttttttgtaaacgaaaa agaGGGGTTGATAACAAAGCTACACAGCTTTTCACCTTGAGTTTACACAA AAGTAACATAGATTTCTCTGAATAATCTTTTTGGTATATTCGTTCAATTG AGCACCAATTGATGCTGAATAATCCAAATACATCGATTTGACAATCTTAG AATacttcaaatttgtttttattttcactttacAGTGATAACAGTCCAGA AGAGATTTTGAGatccaattttttcaacattggACGCAATCCAGCTGCAT TTAGTTCCATCAATTATGTTGGTACAAGAACGACTACCCAATCCACTGAT TTCTCTATCCTCTTGAATGAAGTGAAGAAAAACCTCAAGAACAAGACCGT TCGTTCTGCAAGACCTGTTTCTGTCATTTTCAATGCTTTGATggtaaatt tgattttaaagattatgttcttttttatatgatataaaagttgttctttc ttttgtttaaaaatgctgtctAAGCAATTGTTAGGAGAtacattaaatta aattttaaaataattaaaaaaataactaTTAAGAACGTTCTTAAACCTTT GGAAATTGTTATTCTTCTACAATTCTTTCTTCTTTAGTTCTATTGCCAAT AAGCTGAGTGTTTGTATTTAAGCGCACTCCTTTGAGTCTGAGATTTATAT CAGTGGATCGGGCGTGCACTGACGATAACCACTCTTTACCTTTATTGTAG TTTTTGAATGACAAATTCGGTGATGATATCAATGACATCCTACCAAACAG TTTCCCTGATGAATATTTTACATGTGTTTCAAAATGTTTATCATGCAGGT ATGTTTAATGTTCTTGGAATATCTATTCAATTTATAGAGGATTTTAATCA GTGTTAATCCTTGTTATTCTGTTGTAATGGAATCCTTAAAAGAATTTGGA AGTAGAACTGCGCAAAATCTAGCAGAACTTGTTTATAGAATCCTTAAAAT CATTTTACTGTGGACCGAACTGACTTGATCACTGTACGGAACCAATTCTA TGTTTTTTTCGAAAGATATCAATCAACTTTCGATCCAGCTCCCAAGCAAC TCTAGACATTTCCAACAGAACCTTCTCCAATACCTTCCATTCTTTCTAAT AGTGCTCGATGTGGAAAAAACATGAATCAtgagaaagaagagaaagaaca tCGCTCAGAACAAAAGTGTACATATCAAGCACAATTTGACAACAAAGTAT ATACGTGCAAGGTACGTCTGATTTTTATCTACTTTTATTTTGAAGTAATG TCAGTAAAAGTTTTGCCGTCTCGGTCCGCTTTTTGTCTCAGCTTTGCCAG CTAGTCTAAAAAGTTAGCAAAAAATCTATAGAATCTGTTGGAATTTGTTG TGTAAagttaatttttatttgatacgctacttttgttttcatttgttttg ttAATCGCGAGTGTTGGTAGAGTCTTTTATTATAAACAAGGCAATAGTCG ACCAATTTTAAACCTGTTTATTTCCTAGGCATGCCATGAGAAAGGCGTTG AATCACTTGTGATACCCAAAACTGCTGAAACTCAAGATTCTCCCTTGGTT GGTCTTGCAAAATATGCTTGGTCAGGGTATGTTCTCATTGTGTTTGTGAT TTGTATTAAGAAAAGAAGTTGTATTTAGAATGCtgtgttttgatttcttt ttcaatgtatttttcattaaaagttatACATAACATTGAATTCGCACctt taaaattaagaaaattgcaGAGAAAAAGATTGCATTTTGTTAAtactttt aaattaaaatagttTTCAGAAGATACACTAAAATCGactgtttgtttttt aataCACGATACTGAATAGCATTTGGCTTCCAGAGCAGAACAGGCTCCTT ACATTGTTATTTCACAAAATAATTtcactaaaaagttcaaaagtgATTAA TTCTGACGACGttttatttttggaaagtttttctttttagattttgtCTG GATTTCTCCTATACCTTTCAAACTGGCTGTCTGTAGATAATCCAAGTTAT ATTCAAATACACGATTTTCGTATTGCCAGTTAGATGAGCTTGGACTTAAA ATGGTCCGCTAAATAAAAGATTTGTAATGATTTTCGtccagaatcacaaa atatggTCCAAACAAGTTTTtctatcttttaattttttggaggATTGTTT CTTGAATTTACATCCATAAGACTTTTTGTACAGTCGTTTGTCATGCAACG AATAATGATACAAAAATTAGTATCTTTTCTTTTCCCTAGATATGTTCTTG AATGTCCAAAATGTGGTGTTATTTACCGAAGTCGACAATTTTGGTATGGC AATGGTGAAGTAGAGAATTTTGTGCGCATTGAAATCAAACATGTCTGGCC AGGGgtaagattttgatattttctgttCATCGCGTATACAAGTCTCTCAT TCCAAGCTTCTTCAAATTTGTAGCCAAGAGTGTCGTGAGAAGTACATGAA TGCAAAGCTCATAAAGAGAACTTTACccaaaaagctaaaactttaCTTTA GTTTATACTGAATTGTGTCTAGAGCTTTTTAATTCTGTTNAAACTTTACT TTAGTTTATAATGAATTGTGTCTAGAGCTTTTTAAATATGTTGATGAACG ATTTGCTTGAAAATAGACTCACTTCACAATCAATGCATTCCTCTACCACA TTTCGaaattataagaatattaatTCGTTTGCAGACACGACTTCCAAACA CTAGTCAAAATTCAGCACGACGCATTTTGGATGGTATGATGAACTTGGCA GATGCAATCACCAATGTTAGTGCAAAACCTACTAAAGCTGTCACCAGTTG GGTTACTGATAAAGTTGCTCCAACCTACTGGACACCTAACTATCTCATTA