Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001558 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001558
Unique NameTCONS_00001558
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2276

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001558 ID=TCONS_00001558|Name=TCONS_00001558|organism=Clytia hemisphaerica|type=transcript|length=2276bp
TAGTTGAATTTAGTGACAGTTATCTTTTAATAAAGTTACAAGctattttt
ttgagaaaagaaaTTAAGTTAAGAGAAGTAAAATTCAACAATTACTTTCA
ACAACTGTCTAAATGTCATAATCTCTTTTGGCTAAGGTTAGGATGGGGAA
ATAATGGGTATTTGCTTTTTTGATGATAAACCTCAATAGTTAAAGATATT
ATATAGATATTATCATCATAATCCAAAGCAGGAACTTGTAATTGTAGGAT
TTCAGTTTTGTCTGGTGTTTCTGACAGGAAAATTATGTAATAAAATTCAG
GTTATCTTGACTTTAATATTTGAGGAATTTGACTCCTGGAATTTGTCTAg
tgaaactgaaaaatttaataaaacaaTATTTTCCCTTTAGAATTTCAGTA
AACTAAATAATAAAATGCAGACCATCAAATGCGTGGTCGTTGGTGATGGT
GCCGTAGGAAAAACCTGTTTACTGATTTCTTATACAACAAATAAATTCCC
CAGTGAATATGTACCGACAGTATTTGACAACTATGCTGTAACGGTCATGA
TAGGAGGAGAACCATATACGTTAGGTCTCTTCGATACAGCTGGTCAAGAA
GATTACGATCGTCTCAGGCCGTTATCATACCCACAAACAGATGTTTTCTT
AGTCTGCTTCTCTGTTGTCGCCCCTGCATCATTCGAAAACGTAAAAGAAA
AGtgGGTTCCAGAAATTACACATCATTGTCCTAAAACACCATTTTTACTA
GTCGGTACACAAGTCGATTTACGAGATGATGCCGCCATCGTTGAAAAACT
CGCCAAAACGAAACAAAAGCCAATCTCTTTCGAACAAGGAGAAAAATTAG
CACGAGAATTGAAAGCAGTAAAATATGTCGAATGCTCCGCTTTAACGCAA
AAAGGATTAAAGAACGTTTTTGACGAAGCCATTTTGGCTGCATTGGAGCC
CCCAGAGcaaccaaagaaaaagaaatgtgtTTTACTCTAACTttggttaa
aaaattaattttttgttgaaacGACCTTAATATAAAAATTCCACTCGCTT
CCGTCGATCAATAATGCACACTGCGCTTATCGATAGAGAGAATCTGCCAG
TGGAATGAATTGTACAGCTTTGCTTATATGCCAAGAGAGGTGAATTCATC
ATAACATAAAAGTGTGGAATACCTTTCAAAGGTTTTGCGAGGGAAACTGT
TCATTGTATCGTTAAAAACCAACATCAAAATAAACCTCTATTTtatagtt
taaaaaaaagtttagaaacataaAATTAAATGAATTAAAATATTGTTACC
CAGGTTTTTTCTATAAATTAAGGGCTGGGTTTATGTACTATATCTGGATA
TGCAACTTTTTTTGTATGTATTCTTATGTACCTCTTTCGAAAAAATAGTA
ATTTTTAAGACTTCTCATAATGAATGCCCTGATTGAGCTCAAttcaactt
ttaatttttttgtttatttattgtgCTGATTTTTTTCCTTCGTTGCTTTT
CAGGGGATATTCATTTTTGTTTCAATCACTCAAAcgattttttaaatatg
gcCAAAGTCTTCAGTTTTTATTCTTTGCTCAATCAGGGTGTACACCGAGA
AACTATGTCACATTTTTTATAGTTGATTTCTCATGAATGAATTATGGGAC
CAACCCCCTtctatattttgttttaaaagaaaactaaaTTGGCCACACGA
TTTGTACTTATCTATCTGATTTTATACTTGTGAAAATATCAACTGTCTAG
AACTTTAAACACATCTTGCTCAGATTTGTTCTTCTTTTAAGAAATATCAG
GGCAGAGTTCCAAATTATATACTTGTCAACTTATCAAAACTATTCAAATC
GTTTATCTTGTATAATGTTCGTCAGCAAATAGATTGTTAGTTTTGACTCT
TTTTGACTATTTTGATTTTGTAGGATTATAAACTATATTTTTTTCGTCCC
CTATGTGTTgtctgtatttttgaaaaacaatgttCAATATacagacaatt
taaaaaatttgcctGTAATTTACTTCAATACTTCATGTCCTCCTTTATCT
CCATCCCCTTCTTGTCCGAAGGAACTTTACAATTCTTAATAACCGAGTTC
CAAAAGCGAAGTGGAtcatgtggtgtgtttggggcattaaggctcttacg
aacCTGTCTCCATAGCGGCTTttttattagagggatttttagagtgtctc
ttattttgctagcaacttgcgaattgaggtggagtctagatcgcttcgca
acccttatacaatacggctagtagTG
Run BLAST on NCBI

transcript from alignment at sc0000011:15287..18431+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001558 ID=TCONS_00001558|Name=TCONS_00001558|organism=Clytia hemisphaerica|type=transcript|length=3145bp|location=Sequence derived from alignment at sc0000011:15287..18431+ (Clytia hemisphaerica)
