Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001511 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001511
Unique NameTCONS_00001511
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2224

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001511 ID=TCONS_00001511|Name=TCONS_00001511|organism=Clytia hemisphaerica|type=transcript|length=2224bp
gcaaataaagattattAAACAATTATTAAATATCAAACTGCAGGATATAG
AAaaaatgtataagaaattgcTAGAAACAATAATTGATGTGCTGGAATGT
TTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACA
AACTAAAGACGCTCAAAGCAACAATGATTTTATTGAAGAGATATTTCTAG
GTTGCAATCGATATGATTCAATTCTAAAAGTAGTGGTAGATGCGTATTTC
AAAAGTGAGGTTGGAAGACATGTTTGTCTGATAAGTGACACTAATTTTTA
TAAAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTg
tacattttcgaaaaattgttatTGCCCAACAAAAACATGCCAAGACTTAC
AGGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTT
TGCCGAGtGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATAC
TCTCGCCTGTTTTAAGgTGGCTTCCAGAGATACACGAGTTTTTAGCTCAT
CTTAAAGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATC
CCCTACAGAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTG
TTCCAATTCCAGAGAAaATACCTACTATAAAGAAGCATCGACCAGTACCA
GAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAA
TGATAGAAACAGACAAAATGCCGAGAGGCAACTAATAGATGCATCAATGA
ATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAGA
ATGATCAAATATATGAAAGAAGAAGATTCAAAATTGAAATTCAATTCCAG
TAAAATGAACCCTCTCCCAGCCAACAATGATGACAACATCCCCATCCGTT
TGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAG
GAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCaagGTGGTCGAGATGC
ATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAG
AGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTAT
GAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAA
AGTACAGAGTATTAAAAAAGAGACTAGAGAAATGATGGACGAATTTTTGA
AACAGAAATTTCAAAAGCAACAAGACATGAGAATGTTAGTTGAGGATATC
ATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCAAACTCAAAAAGTA
CAAACAAAGCATAGTTGAACAAGTGACGAACGAAAGTAAAGCACTCATGA
GAAAAGCGTTGGAAGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTG
ATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAAca
AGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTCCG
TTGCTGAGtTACGAGAACGTTTGGGTATTTTGAAAGttcaagaaaaagaa
gatgaagaaaagaagagacaagaaattattcaaaataaagtGGACAAGAA
CCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCA
AAGAAAGAGAGGCTGCTATGAAACAAGAAGAAAGGCGCTCACCAACAAAA
CGAGAAATCAAAGATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGC
AAAAAGGGCAGAACGTGAAAAACTTCGTCAAATCAGCCCTCCAAAACCAA
CAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGGAAAAACTGGAAGAG
ATGCGTTGGAAGGAACTTGAGAAAACACGTGAAAAAGCAGCGCGCCTTCA
TGCTAAATCCGCCACAAACAGTCAACAGCCGAACAGAGTAAAGTTGACAT
AGTGTGTTGTATAAAACCATTGAACCATTGGTTTATTGTTGGTAAAGAGC
ATGTTCTGTTTTTCTTGATAAGGATGATTCTAGATCACCATTAAGGAGTT
GAGTAGTGGAGAAAATCTccaaaatgattttttacactTTACCTGGCAGC
CTGAAGGTGTCTAAGGCCAAAGGAGCTGCTGTGGTTGATTCTTTTGGCTT
TAATGATTTCTGCTTGGAAATGAG
Run BLAST on NCBI

protein sequence of TCONS_00001511-protein

>TCONS_00001511-protein ID=TCONS_00001511-protein|Name=TCONS_00001511-protein|organism=Clytia hemisphaerica|type=polypeptide|length=666bp
QIKIIKQLLNIKLQDIEKMYKKLLETIIDVLECFDATVDEPQAFIEEYLQ
TKDAQSNNDFIEEIFLGCNRYDSILKVVVDAYFKSEVGRHVCLISDTNFY
KVLCYISLFCLDDLGAVHFRKIVIAQQKHAKTYRFLNYLFDETKLKTWLF
AEWCKIYDHSYVQINILSPVLRWLPEIHEFLAHLKDRENNRQKAKRDVLS
PTEVKPFNLTKVKPRSVPIPEKIPTIKKHRPVPETTYSKPKEIDSLATAN
DRNRQNAERQLIDASMNQFSCATTEKSAKTKERMIKYMKEEDSKLKFNSS
KMNPLPANNDDNIPIRLNAATIMREGVLIQKKEEEEYKKLADLAQGGRDA
SEFLSWQQDMRRKDLEEKLAEIEANRISGQLSYEEAILARQSLVDENRKK
VQSIKKETREMMDEFLKQKFQKQQDMRMLVEDIMEGHENAKEAKVKLKKY
KQSIVEQVTNESKALMRKALEEAEIEMREKIALIAKIRAIESVPRIRCKQ
VDLTESSGIGLLGEMSVAELRERLGILKVQEKEDEEKKRQEIIQNKVDKN
QYLMDTLESIAQRRARKEREAAMKQEERRSPTKREIKDPKVLGMQERLSA
KRAEREKLRQISPPKPTRSKHIQLNKQKEKLEEMRWKELEKTREKAARLH
AKSATNSQQPNRVKLT
Run BLAST on NCBI

transcript from alignment at sc0000010:985935..1007832-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001511 ID=TCONS_00001511|Name=TCONS_00001511|organism=Clytia hemisphaerica|type=transcript|length=21898bp|location=Sequence derived from alignment at sc0000010:985935..1007832- (Clytia hemisphaerica)
GCAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAG AAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGT TTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACA AACTAAAGACGTAAGAATTAAGATTTTACTAGGGTCTTGATTGTTATAAG AGCTAATCTTCCAAACTTGTTAATTATAGCATGCCCTTTTTTATACCTGC TCTTACTGGCTTTGTTTGGCTTGCAACAACAGATAAAGGGCTTCTTCTGA AAAAAAGATTCAATGGTTAGGCGAGACAAATTTAATTTGTTGTTCTACGG GCAGATCGTAAGCAAAATATGGGTTGGTCGGTCGGTAAAATAAGAATAAA TTTTTCATTTATCAGGGTTGGCAAAGTACCAAAAATGTTTTCCAAAAAAT ATCTAATTCAAAAATTCAGTAGTGTATGGAATGCTTGATTTTCTAAATTT TTCAATTTCTTGAATTAATTTTCAGCTTTATTATAATCTTTATAGTAGTG TGTAAAATATATTGTAGTGGAAATTCAATTCAAAAAAATTTTTATTTTAT TTTAGCAAAAATAGGGTCGGATTTTCTACTGTTTTCATTCTATTTGTGTC TTGCATTTGGCTCCCTTGACTGCAAAAATTGATGTGTATAACATCAGCTT AAAATTCCAAAGTAATCAAACAAAATCATTATTCCATTAGATGATCTTTT TAATTTATAAACCAAATTGTTTACTTATAGGCTCAAAGCAACAATGATTT TATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAAG TAAGTTCTGTATTGCTCTCATTCCAAATGTATATTTAAAAATTTAAAAAT TTTGTTTACAAAAATACCAGTCTGAAACCAATCCTGTATGGTTAAATTAC TGATTAAGTTTGATGTTTGAGATGACAGCTTGAAATAAATGATAATTGTT GTTTGAATTATGTTTGCATTGACTGTTTCTTTGTGTTTATTACAGGTAGT GGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTGTCTGATAA GTGACACTAATTTTTATAAAGGTTCGTTTCATCATAACAAACAAGAGAAC ACATGTGCTTAATTTAGGAGTATAACCAGGTATAACCCATTCTCCAATAG TGTCTGGTTATATTCTAATTCACGGTAGATATTTTTTGTGGTTTTACAGT ATTTTAGGCCAATTCCAATGACAGACAGAAAGTTATACATTCCTGATGAC TGAATTATTTATATTTTTACATTCAAGTTCTCTGTTACATCAGCCTGTTT TGTCTGGATGACCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCA ACAAAAACATGCCAAGACTTACAGGGTATTCTTAATTATATTTACACCAA ATATTTGAAATTTTTGAAGTGTTTTTTTTTGACAATTCTTTAATTTGTTT AATTCATACTTTGCGAGATGTTAATAAGTTACTCTACTGTACAATGGGCT CTTCCAGAAAATTTTGTACATGGGGGGGGGAGAGGTGGAGGATATATTGG ATATTTTATCTGGGGGGTATTGAAAAATCTACAAAATTTGCCTTGTTTAG GGGCAAACTTGCTTTGATTAGGGGTGATTTTGAATGCCCAGGGGTCAAAA TTCACAATGTCCGGGGGGTAAATTTCCAAAAAATGTTATATCCTCCACAC CCCCAATATTCAATTTATTTTCCGTAAGAGCCCATGTTCCAAAGATAAAT AATAAAGGTTTCAGTGGTATTTACTCCAGTATCTCTCTCCTCATTCTGTT TCAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGT TTGCCGAGGTAAATATATTGCAATTTGCAAGAGAGAATATCATTCTTTGT GCACTAATCTTTTTAAAATGTATGACATCATGTATTTGTAATTGTATTGA TTTTGATTGCTTTTTAACAAAAGGTGCGGTACATAAAAACAGGGTGAAAA TTTACTGGAAGTTCGGCTTTACTTTCTTTTTAGTGGTGCAAAATCTATGA CCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAAGGTATATTA TTTTCCTTTGGTATTGTCAAAAGTTCTTTTTGAAGCACTCTAATAAGGAA TTTGCGTGAGAAATCGTAATGAATAGCTCTAACTCTTCCAGGCTTTAATA ATTATTTTTAAATGGAATATCTAAAATTCACTTTAATAAAAAATCCTGTT CAAATATTTTCATTTTTAAAACCAGTAAATAGGAAGAAGATTTTAGCATT TGAATTTGAATTAAGGAATAATAACTTTGTACCTTTCAATACTCTCTTAT CAAATTCATGATTTTCTCATTTTTTTAGGTGGCTTCCAGAGATACACGAG TTTTTAGCTCATCTTAAAGACAGAGAAAATAACAGGCAGAAAGCCAAACG GGATGTACTATCCCCTACAGGTAAATTTTAAAGGTTTTTTGTACCCTCAA GTAAAACATAGTCCACAATTTCTTTACTGACCATTCTCAATTTTGTTACT ATTAAAGAGTATTTATAATATCAAACTGTTATTTTACTTTCTATGTTTAG AAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATT CCAGAGAAAGTATGAATTATTTTTTATGCAGAACTAACAGTACAAAATTA TCACATCCTCGTTTTTAAAGCTTGCAATTTTCTTTTTGATCAAGTAAGTC ATGACTTAGGAATTAGAGATGTAAAGGAAAGTATTTAATAATTCAATTGA AAGTAAGTGAAGGTTTAATGCTGATTGTTTCAAATTGGTGTGGGGTCAAT TATGCAATCTCACAGGTGTCATTCAAAATTTTCATCAAAAAATCTTAATT CTTAGATGGTGTTAATTTTAGACCAATAAAAGTAAACTGATAGACCTCTA AAAACAATAAACCTTGATTTGACTTTTTAGATACCTACTATAAAGAAGCA TCGACCAGTAAGTCCCCAATTTTTCCATACGATTTGGTGCACAGAGAATT CCGACTTCCTATACCAGCGGTATCGTCAAGGGGAATCATTGCTCTATATC TTATATTTTTTTAATTTGGTATCTAAAAGAATCTTTTGCGTAAATTCATA AAATACCTTGTGGAAAGCTTCAAGAAACTTAGAGAACAAGTAACTAATTT TTGCAGAACTTATTTTTGCAAAACTAATTTTCGCGGATGTCACCCTTTTT GTTGAAATTCTTTCATAGATAGAGGATTTTTAATAAAAATTGCGTTTCAC GGAACTAATTGATTTTCACAGTAGACACCCAAAAACGCAAAAATTAGTTC ACACGAAAATTAGTCATGGGAAAATTAGTTCCTGCGAAAATTAGTTCCCT TAAGGTAGTCATAAATTAGCCCAGGCAATTGATATATTTACATTCAATAC CATCCTAGGTACCAGAGACCACATACTCGAAACCAAAAGAGATTGATTCT CTGGCAACAGCAAATGATAGAAACAGACAAAATGCCGAGGTAATGTTAGC TTTTGTACCCAGATTCAGAAAAGGATCTTATCAATTATTGTTTGAATAGT TTTTTGATTCCATTTGCTGAGAAACTTTTGGCGAATACCTTTGAAAAAAT TTATTAATCAAAAGATCAAGAATTAAAAAGAACAGTTTTGTATATACATT TTTTGAATAATATCACTTACTACCCTCATTCCACATATCTTCATAATAAC ATTTGTTCATTTAATTTACTATTTAATTTTAGAGGCAACTAATAGATGCA TCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAA AGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACTTACTAC TCTTCTTTTGACGGCCTTGATTTTTACTTTGACTCAAATTCATGTTAATT ACCTCAGATGCTAAATGCATCGTTAAAGTGTGGGAAGACTGAGTTCTACT CTACCAGGAAGAAATGATGTCGAAATGTCTGAGTTCATTGCATTGACATT CTTAATTCGTAATTTGGATGAGGTTCAAGTATTCTTAAAAGAAAGTACCA AAATTGAGGGTGAAATATTCTTAACGTATTCTTACTTTTTTAGACTTGAC TTTTTTACAAACATGAGAAATGATCAATTTGAGAGTTTTGGATTTTTGAG TGAACATTTGTGTTAAAATTACATTTCTTCAAGTTTCAATTTATCTCTAA CAAAGGAAGCAGTTTTTCTGTTAACCAAATACAAAATGACTGTATTCTTA TCAAATTCTTACGATTTGGCCAATTTTCACCCTGATATTCTTATAGAAGA TATTCTTATAAAATAAATAAACATAATAATAAATAAACGTCAAATACAAT TGAGTAAGGTCACATCTGATAGCGACAGTCAAATTCAACAAAATCTGAGT TTTTCTGAAAAATCATGAAAAATCGCTACTAGACCCACTCAAATTCATCA AANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNGACAAACGAATGGAAAGATAAGATCTATAAATTGTAAAGAT GTAAGATTGTTTCATAGAGGTCAATAGACCTGAGAAATACACTTCTATAA ATTAAAAAATAAAGCGTGTATATTGTTGTATATTGAAACTTTAAGTTGTT TATGAATTGCTCCTTTTTTTCCTAGATTGAAATTCAATTCCAGTAAAATG AACCCTCTCCCAGCCAACAATGTAAGTTCAATGTGAATTTATTGAGAAAA TAATTCATCCCCATTGATAAATTCGTTTTTGATAGAACTGAAGCCAAACT AATTTATTATATCTTAAGAGGAGAAATTTTGACAACGGAAAGAAAATTTG GGGATTTGAAATTAAGTTCCCGTTAACATTTTTTTCCTTAAGGTATTCCT TCCTGTATATTCAGGATTTCCAACTCTGATTAAATGAGATTCAGGATTCT TTACTTTAATTTAGCAAATAAACTTATTTAACAAAAAAAAATTGACAGTT TAGTCGCTAAGACCCTTGCACCAAAAGCCAAGGTTGAGTTTTCTGAATCG ACCTGAATTGATACACTCTATAATACAGAAATTCACCATCATTCAACCCC TGGTAAATTCAGATCCAATGTTAATAGTTGTTGTTGATGTACATCATTTT TATAATCTTATAATTTAGGATGACAACATCCCCATCCGTTTGAATGCAGC AACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAGAAT ACAAAAAGCTAGCTGATCTAGCGCAAGGTTTAAAAAATGTTTTCTCTTTC TTTTTGTATAATCCAAACAATTTTGGGCTCATTTTCAAGCATTTTTTTAT