TTGTAAGttcttttgttatattttcgaatatattgTGTCTTTGAGAGATA TGTTGTTGAACGATGGAAAAAATTGTGATCCGCTCTCaatgatattttta tttgtgTCTTTGAAAGATAAACTTTTGGAATCTATAATGTATtaaattgg agaaaaatttgTCCAATGGCCCTGAATGGCCATGCTTAAGAAGATGTTGT AAAATATGAAAGATTCGAGGTTTTTTCTTTTGGACAAACTATTCAAATTA AAAGGGCTATTCAAATATGCAATTTCTAGGTAAAAATTAGCATGGTAAAA AGGGTGTGTCATTTGtcgattggaattttttttgtctaAAGTAATTATAT GGGAAGTTCATATAATTCCACtgttttcaaagaaaagttttgtttatttt tgagtAATGAGTAACTGCGAGTTTGAAAGTCGTTTTTTCCTCCAATTAAT ATCAGACCTGGTGGGAGGGCAGAAGGCTGGAAGaaagaatgaagaagaag aaaacaatcCATTCATGTTTTctccttaaaatgttttttataagaaaatc acTTTCAAGAAAGTACTTGATTAAACCTTAAACTTTGCCAGCCAATCTCT TGGATGGACAAAAAttcttcgaatttttttacaatattatggtgaaaata tttgaaatatatCTCACTTCGATTTTTCACCCTCTCTAGGACTGTGCAAA ATGTGGCCATGATTTTGAAGAGACAGAGAAGAAACATCATTGTCGAGCCT GTGGTCGAGGTTATTGTGACTCGTGTACACAACATAGGATTCCTGTACCG GACAGAGGCTGGGGAGACACGCCCGTTCGTGTTTGTGATGATTGCTTCAC TAAATCCGGACAAGTCGATCAATCGAGTGTGCAGAAGAATTCGATCGATA TCAGGTAAGAAAATTTCCAGTTTGTTAAATGTGCAAGATTTTGAGTTGCA AACATCGTTAAgaataacacccccttctcactgaCACGGTAGGATTCTTT CAGCCTggaataaaaataacggactgaaattcgatggggattaacattcc catattttttatggcttgggatttcaattcttttgttttcaagtcacaaa attcagtggggatagaaagaatagtataatattttgcagtgaagattggt ttatttgattattttcagtggggataaaaattggaggataattttcaact atggacgatatttttgccaatttttccagtgtgaaggggtcccagtaggt ctgtgagaaggggtttaAGAATAGTACACGAaggaatcttttaaaaaaat cgcaaaagctcaaagtttcaaatttaaaaactgAACCACCTTCATATTAT TTGCATGCTTTCTTTTACCAAAAACGCAATGTTAAAATCGATAATGACGA CGATATAGTACCCAAAAGGCAAGGGTTAGACCTATGGTTTtcctagaaaa aaattaaagccGGTTCTCGGTATAGTCTAAATCACATCCCTTTGTAAAAC CGCAGGTCTAAGGAGCtagaatccgttagtggatgctaGCAGCAGTAGAA TTTTCTTGTGATATCATTGGAATATCTTTATAGATGCCTTTTTAGGAATT CtagctttacagatctgtgaatATTATCAAATCGAAAATTGACCATCTTT TCTCTCTCCTTCCATCCATAGTGAGTTGTTGGAAGCGATTGATGATGACC CTGAAATCGATACAGGTGAAATGGTAGCCATCAAAACCGCCAAAAACATA CCCACCCGCCACCCGCCTGAAGTTCTCACAACACGGAAAGTAACCGAGCA AGTCCAGTCCACACTTTCATTCCTATCAAGCTCTTTAGAATATCCCTTGG AGTATTTAGTGGATTCGGCCAGACCTGATTATTGGGTTCCAGATTCCAAG ATTTTGAATTGCCACTCATGCGAAATGGAATTCTCAAAAAAAGATTCTAA GCATCATTGTCGCAAGTGTGGAAAGGGCTTTTGTGATCCATGCTCAAAGT CTAGAGTGCCGGTACCGAGTCGTGGTTGGGATTATCCAGTTCGTGTTTGT AACGGATGTTCGTTGAAGAAAGGTCCTTTGTAATGATTGAGGGTATGATG TCATCATTTATAATGATCTGTTGATGGTTGGCTTTATTTGGCTttattat gttttgatttaactttctGCTTAAAAAAAGATATCTACAACCTATGCTGT TGTTTTCCATATAACTTTATCGTGATGCTCTTGAATGTAAAGTATCCACA CATACTTGAagcttttttgaatttattcaaAGCTGTGTGAAGAGCATCTC GCTACTTTTCTTCATGTCTTTTTTGTATCTCTAAACTTGTAACTAGAACT GTATGAATTGTCATCCCAAAGTTGTTCGTTGTCCCCTAGGACCAGTTATG AATCCTAGTGGGACACTTCTTTGGAAATGATGAAGTAGACTTAGCTTTTA TATCCTAAATCATAATCATAATTTTTATCGCTGTACTGTActttactttc gtttttaacccTAGTTTCTAAGGGTGCTTGTTCCTTATGTTGAGTTAAGT AGTTAGAGAATtgtgttgttttttaattttttacatCACTTTGTGGCTAC TGAAAGGTCCCGTCGAGTTTCTTCAAGTTTTAACCAAATGGGGCCAGATC AAGGATCACAGacgggtcaaattaaattctcttTACCTTATAATTACGAA