TAGTTGAATTTAGTGACAGTTATCTTTTAATAAAGTTACAAGctattttt ttgagaaaagaaaTTAAGTTAAGAGAAGTAAAATTCAACAATTACTTTCA ACAACTGTCTAAATGTCATAATCTCTTTTGGCTAAGGTTAGGATGGGGAA ATAATGGGTATTTGCTTTTTTGATGATAAACCTCAATAGTTAAAGATATT ATATAGATATTATCATCATAATCCAAAGCAGGAACTTGTAATTGTAGGAT TTCAGTTTTGTCTGGTGTTTCTGACAGGAAAATTATGTAATAAAATTCAG GTTATCTTGACTTTAATATTTGAGGAATTTGACTCCTGGAATTTGTCTAg tgaaactgaaaaatttaataaaacaaTATTTTCCCTTTAGAATTTCAGTA AACTAAATAATAAAATGCAGACCATCAAATGCGTGGTCGTTGGTGATGGT GCCGTAGGAAAAACCTGTTTACTGATTTCTTATACAACAAATAAATTCCC CAGTGAATATGTACCGACAGTAAGTAAATATTTATTCTTTTCTATACTGG ACAATAGAGTATACCTTTGGAAATGCAGCTTTTATGCATACAAGgctttc aattaaaaatgattttgtttttattttttctcaagGTATTTGACAACTAT GCTGTAACGGTCATGATAGGAGGAGAACCATATACGTTAGGTCTCTTCGA TACAGCTGGTATGTATATTTGAATCATGTTTTTATTAGTatatcaaaaaa gattttttgtccaCCTTTTCCATTTTCCAGATTGATTGAGAACTTGGACT AAAAAGCTTTTGACATCTTTCTTTGTGTTAAAGCAGTATCGTAATTCTTC CATCTGTCGAAAGAAATCCATCCAGTTGAGATTTTTCACTTAGATTTCCG TCCCAATAGCACACGAATCTAAAAGTAGTAACAAATCTGCATAACTATTT GTTTGTATAACTTGCGATCTCGTCCTCCTTTGCGTTAACTGCTCTTGCAC ATTAGTCAATTACAATATTAGAGGTAATAACTTTCATGGTTTTACAATCA TTTCAAAATGAACTGTGGGATTGGAACTCTACAAATTTctagttgaaata attatgacgtGTTAGATACGAAGGGCTATTGCAAGCCTTTGAAGCTTTCG TCTAATTTTGAACCTTCTATCCAGAAAACCAAAATAGTTGCGAAACTGGT ACTTGATTTAAAATCCTATTTATCACTTTGTTATTACCAGGTCAAGAAGA TTACGATCGTCTCAGGCCGTTATCATACCCACAAACAGATGTTTTCTTAG TCTGCTTCTCTGTTGTCGCCCCTGCATCATTCGAAAACGTAAAAGAAAAG GTACGTTTTACTAGTTTAAGATCTATTGTGATATTTTTAACTTATGATCC TCAAATGTTTCTGTGTTGTTCCATAATGAGCAACCaagaaagaatttcaa aaattgaataatcGCTCTAACAGGCCATTGGTTACTGCCCACTTAGTGTG AAATAGTTTTAAATTCTTGATAATTCCCAAAAAGTAATTGATTTTATAac aagtttttcttttcttttcagtgGGTTCCAGAAATTACACATCATTGTCC TAAAACACCATTTTTACTAGTCGGTACACAAGTCGATTTACGAGATGATG CCGCCATCGTTGAAAAACTCGCCAAAACGAAACAAAAGCCAATCTCTTTC GAACAAGGAGAAAAATTAGCACGAGAATTGAAAGCAGTAAAATATGTCGA ATGCTCCGCTTTAACGCAAAAAGGATTAAAGAACGTTTTTGACGAAGCCA TTTTGGCTGCATTGGAGCCCCCAGAGcaaccaaagaaaaagaaatgtgtT TTACTCTAACTttggttaaaaaattaattttttgttgaaacGACCTTAAT ATAAAAATTCCACTCGCTTCCGTCGATCAATAATGCACACTGCGCTTATC GATAGAGAGAATCTGCCAGTGGAATGAATTGTACAGCTTTGCTTATATGC CAAGAGAGGTGAATTCATCATAACATAAAAGTGTGGAATACCTTTCAAAG GTTTTGCGAGGGAAACTGTTCATTGTATCGTTAAAAACCAACATCAAAAT AAACCTCTATTTtatagtttaaaaaaaagtttagaaacataaAATTAAAT GAATTAAAATATTGTTACCCAGGTTTTTTCTATAAATTAAGGGCTGGGTT TATGTACTATATCTGGATATGCAACTTTTTTTGTATGTATTCTTATGTAC CTCTTTCGAAAAAATAGTAATTTTTAAGACTTCTCATAATGAATGCCCTG ATTGAGCTCAAttcaacttttaatttttttgtttatttattgtgCTGATT TTTTTCCTTCGTTGCTTTTCAGGGGATATTCATTTTTGTTTCAATCACTC AAAcgattttttaaatatggcCAAAGTCTTCAGTTTTTATTCTTTGCTCA ATCAGGGTGTACACCGAGAAACTATGTCACATTTTTTATAGTTGATTTCT CATGAATGAATTATGGGACCAACCCCCTtctatattttgttttaaaagaa aactaaaTTGGCCACACGATTTGTACTTATCTATCTGATTTTATACTTGT GAAAATATCAACTGTCTAGAACTTTAAACACATCTTGCTCAGATTTGTTC TTCTTTTAAGAAATATCAGGGCAGAGTTCCAAATTATATACTTGTCAACT TATCAAAACTATTCAAATCGTTTATCTTGTATAATGTTCGTCAGCAAATA GATTGTTAGTTTTGACTCTTTTTGACTATTTTGATTTTGTAGGATTATAA ACTATATTTTTTTCGTCCCCTATGTGTTgtctgtatttttgaaaaacaat gttCAATATacagacaatttaaaaaatttgcctGTAATTTACTTCAATAC TTCATGTCCTCCTTTATCTCCATCCCCTTCTTGTCCGAAGGAACTTTACA ATTCTTAATAACCGAGTTCCAAAAGCGAAGTGGAtcatgtggtgtgtttg