CACCTAAAAAAAAACAACCAAAAAAAAGAATCATTTTCAGAATTTCCTAC CTTCAATAAACTATACATTAAAGTTTTTTGGCTCAAAAAACGCATGTTTA TCCATAAGTATCACTATTAATAAGCATACATCAATGTTCTTAGTCAAATT ACTCAATTTTTTTATGAGATAAATGCTTTTTTTGCTCACGAGGGCTTACT TTTGAAGAATATGTGTGTTTAGACATGAAATTTTCGTTGCTTGGCGTGTT TTTATAGAAAAACTGGCCTAATTCGATATTTTTTTATAAGCACATTATCA ATTACTTAGGCCCGATTTTCGAAAAAAAAATGTTTTTTTTTTTAAAGAGA AATATGGTTTCAGGCGCTCATTGGGCTTCTTAAACCGATCTTTTACAAAA TATTTTCTTAAAATAAAGTTTGTCGCGAGGATTTCCTCGGACTCTGAATA CATGATCTTTCTCCGACATCGCTTGATTTATTTCGTTCGCTTTTTTTCGC CACTCTTTAACTTGTTCTCTTTCCATTTTGGTTAGGTCGTCCGTTATGCT AACGTTGTTGTACTTTTGATGTTGTTTTAGTTCCCTCAACTGTTTCATAA ATCTGTATTTGGAATGTGTGTCTTTAAACACGACTTTTATTGGGCGCACA CCAGATTCTTTTCCTATACGGGAAACGTACGTTGGTTCTGTATTTATATT GACGTCGCTCAGGAGCTTGGCTACGAAGTCTTTCTCATCTTTGTTTACGG CCTCTTTGAGACCATGGATGATGATGTTGGCATCCCTTGATTGTTTCCTC TGTTCCTCGATTTGTTCTTCAACTTTTTCACTCCGGAGAAGCCGTTTTAT GTTCGTGATGATTAAGTCGTTGTTAGTTTTTGTCATCTCAGCGTAACTTT TCGTAGGAATTTCCTCTTGGTCCGTTTTAGTCTTTGCAATTATTGTCTCT TCGATTTTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATTTCAGTTACTTGGTT CTTCTCCTGTAGATATCCTTGACATCTTGCTTGCAGCTCCTTAACTACAC AGCCTAGTCTTTTCTCATTTTCGCTACTATTTTTCTGGTTGTCAACGAAG CCTTTGACACGCAGTGATTGATCGATTATCTTTTTATTCAGTTCTTCATC AATTGAACAGCAATTTATACACTAGTACTTTCGATAACCTTTATTCAGAA ACAGCTTTAATTGATATGTTGGGAGTCCAGTACATGCATAATGTATTCTC TTGCAATTTTGACATTCGATTCTCATATTATCATTATCTTTGATTCAGTT CTTTTCTGTGCATCGATCGGTGCCATTTTCACTTTCTTTTTTGGTTGATG TAGCAGTAGGAGAAGCTGTTTGTTGTTGAAATTTGGTTGTTTTTCTCATG TTTTTTTGATTTTTGTTAAAAATTCTCCATTTTTTTAAAGAAACGAAGAG AACGACCTTCCTAATTGACGTCAAATAAATTATGAAAAGTTTTTGGGCAA ATTTGGGCCAAAAAACGGCTAAAAAAAGGGCTTTTTGGACTTTGAAATAT TGGATCATTGTGTTTTTCTGATTTTTTGCATGGAAGTAGTTAAAAGATAG CTCAAGCAGATTTTTGTAAAAAAAGAATTTTCAGCTCAAAAAACGCATCT TTATCTATAAGAATCACAATTAATAAGCATACAATGTTTAAAAACGCATG TTTATCTATGTCAGTGTTTTTTACACTTTTGGCAAAAACGTGAAAATATG GGCACTTTTTTAAACCAAATTTTAGAGAGCAAGTTTTCGTTCATTATATC AAATTTAGTGGGTCTATTGGAGAGAGAAAAGATTAAAGATTCCATTCCTT TTTAAATGAACTACATAGCGTTATTGTACTAAACGTAACGATCTTTCAAA GTTTGGAGCAGTTAATCATAAATTTATTCCATTGGGAAATGGAAGAAATA TTCCATCGGCAATAGCTCATTGAGTTTTTAAGCTTTTGGNAAGATTGATA TATTCCTAGATAGTTCTTGTGTTAAAAAAAATACGAAATAAATTACCCAG AAGCATCTTTACGTTCATGTCAAGTTATAATCCATAATCTGAGCTTCTCG TTCAAAAGTGCTCCTTTTTACAGACTTGTTNAGGCAGAAGCCTTTAAGCG TTCGCAATCCATAAAAGGAAGAATTATTCCATTTAGAGCAATTCTAGAGG AGTTATTCCGCTTTTTCGTTGGATAAATCATTAACTTCATTCAAAATTTT ATTGGGTAGTATTTGAGAAATCATGTAAAGCAAGCATTTGTTCAATCTCA AGCATCCCTAGAATTGAAAAGTTAACATTTTTTTGGAAATGGAGCATGCA GGGATTCCATATTTCACNATATATATTTTTGTTGGAATTCGAAATGTTAC ATTGCTTGGGTGACTGGTAGACTTCGACTTCTTTGCATTAATAGAACTAG GTAACCCTTTAAGGTATGTGTTCACCTTCCTTGACACATTCTCTTTAATT GATCATATCTTTAGAACAACAAATTTTTATACATCAAAAGTATATATTTT CTGAAAGCCAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAATGTGTCAAAAATAT TACTATTCAATAGAGGTGAGAATAAACATCAGCTGAATTCTCTCTTTTGT CTTTGTTGTTTCCGAAAGAGACAATTATTTGAGTATAAAATAATCCATCA TAAGACGAACTTTGTTTTGAAATTTAAATGGTTATAACTCTGGATCTAAA AAAGATTTTAAGATCGCGATTTTACCAAAATGAAATCCAGTAACTTTTCT TCCACTTTGACTGAAAAAAATTTTTTTGACAAAAAATCGGAAAAAGGGTG TACACATACCTTAAAAACGGAATATTTCATCCTTCTGAACTCTAGAAAAA TCTTACTTCTACAATTTATCGAGTTCTTGATACTTATTATGTTTTTAAGC TTTTCAAACTGGGAATAGTCCGAAGAAGCTCAAAGAGGTTACTATGGTTA GGTTTTTCTGATATTTCTTGTTGGAATATTAATCTTTCTCAGCTCCTNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAATCTTGTACGAC TCAGCAGACTTTCCACCAAGTTTAGATGTTATAGGACTCAAAATCATTTG ATAAAACCTTAAAAATTTATGTTTAGCTTTAACTGACTATTGTGACGGAA TAAGCAATAAAAAAGTGCTCTTCGCTTGTGTTTTTCGAAATCAGGGATGA AGGTGTAAGGAAATCGTATTTAGAACTTTGAAATTTGTATATAACAATTT CAAATGAGAAAAACACAAAATCTAATTTTTTGGAATATCTCATCAAGTAT TGCTCGAGGAAAAAATTTCAACAGATTTGAAATTATAATTCTTAACTTAT TGGAAGTTTTTATCCCAAAATACTCAAGAATCGTGATTTTAGACTGAAAA AACCGTTTTTGACGAAAATTATAGTTTTCACGTTTTTGCCAAAAGTGTAA AAAACACTGACCTATAAGAATCACTATTAATAAGCATACATCAATGTTCT TAGCCAAATTGCTCAATTTCTTGATGAGATATGTTTTTTTGCTCACGAAG TCTTGAATATAAAAGAATATTTCAAGAGTATGAAATTTTGGTTTCTAAAC GTTTTTTTTTTATAAGAAACAAACAACTAATTTTAATAGATCGTCACTAT TTGTGTTCTGAATGATTGTTTAACGGTCATGCTTACGTAGATATCAATTA TATATGTGTTAAATGCATAACCAGGTAGGTCCATAAAAGTACCACTTGTG TTTGTTATTTTTCACCTTTGCTTTGATCTTTCTAGGTGGTCGAGATGCAT CTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGAG AAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATGA GGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAAG TACAGAGTATTAAAAAAGAGGTAATCCATCCTCCTTATAAAATTTGATTT ATTTTCATATTTGAGTTATTTTTTAAACTATTTTGAATATTTCACTGTCT CATCACACTGAATTACGTCCCTAAGGTATCATTAAAAAAGGGCTTTTTAA ACCAACCTTTAAGCTATCGTTATACAAATTTTCTTATATTAACTCCTTTT TATCGTTTTTATCTCCTTAGACTAGAGAAATGATGGACGAATTTTTGAAA CAGAAATTTCAAAAGCAACAAGACATGAGGTGATTTTTTGTGTGCCGATT ACTCGTCAAATGACAACAAATTGGTTGATAATTCAATGTATAAAATGAAA GAAGTATGAGAAAAACCTCTTTAATGAATTGTGCATCAGTCCAAGAAAAG TCTTTATCAGGTGTCATTGTACATTATTCAAATTCTTTTCATGGTTTTTA GAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCG AAAGTCAAACTCAAAAAGTACAAACAAAGCATAGGTATGCAATGTTTTTC TGAACTGGCATGAAAAATAACCTGGAAGCCTGTTCTTGTCTGTAAAATAC ACATACAGGTGCCAATTTTTTTGGGTCTGAGATCTAAATCCATTTTTGAC CCCTAAACTACAAATTGTGTAAAGTTTCATACTTTTACGCCTTTGTGCGC AATGTTAATGACTCTTTGCACATCTAGACTGCACTACTCTTTTCGAGTTC TATTTAAAAGATTTGGTTGACTGTTTAATTGATCGCTCACTCTAAGGATG ACCTCTGCTATCGGCCTTTTCAAAAAAGGGTGCGCCAATCACCAACTAAA TCATCAATCAAAGGACACACAAACCCCATTTATCTGCACTTCCTCATTTT CTTTCTCATTATACAGTTGAACAAGTGACGAACGAAAGTAAAGCACTCAT GAGAAAAGCGTTGGAAGAGGTTTGTTTCACTGTTCTTGCAATGACAGTCT TTCTTTCCCAATTCATCTACAAACGTAGATATGTGTTATATTTATTTTAT AATATTTACCATGAGGTGTATTCTGAGAAGTTGTCAACAACAATAAGAGT TTATACTTCACTGAACCGTCTCTATGGGTGCTATGAGATGGTGCATGGGT TGTGGTGCTCCTAGGTCGCTACTTGCCGTATCCAGTCAAAAATGTAATGT AACGTATCCCTTCCCTTGGAATGGCCGAACAATGTGATTGTTCATCAGTT CTCAGGAGAAAATCCCAAGAAACAAAGTTGTTTTGAGCGAAATTGACACC ATTCAACATGAACATTGGGAATCATCCATATATCATCAAGCTTAATACTT ATATTTTCTTCATCTTTGTAGGCTGAGATTGAAATGAGGGAGAAGATTGC ATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCA AAGTAATCAGAACTTTTTTGCACTTGTTGTCATTTAAATCGAGTCGATTC ATTGAATTCTTTTGTGATAATCCAACCTTTCTTTATTGTGCAATATACAT TCTTTGGGATTCATGATCACTTCTTTAATTCATGAGAGATCAATCACAAT GTTTTTTTTTATAAGCATTGCACTTGTAAGCATATCTAGGCTCATATATG GGGAAAAATTAAGCATATGCTAAGCATTACCTCGAGCATATGAAAAAAGT ATAAGCTACTTTGTAGTAATAGCTACTTTATTTTTTTGTGAAGCCATTGC AAAGCAAATCGAAAACTAAACCAAAAATCTGTTTCAATTTTGTTTCCCTC TTTCCCCACTTTCGTTTGTTATATGGGTATTAACTCTACTTAACTTCTAT AGGTAAATTTAAGCATATTTTGAGCCTGATTCATTATCTTTTGTAAGCAT CCTCGAAAAATTTATGTTAGGATATATACATATATCCCTAAAGCATTTTT TCAGCCTTATTAAGCTTTCGGCTTAAGCATCTTTGAGCCTGTTTTATATG CTTATAAAAAAAACATGTATCTATGATTTAACTATTTTCTTCTCTTTTTC TTTTTCTAGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGG AGAAATGTCCGTTGCTGAGGTATTTTAAAATTGACATCTAAAAAACTTGA CACATTTGCCTTGGAGAAAGTTGTCATGTCGCTACAAACTTCTAATTCCT GATAAACTTCAAATTTCTATTGAGTAATCTATTTTCGAATTATTTTTTTG CTGGTTTCTTGATCGTCTAATCATTGCTTTATATGCTTTTTTTTCTTTCT TTCAAAGTTACGAGAACGTTTGGGTATTTTGAAAGTTCAAGAAAAAGAAG ATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTGGTAGGATTT TTGTATTTGTCTTATGATTCACAGCTTTTGTTATGCACGGCAACGTCCAN GGGATTTTTTGTATTTGTCTTATGATTCACAGCTTTTGTTATGCACGGCA ACGTCCAGTTTATACTGATTTGGATCACTGATTTCCGATTTTCTTAAGTA TAACTCCTGAAACTTAAAGTTTTTACAATATTGTAGTTTGTTAATGACTT GAAAGTCTTGAAAGTGAAATAGAGCTCATCAAAATATTCTTCTATAACAA TATTTAAAAGAAATCATTTAACGTATATCTTCTACCATTTGCTTACACAG CATTTTCAAACGACCGATAGAACAACCTTTTGTCACTCCGGCGCTGCGTT GATTTTTTAGTCTGCTTTGTCAGCATAATAGATGCGTCTCCTTTCTATAT CGTAAAAAATACCTTTGACTAGGATAGACAATTTGTTTATGTAATTGTTA GGACAAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAA GAGCTCGCAAAGAAAGAGAGGCTGCTATGAAGTAAGAGTTGTGTAAATAA TCCATTCAAGTTGGACTTGTAACGCATGTCTTGTCATGTAAAGGTGTAGG CTTAGAATGTCTCAAAAGCCATCGAAACATTACAGTAAAGATATTTGAAA GTGGAAATCTTTCTAACTAAGACTTTAAGAGGGGGGAATCCATCTAAGAA TATTTATTATGTTTTAAAAACTTGACAAAGTTTGATTTTTTTAAACTATA ATTTGTTTTCTGGATATTTACAGTAATCATCGGTAGTTATATATCTGACT TTCAATTGAAAATTTTATAGACAAGAAGAAAGGCGCTCACCAACAAAACG AGAAATCAAAGATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAA AAAGGGCAGGTATGTACGAATATCATCATCAAATTTTTGGGAATTATTAG GGCGAGGAAATTCAAAATTAAAAAAAAGTCAACTGAGCCCCAATGTCTGA AAACTTCACTATGTGAAATAAGACAAGGCACGCAAATAACTGGTAGTCGA GATTACGTTCACGCATCATTTTCTTTGCACAAAAAACATACATTGTGTAT CTCATCTTTGCACTACATACAGTATATATCAATCGGCTCCCCAATCAGCC TTCAAATGAGTTGGCCCCACTTGTCTTAACTTTGTGTTTAACACACTCAT GGCTCTTATAATGTCGATGCACATTCGACAACACACTGTTTCCCTCGTTA TGTTTGCTCAATTTGATCTCTCGCTGACAATTCAAGCACTGGAAGTGTTT TATTCCATCCTCTGTCTCAGTGATTGAATAAATCTCTTTGTATCCATTTT TCTGCATCCATTTATCAAGTCTATGAACAATCATTTCTATCGTTTCTTCG GTTTGTTTCCTTCTCTTTGGAGTGGAGGCTGTGCCCGAGAGTTCTTTCCT CTTCCCTTTATTGACGTTGATTGCGTCAGCTCTTTTTCTAAGTAAGAGTT TCTCACATTCTTCTAAGAAAGTAGTAAATATCGTTTCATGGCCTGGCAAA ACTTGAACTTTCTCTGGACATTGTTCAAACATCCCAAACATCTTTTCTCT ATCGTCTACTTGGTCTATCATGTCCACCGCGAACTGAAACATTTCTCGTC TTTTATCTTTATCTCTTAATTCTAGAATGGCATTTAAATCGTTGAAACCG GCAAATTTCATTATCTCGAAAACATACTGTCCCCGTTCGGGTAATATTCG CCATAACTTTTCTGGAACAGCAATTTTGTTACATTTAGCTAACTTTTCAG TTTTGTTTGTCTTCTTTTCCACTGCGACTATATTCGATGGATTATTTTGC TCAACAATTATGATTTTCTTGTCTTCTAAAAAACTTGGACAATTCACTTG ATGTACGATTTCACCATTTGCGAGCTGAATAATTTCTCCACTTTGATTAT CATTGTGATTTTGTCTGTAAATTTCAAATGTCTCGTTATTTTGATATTCC ATCTTTTTGAAATCTTGGGAAAAAAATCTCAGTCAGAAGCCTTCTTTTTA GTTCTGTTCACTCAAGCCTTCTCTTACGATGTGAATGAAAAAAAAATCGA ATCAAATTTCGTTCTGTTTTTCTTTCTCTCTCTTATTTATTCATGATTCT CCTTTTGATTTATGATTTACTTTCTGATTCGTCTTTGAGTTGAATAATAA AGTTGAATTTAAGTTTTTTATAGAGATTTATGTACATGTTTTTTTATAAG AGCATTCTAAATTTTGAAGTTTTCGGAGGATGTTTTTAACTTTTTGAGTT TTCAGCCTAGAAATGTTTCATTAATATTAAAAATTATTATTTTCACCATT TTTGAGGATTTTTGTAAATTTTTGTCTCGTGTTTTATAGTCCGTTAAGCC TTAAAATGCTCTTAACTTGTTCTTGATATTTTGGCCATCGAAACGTTATG CTCTTAGATGCTTTGTTCTTATAAAAAACGTGTAAATTTACTTTAATATT TATTTCCCCCCTTTTTTTCTGATATACGCTGTTTATAAGAACCATTTTAA TCTTGCCCAGGAGCTGCTCTCATTTAGACCGTGCTTGTTTACAGCTTGAC AAAAGGCCCACCTGCGTCCGTGTACGTGTACACAGGAAGTGGGACATTTG ATACCAATGGTACACGTTTTTTTATATAAGAACATCCATAATTTTAAAGC CTTCGGATGTTCTTAAATGTTTGAGTTTAAGCCTAAAAATTTTTTAACGT GCTATTATTTTCGCTACTGAGTATTTTCGTACATTTTAAGAAATCAGTTG TTAGAATCTGCAAAGCCTTGAAATGTTCTTAACTTGCTCTTGATATTTTG GCCATCAAAGCTCTATGTTCTTATATAGTTTGCTACAAAAAAAACGTGTT TGCTGACTAAGCCCTCCAATATGTTCACTTTTCCTTACAGAACGTGAAAA ACTTCGTCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGC TCAACAAACAAAAGGTATCAAATGTCATATGGAACCTCACAACTGCCGAA AATTGAAGTTTTAGATGCATTTAATTTCTTTTATAAGAGCGATGAGGAAT TTCTGAATTTAGTAGAATTTCAGGGTTAAAATACTATAATCTGGTGAAGA GCCTAAAATACCTGAATTTTGTCTATAAATAAGAACATGATAAGAACAAT TTGAGCCTCAAGGTGCCAAAAAGTAAAAACCAACAAGATTCTACTGGTTC TTATAAAAAGAAGAGTGCAATGTTGAATAAAGTAGAATGTTCCACGAATT TCCATAATTTTAGGCTGTATGAAGAAATGATTCTGGTGAAAATCATCGTA TATTTTTAGGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAAC ACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAAC AGCCGAACAGAGTAAAGTTGACATAGTGTGTTGTATAAAACCATTGAACC ATTGGTTTATTGTTGGTAAAGAGCATGTTCTGTTTTTCTTGATAAGGATG ATTCTAGATCACCATTAAGGAGTTGAGTAGTGGAGAAAATCTCCAAAATG ATTTTTTACACTTTACCTGGCAGCCTGAAGGTGTCTAAGGCCAAAGGAGC TGCTGTGGTTGATTCTTTTGGCTTTAATGATTTCTGCTTGGAAATGAG