GCGTTTCAGTTTCATTTTTGAGATGAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000820XLOC_000820Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001571-exon-sc0000011-1491911889:147489..147976TCONS_00001571-exon-sc0000011-1491911889:147489..147976Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:147489..147976TCONS_00001571-exon-sc0000011-1510915933:147489..147976Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:147489..147976TCONS_00001571-exon-sc0000011-1575043694:147489..147976Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:148324..148531TCONS_00001571-exon-sc0000011-1491911889:148324..148531Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:148324..148531TCONS_00001571-exon-sc0000011-1510915933:148324..148531Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:148324..148531TCONS_00001571-exon-sc0000011-1575043694:148324..148531Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:148839..148936TCONS_00001571-exon-sc0000011-1491911889:148839..148936Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:148839..148936TCONS_00001571-exon-sc0000011-1510915933:148839..148936Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:148839..148936TCONS_00001571-exon-sc0000011-1575043694:148839..148936Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:149241..149349TCONS_00001571-exon-sc0000011-1491911889:149241..149349Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:149241..149349TCONS_00001571-exon-sc0000011-1510915933:149241..149349Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:149241..149349TCONS_00001571-exon-sc0000011-1575043694:149241..149349Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:149617..149714TCONS_00001571-exon-sc0000011-1491911889:149617..149714Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:149617..149714TCONS_00001571-exon-sc0000011-1510915933:149617..149714Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:149617..149714TCONS_00001571-exon-sc0000011-1575043694:149617..149714Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:150378..150492TCONS_00001571-exon-sc0000011-1491911889:150378..150492Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:150378..150492TCONS_00001571-exon-sc0000011-1510915933:150378..150492Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:150378..150492TCONS_00001571-exon-sc0000011-1575043694:150378..150492Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:150823..150990TCONS_00001571-exon-sc0000011-1491911889:150823..150990Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:150823..150990TCONS_00001571-exon-sc0000011-1510915933:150823..150990Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:150823..150990TCONS_00001571-exon-sc0000011-1575043694:150823..150990Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:151678..151892TCONS_00001571-exon-sc0000011-1491911889:151678..151892Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:151678..151892TCONS_00001571-exon-sc0000011-1510915933:151678..151892Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:151678..151892TCONS_00001571-exon-sc0000011-1575043694:151678..151892Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1491911889:152660..153715TCONS_00001571-exon-sc0000011-1491911889:152660..153715Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1510915933:152660..153715TCONS_00001571-exon-sc0000011-1510915933:152660..153715Clytia hemisphaericaexon