gggcattaaggctcttacgaacCTGTCTCCATAGCGGCTTttttattaga gggatttttagagtgtctcttattttgctagcaacttgcgaattgaggtg gagtctagatcgcttcgcaacccttatacaatacggctagtagTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000816XLOC_000816Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001558-exon-sc0000011-1491911889:15287..15805TCONS_00001558-exon-sc0000011-1491911889:15287..15805Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1510915933:15287..15805TCONS_00001558-exon-sc0000011-1510915933:15287..15805Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1575043694:15287..15805TCONS_00001558-exon-sc0000011-1575043694:15287..15805Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1491911889:15922..15994TCONS_00001558-exon-sc0000011-1491911889:15922..15994Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1510915933:15922..15994TCONS_00001558-exon-sc0000011-1510915933:15922..15994Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1575043694:15922..15994TCONS_00001558-exon-sc0000011-1575043694:15922..15994Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1491911889:16527..16636TCONS_00001558-exon-sc0000011-1491911889:16527..16636Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1510915933:16527..16636TCONS_00001558-exon-sc0000011-1510915933:16527..16636Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1575043694:16527..16636TCONS_00001558-exon-sc0000011-1575043694:16527..16636Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1491911889:16858..18431TCONS_00001558-exon-sc0000011-1491911889:16858..18431Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1510915933:16858..18431TCONS_00001558-exon-sc0000011-1510915933:16858..18431Clytia hemisphaericaexon
TCONS_00001558-exon-sc0000011-1575043694:16858..18431TCONS_00001558-exon-sc0000011-1575043694:16858..18431Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000011supercontigsc0000011:15287..18431 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
30.6064 28.2842 34.1751 41.464 81.0591 68.0731 65.9161 68.6429 12.2195 11.442 15.8679 12.3882 14.5469 19.8118 11.5429 9.48042 16.7483 14.5282 15.7538 9.47165 26.5234 23.3404 23.0532 24.284 79.3735 71.4061 23.2701 20.8046 17.8079 16.4474
Blast
BLAST of TCONS_00001558 vs. Swiss-Prot (Human)
Match: CDC42 (Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2)

HSP 1 Score: 351.673 bits (901), Expect = 7.077e-116
Identity = 168/181 (92.82%), Postives = 175/181 (96.69%), Query Frame = 1
Query:  415 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVKEKWVPEITHHCPKTPFLLVGTQVDLRDDAAIVEKLAKTKQKPISFEQGEKLARELKAVKYVECSALTQKGLKNVFDEAILAALEPPE 957
            MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVV+P+SFENVKEKWVPEITHHCPKTPFLLVGTQ+DLRDD + +EKLAK KQKPI+ E  EKLAR+LKAVKYVECSALTQKGLKNVFDEAILAALEPPE
Sbjct:    1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPE 181          
The following BLAST results are available for this feature:
BLAST of TCONS_00001558 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CDC427.077e-11692.82Cell division control protein 42 homolog OS=Homo s... [more]
back to top