TCONS_00001571-exon-sc0000011-1575043694:152660..153715TCONS_00001571-exon-sc0000011-1575043694:152660..153715Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:147489..153715 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.310246 0.539761 1.32672e-08 0 0 0 0 4.85935e-07 0 0 0.00235826 1.40531 0.742181 0.690595 2.97339e-09 3.00602 0.583323 3.44482 0.247659 0 0 0.000913758 2.73403e-07 0 0 0 1.79385 0.0228942 0
Blast
BLAST of TCONS_00001571 vs. Swiss-Prot (Human)
Match: ZFYV1 (Zinc finger FYVE domain-containing protein 1 OS=Homo sapiens GN=ZFYVE1 PE=1 SV=1)

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 337/639 (52.74%), Postives = 445/639 (69.64%), Query Frame = 1
Query:    7 DPRVKVVSIFGNTGDGKSHTLNHTFFDGAEVFDTSPSQKSCTVGVWVSYCPNQKAIIVDTEGLLGVSENANKRMRLLMKILAVSDVVIYRTRAERLHSDMFTFLGDASEAYIKYFTKDLQSVQQRGHMENVPLCSLGPSIVIFQETHYTTPLGFENDPSEHDNSPEEILRSNFFNIGRNPAAFSSINYVGTRTTTQSTDFSIXXXXXXXXXXXXTVRSARPVSVIFNALMFLNDKFGDDI-NDILPNS--FPDEYFTCVSKCLSCSARCGKNMNXXXXXXXXRSEQKCTYQAQFDNKVYTCKACHEKGVESLVIPKTAETQDSPLVGLAKYAWSGYVLECPKCGVIYRSRQFWYGNGE-VENFVRIEIKHVWPGTR-LPNTSQNSARRILDGMMNLADAITNVSAKPTKAVTSWVTDKVAPTYWTPNYLIIDCAKCGHDFEETEKKHHCRACGRGYCDSCTQHRIPVPDRGWGDTPVRVCDDCFTKSGQVDQSSVQKNSIDISELLEAIDDDPEIDTGEMVAIKTAKNIPTRHPPEVLTTRKVTEQVQSTXXXXXXXXXXXXXXXVDSARPDYWVPDSKILNCHSCEMEFSKKDSKHHCRKCGKGFCDPCSKSRVPVPSRGWDYPVRVCNGCSLKKGPL 1908
            D  +KVVSIFGNTGDGKSHTLNHTFF G EVF TSP+Q+SCTVGVW +Y P  K  ++DTEGLLG + N ++R RLL+K+LA+SD+VIYRT A+RLH+D+F FLGDASEAY+K+FTK+L++   R  + +VPL +LGP+++IF ET +T  LG ++ PSE    PE++++  F  +GR P AFSSI+Y GTRT    TDFS L   +++ L+N T RS R   VIF AL  L+D+F  +I +D + +S  FPDEYFTC S CLSC   C K+MNH KE   H ++ +C Y  Q+DN+VYTCKAC+E+G E  V+PKT+ + DSP +GLAKYAWSGYV+ECP CGV+YRSRQ+W+GN + V+  VR EI HVWPGT      + N+A+R+LDGM  +A +++ +S  PTKAVTSW+TD++AP YW PN  I+ C KC   F++ + KHHCRACG G+CDSC+    PVP+RGWG  PVRVCD+C+           +  ++ ++     +DD    + G ++A                  RKV E VQ+TL  + ++++ PL  + D+ARP YWVPD +IL+CH+C  EFS K SKHHCR CG+GFCD CS  R  VPSRGWD+PVRVC  C+ K G L
Sbjct:  177 DQHLKVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGLLGATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTARCGL-DVPLSTLGPAVIIFHETVHTQLLGSDH-PSE---VPEKLIQDRFRKLGRFPEAFSSIHYKGTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSSFFPDEYFTCSSLCLSCGVGCKKSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCY-----------EARNVQLAVTEAQVDD----EGGTLIA------------------RKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL 777          
The following BLAST results are available for this feature:
BLAST of TCONS_00001571 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZFYV10.000e+052.74Zinc finger FYVE domain-containing protein 1 OS=Ho... [more]
back to top