Coding sequence (CDS) from alignment at sc0000010:985935..1007832-

>TCONS_00001511 ID=TCONS_00001511|Name=TCONS_00001511|organism=Clytia hemisphaerica|type=CDS|length=48024bp|location=Sequence derived from alignment at sc0000010:985935..1007832- (Clytia hemisphaerica)
GAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACACGTGAAAA
AGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAGCCGAACA
GAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGCCCTCCAA
AACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGACAAGAAGA
AAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTTCTGGGTA
TGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAATATTTGAT
GGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAAAGAGAGG
CTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAAGAAAAAG
AAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTGCAAGTT
GACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTCCGTTGC
TGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCAAAAATTC
GAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAAGTGACGA
ACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGTTAGTTGA
GGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCAAACTCA
AAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAATTTTTGAA
ACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGCATCTGAA
TTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGAGAAACT
GGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATGAGGAAG
CCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAAGTACAG
AGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATGCAGCAAC
CATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAGAATACA
AAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGTAAAATGA
ACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAATGAATCAA
TTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAGAATGAT
CAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACATACTCGAA
ACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAACAGACAAA
ATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAGCCTTTCA
ATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAAAGTGGCT
TCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAAAATAACA
GGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCAAAATCTA
TGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAAGTTTCT
AAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTTGCCGAGT
TCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTGTACATT
TTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTACAGGGTA
GTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTGTCTGAT
AAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTTTATTGAA
GAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAACAAATAAA
GATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAAAAAATGT
ATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTTTGATGCT
ACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAACTAAAGA
CGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACACGTGAAA
AAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAGCCGAAC
AGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGCCCTCCA
AAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGACAAGAAG
AAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTTCTGGGT
ATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAATATTTGA
TGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAAAGAGAG
GCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAAGAAAAA
GAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTGCAAGT
TGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTCCGTTG
CTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCAAAAATT
CGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAAGTGACG
AACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGTTAGTTG
AGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCAAACTC
AAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAATTTTTGA
AACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGCATCTGA
ATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGAGAAAC
TGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATGAGGAA
GCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAAGTACA
GAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATGCAGCAA
CCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAGAATAC
AAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGTAAAATG
AACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAATGAATCA
ATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAGAATGA
TCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACATACTCGA
AACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAACAGACAA
AATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAGCCTTTC
AATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAAAGTGGC
TTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAAAATAAC
AGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCAAAATCT
ATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAAGTTTC
TAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTTGCCGAG
TTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTGTACAT
TTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTACAGGGT
AGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTGTCTGA
TAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTTTATTGA
AGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAACAAATAA
AGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAAAAAATG
TATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTTTGATGC
TACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAACTAAAG
ACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACACGTGAA
AAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAGCCGAA
CAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGCCCTCC
AAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGACAAGAA
GAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTTCTGGG
TATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAATATTTG
ATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAAAGAGA
GGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAAGAAAA
AGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTGCAAG
TTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTCCGTT
GCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCAAAAAT
TCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAAGTGAC
GAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGTTAGTT
GAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCAAACT
CAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAATTTTTG
AAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGCATCTG
AATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGAGAAA
CTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATGAGGA
AGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAAGTAC
AGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATGCAGCA
ACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAGAATA
CAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGTAAAAT
GAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAATGAATC
AATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAGAATG
ATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACATACTCG
AAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAACAGACA
AAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAGCCTTT
CAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAAAGTGG
CTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAAAATAA
CAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCAAAATC
TATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAAGTTT
CTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTTGCCGA
GTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTGTACA
TTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTACAGGG
TAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTGTCTG
ATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTTTATTG
AAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAACAAATA
AAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAAAAAAT
GTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTTTGATG
CTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAACTAAA
GACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACACGTGA
AAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAGCCGA
ACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGCCCTC
CAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGACAAGA
AGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTTCTGG
GTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAATATTT
GATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAAAGAG
AGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAAGAAA
AAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTGCAA
GTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTCCGT
TGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCAAAAA
TTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAAGTGA
CGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGTTAGT
TGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCAAAC
TCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAATTTTT
GAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGCATCT
GAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGAGAA
ACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATGAGG
AAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAAGTA
CAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATGCAGC
AACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAGAAT
ACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGTAAAA
TGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAATGAAT
CAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAGAAT
GATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACATACTC
GAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAACAGAC
AAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAGCCTT
TCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAAAGTG
GCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAAAATA
ACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCAAAAT
CTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAAGTT
TCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTTGCCG
AGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTGTAC
ATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTACAGG
GTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTGTCT
GATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTTTATT
GAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAACAAAT
AAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAAAAAA
TGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTTTGAT
GCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAACTAA
AGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACACGTG
AAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAGCCG
AACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGCCCT
CCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGACAAG
AAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTTCTG
GGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAATATT
TGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAAAGA
GAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAAGAA
AAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTGCA
AGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTCCG
TTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCAAAA
ATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAAGTG
ACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGTTAG
TTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCAAA
CTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAATTTT
TGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGCATC
TGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGAGA
AACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATGAG
GAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAAGT
ACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATGCAG
CAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAGAA
TACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGTAAA
ATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAATGAA
TCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAGAA
TGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACATACT
CGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAACAGA
CAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAGCCT
TTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAAAGT
GGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAAAAT
AACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCAAAA
TCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAAGT
TTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTTGCC
GAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTGTA
CATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTACAG
GGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTGTC
TGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTTTAT
TGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAACAAA
TAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAAAAA
ATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTTTGA
TGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAACTA
AAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACACGT
GAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAGCC
GAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGCCC
TCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGACAA
GAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTTCT
GGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAATAT
TTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAAAG
AGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAAGA
AAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTGC
AAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTCC
GTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCAAA
AATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAAGT
GACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGTTA
GTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCAA
ACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAATTT
TTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGCAT
CTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGAG
AAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATGA
GGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAAG
TACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATGCA
GCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAGA
ATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGTAA
AATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAATGA
ATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAGA
ATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACATAC
TCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAACAG
ACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAGCC
TTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAAAG
TGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAAAA
TAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCAAA
ATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAAG
TTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTTGC
CGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTGT
ACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTACA
GGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTGT
CTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTTTA
TTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAACAA
ATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAAAA
AATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTTTG
ATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAACT
AAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACACG
TGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAGC
CGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGCC
CTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGACA
AGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTTC
TGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAATA
TTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAAA
GAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAAG
AAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGTG
CAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGTC
CGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCAA
AAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAAG
TGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGTT
AGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTCA
AACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAATT
TTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGCA
TCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAGA
GAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTATG
AGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAAA
GTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATGC
AGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAAG
AATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGTA
AAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAATG
AATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAAG
AATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACATA
CTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAACA
GACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAGC
CTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAAA
GTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAAA
ATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCAA
AATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTAA
GTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTTG
CCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCTG
TACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTAC
AGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTTG
TCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTTT
ATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAACA
AATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAAA
AAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTTT
GATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAAC
TAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACAC
GTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACAG
CCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAGC
CCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGAC
AAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGTT
CTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAAT
ATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGAA
AGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCAA
GAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAGT
GCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATGT
CCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGCA
AAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACAA
GTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATGT
TAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGTC
AAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAAT
TTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATGC
ATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAAG
AGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTAT
GAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGAA
AGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAATG
CAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGAA
GAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAGT
AAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAAT
GAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAAA
GAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACAT
ACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAAC
AGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAAG
CCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGAA
AGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGAA
AATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGCA
AAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTTA
AGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTTT
GCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGCT
GTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTTA
CAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTTT
GTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATTT
TATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAAC
AAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGAA
AAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTTT
TGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAAA
CTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAACA
CGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAACA
GCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCAG
CCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAGA
CAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAGT
TCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCAA
TATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAGA
AAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTCA
AGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAAG
TGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAATG
TCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTGC
AAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAACA
AGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAATG
TTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAGT
CAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGAA
TTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGATG
CATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGAA
GAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTTA
TGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAGA
AAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAAT
GCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAGA
AGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCAG
TAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCAA
TGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGAA
AGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCACA
TACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAAA
CAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCAA
GCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAGA
AAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAGA
AAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTGC
AAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTTT
AAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGTT
TGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTGC
TGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACTT
ACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGTT
TGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGATT
TTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAAA
CAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAGA
AAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGTT
TTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACAA
ACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAAC
ACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAAC
AGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATCA
GCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAAG
ACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAAG
TTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACCA
ATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAAG
AAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTTC
AAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAAA
GTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAAT
GTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATTG
CAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAAC
AAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAAT
GTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAAG
TCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACGA
ATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGAT
GCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGGA
AGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGTT
ATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAAG
AAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGAA
TGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAAG
AAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCCA
GTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATCA
ATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAGA
AAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCAC
ATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGAA
ACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTCA
AGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGAG
AAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGAG
AAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGTG
CAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTTT
TAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTGT
TTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGTG
CTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGACT
TACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATGT
TTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGAT
TTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAAA
ACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATAG
AAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATGT
TTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTACA
AACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAAA
CACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCAA
CAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAATC
AGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAAA
GACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAAA
GTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAACC
AATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAAA
GAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGTT
CAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATAA
AGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAAA
TGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGATT
GCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGAA
CAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGAA
TGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAAA
GTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGACG
AATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAGA
TGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTGG
AAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAGT
TATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAAA
GAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTGA
ATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGAA
GAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTCC
AGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCATC
AATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAAG
AAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACCA
CATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAGA
AACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGTC
AAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAGA
GAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAGA
GAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGGT
GCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGTT
TTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTTG
TTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGGT
GCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGAC
TTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACATG
TTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATGA
TTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTAA
AACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATATA
GAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAATG
TTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTAC
AAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAAA
ACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTCA
ACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAAT
CAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAAA
AGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCAA
AGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAAC
CAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCAA
AGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAGT
TCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAATA
AAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGAA
ATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGAT
TGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTGA
ACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAGA
ATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGAA
AGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGAC
GAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGAG
ATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTTG
GAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGAG
TTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGAA
AGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTTG
AATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGGA
AGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATTC
CAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCAT
CAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAAA
GAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGACC
ACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATAG
AAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAGT
CAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCAG
AGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACAG
AGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTGG
TGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTGT
TTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGTT
GTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTGG
TGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAGA
CTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACAT
GTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAATG
ATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCTA
AAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATAT
AGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAAT
GTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCTA
CAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGAA
AACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGTC
AACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAAA
TCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACAA
AAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCCA
AAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGAA
CCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGCA
AAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAAG
TTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAAT
AAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAGA
AATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTGA
TTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATTG
AACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGAG
AATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCGA
AAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGGA
CGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCGA
GATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACTT
GGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTGA
GTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCGA
AAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTTT
GAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAGG
AAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAATT
CCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGCA
TCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAAA
AGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGAC
CACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGATA
GAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAAG
TCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCCA
GAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGACA
GAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGTG
GTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCTG
TTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGGT
TGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTTG
GTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAAG
ACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGACA
TGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAAT
GATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTCT
AAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGATA
TAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGAA
TGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACCT
ACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAGA
AAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAGT
CAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCAA
ATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAACA
AAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCCC
AAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAGA
ACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCGC
AAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAAA
GTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAAA
TAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGAG
AAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATTG
ATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAATT
GAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAGA
GAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGCG
AAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATGG
ACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTCG
AGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGACT
TGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATTG
AGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATCG
AAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGTT
TGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGAG
GAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAAT
TCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATGC
ATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACAA
AAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAGA
CCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGAT
AGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAAA
GTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTCC
AGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGAC
AGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAGT
GGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCCT
GTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATGG
TTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCTT
GGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCAA
GACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGAC
ATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACAA
TGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATTC
TAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGAT
ATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGGA
ATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATACC
TACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGAG
AAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACAG
TCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTCA
AATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAAC
AAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATCC
CAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAAG
AACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTCG
CAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGAA
AGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAAA
ATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGGA
GAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCATT
GATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAAT
TGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAAG
AGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAGC
GAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGATG
GACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGTC
GAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGAC
TTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAATT
GAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAATC
GAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCGT
TTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAGA
GGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCAA
TTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGATG
CATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGACA
AAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGAG
ACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATGA
TAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCAA
AGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATTC
CAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAGA
CAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACAG
TGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGCC
TGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACATG
GTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACCT
TGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCCA
AGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAGA
CATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAACA
ATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAATT
CTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGGA
TATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTGG
AATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATAC
CTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTGA
GAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAACA
GTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGTC
AAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAAA
CAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGATC
CCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACAA
GAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCTC
GCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTGA
AAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCAA
AATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTGG
AGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCAT
TGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAAA
TTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGAA
GAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAAG
CGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGAT
GGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGGT
CGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGGA
CTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAAT
TGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAAT
CGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCCG
TTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAAG
AGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTCA
ATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGAT
GCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGAC
AAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAGA
GACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAATG
ATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACCA
AAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAATT
CCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAAG
ACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTACA
GTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCGC
CTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACAT
GGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGACC
TTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGCC
AAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAAG
ACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAAC
AATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAAT
TCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAGG
ATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCTG
GAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAATA
CCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTTG
AGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAAC
AGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCGT
CAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACAA
ACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGAT
CCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGACA
AGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGCT
CGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTTG
AAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTCA
AAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTTG
GAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGCA
TTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCAA
ATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGGA
AGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGAA
GCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATGA
TGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTGG
TCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAGG
ACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCAA
TTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAAA
TCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATCC
GTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAAA
GAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATTC
AATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAGA
TGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAGA
CAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCAG
AGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAAT
GATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGACC
AAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAAT
TCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAAA
GACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTAC
AGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTCG
CCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGACA
TGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGAC
CTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATGC
CAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGAA
GACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCAA
CAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCAA
TTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCAG
GATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGCT
GGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAAT
ACCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACTT
GAGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAAA
CAGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTCG
TCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAACA
AACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAGA
TCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGAC
AAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAGC
TCGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTTT
GAAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATTC
AAAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCTT
GGAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTGC
ATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGCA
AATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTGG
AAGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAGA
AGCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAATG
ATGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGTG
GTCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAAG
GACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTCA
ATTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAAA
ATCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCATC
CGTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGAA
AGAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAATT
CAATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATAG
ATGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAAG
ACAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACCA
GAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAAA
TGATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGAC
CAAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCAA
TTCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTAA
AGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCTA
CAGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCTC
GCCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGAC
ATGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATGA
CCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACATG
CCAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGGA
AGACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGCA
ACAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTCA
ATTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGCA
GGATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTGC
TGGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGAA
TACCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAACT
TGAGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACAA
ACAGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTTC
GTCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAAC
AAACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAAG
ATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGGA
CAAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGAG
CTCGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATTT
TGAAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTATT
CAAAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCCT
TGGAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATTG
CATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATGC
AAATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTTG
GAAGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAAG
AAGCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAAT
GATGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGGT
GGTCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAAA
GGACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGTC
AATTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGAA
AATCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCAT
CCGTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAGA
AAGAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAAT
TCAATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAATA
GATGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAAA
GACAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTACC
AGAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCAA
ATGATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCGA
CCAAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCCA
ATTCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTTA
AAGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCCT
ACAGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTCT
CGCCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAGA
CATGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGATG
ACCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACAT
GCCAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTGG
AAGACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAGC
AACAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATTC
AATTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTGC
AGGATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGTG
CTGGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGGA
ATACCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAAC
TTGAGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCACA
AACAGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACTT
CGTCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCAA
CAAACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAAA
GATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAGG
ACAAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAGA
GCTCGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTATT
TTGAAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTAT
TCAAAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTCC
TTGGAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGATT
GCATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGATG
CAAATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGTT
GGAAGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAAA
GAAGCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAAA
TGATGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAGG
TGGTCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGAA
AGGACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGGT
CAATTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATGA
AAATCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCCA
TCCGTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAAG
AAAGAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAAA
TTCAATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAAT
AGATGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCAA
AGACAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTAC
CAGAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGCA
AATGATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATCG
ACCAAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTCC
AATTCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCTT
AAAGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCCC
TACAGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACTC
TCGCCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAAG
ACATGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGAT
GACCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAACA
TGCCAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTTG
GAAGACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAAG
CAACAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGATT
CAATTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACTG
CAGGATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATGT
GCTGGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAGG
AATACCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGAA
CTTGAGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCAC
AAACAGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAACT
TCGTCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTCA
ACAAACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCAA
AGATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCAG
GACAAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAAG
AGCTCGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTAT
TTTGAAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATTA
TTCAAAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCTC
CTTGGAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGAT
TGCATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGAT
GCAAATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCGT
TGGAAGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAAA
AGAAGCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGAA
ATGATGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGAG
GTGGTCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAGA
AAGGACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTGG
TCAATTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGATG
AAAATCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCCC
ATCCGTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAAA
GAAAGAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGAA
ATTCAATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTAA
TAGATGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGCA
AAGACAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGTA
CCAGAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAGC
AAATGATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCATC
GACCAAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTTC
CAATTCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATCT
TAAAGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCCC
CTACAGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATACT
CTCGCCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGAA
GACATGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGGA
TGACCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAAC
ATGCCAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGTT
GGAAGACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAAA
GCAACAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGAT
TCAATTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAACT
GCAGGATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGATG
TGCTGGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGAG
GAATACCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGGA
ACTTGAGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCCA
CAAACAGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAAC
TTCGTCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCTC
AACAAACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATCA
AAGATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGCA
GGACAAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGAA
GAGCTCGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGTA
TTTTGAAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAATT
ATTCAAAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTCT
CCTTGGAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAGA
TTGCATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAGA
TGCAAATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGCG
TTGGAAGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCAA
AAGAAGCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAGA
AATGATGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATGA
GGTGGTCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAAG
AAAGGACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCTG
GTCAATTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGAT
GAAAATCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCCC
CATCCGTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAAA
AGAAAGAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTGA
AATTCAATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACTA
ATAGATGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAGC
AAAGACAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAGT
ACCAGAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACAG
CAAATGATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCAT
CGACCAAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGTT
CCAATTCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCATC
TTAAAGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATCC
CCTACAGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATAC
TCTCGCCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTGA
AGACATGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTGG
ATGACCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAAA
CATGCCAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGGT
TGGAAGACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCAA
AGCAACAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATGA
TTCAATTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAAC
TGCAGGATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGAT
GTGCTGGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTGA
GGAATACCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAGG
AACTTGAGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGCC
ACAAACAGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAAA
CTTCGTCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGCT
CAACAAACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAATC
AAAGATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGGC
AGGACAAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACGA
AGAGCTCGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGGT
ATTTTGAAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAAT
TATTCAAAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGTC
TCCTTGGAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAAG
ATTGCATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCAG
ATGCAAATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAGC
GTTGGAAGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGCA
AAAGAAGCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGAG
AAATGATGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACATG
AGGTGGTCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGAA
GAAAGGACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTCT
GGTCAATTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTGA
TGAAAATCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATCC
CCATCCGTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACAA
AAGAAAGAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATTG
AAATTCAATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAACT
AATAGATGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCAG
CAAAGACAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAAG
TACCAGAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAACA
GCAAATGATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGCA
TCGACCAAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTGT
TCCAATTCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCAT
CTTAAAGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTATC
CCCTACAGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATATA
CTCTCGCCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTTG
AAGACATGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCTG
GATGACCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAAA
ACATGCCAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAGG
TTGGAAGACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTCA
AAGCAACAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATATG
ATTCAATTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAAA
CTGCAGGATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTGA
TGTGCTGGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATTG
AGGAATACCTACAAACTAAAGACGAAAAACTGGAAGAGATGCGTTGGAAG
GAACTTGAGAAAACACGTGAAAAAGCAGCGCGCCTTCATGCTAAATCCGC
CACAAACAGTCAACAGCCGAACAGAGTAAAGTTGACATAGAACGTGAAAA
ACTTCGTCAAATCAGCCCTCCAAAACCAACAAGAAGCAAGCACATTCAGC
TCAACAAACAAAAGACAAGAAGAAAGGCGCTCACCAACAAAACGAGAAAT
CAAAGATCCCAAAGTTCTGGGTATGCAAGAACGATTGTCTGCAAAAAGGG
CAGGACAAGAACCAATATTTGATGGATACTCTTGAATCGATAGCACAACG
AAGAGCTCGCAAAGAAAGAGAGGCTGCTATGAATTACGAGAACGTTTGGG
TATTTTGAAAGTTCAAGAAAAAGAAGATGAAGAAAAGAAGAGACAAGAAA
TTATTCAAAATAAAGTGCAAGTTGACCTGACGGAGAGCTCTGGTATCGGT
CTCCTTGGAGAAATGTCCGTTGCTGAGGCTGAGATTGAAATGAGGGAGAA
GATTGCATTGATTGCAAAAATTCGAGCCATCGAAAGTGTACCACGTATCA
GATGCAAATTGAACAAGTGACGAACGAAAGTAAAGCACTCATGAGAAAAG
CGTTGGAAGAGAATGTTAGTTGAGGATATCATGGAAGGTCACGAGAATGC
AAAAGAAGCGAAAGTCAAACTCAAAAAGTACAAACAAAGCATAGACTAGA
GAAATGATGGACGAATTTTTGAAACAGAAATTTCAAAAGCAACAAGACAT
GAGGTGGTCGAGATGCATCTGAATTTTTGTCATGGCAACAAGATATGAGA
AGAAAGGACTTGGAAGAGAAACTGGCAGAGATTGAAGCAAACAGAATTTC
TGGTCAATTGAGTTATGAGGAAGCCATTCTTGCCAGACAATCACTGGTTG
ATGAAAATCGAAAGAAAGTACAGAGTATTAAAAAAGAGGATGACAACATC
CCCATCCGTTTGAATGCAGCAACCATCATGCGTGAAGGAGTTCTGATACA
AAAGAAAGAGGAAGAAGAATACAAAAAGCTAGCTGATCTAGCGCAAGATT
GAAATTCAATTCCAGTAAAATGAACCCTCTCCCAGCCAACAATAGGCAAC
TAATAGATGCATCAATGAATCAATTCTCTTGTGCAACAACCGAAAAATCA
GCAAAGACAAAAGAAAGAATGATCAAATATATGAAAGAAGAAGATTCAAA
GTACCAGAGACCACATACTCGAAACCAAAAGAGATTGATTCTCTGGCAAC
AGCAAATGATAGAAACAGACAAAATGCCGAGATACCTACTATAAAGAAGC
ATCGACCAAAGTCAAGCCTTTCAATTTAACTAAAGTCAAACCAAGGAGTG
TTCCAATTCCAGAGAAAGTGGCTTCCAGAGATACACGAGTTTTTAGCTCA
TCTTAAAGACAGAGAAAATAACAGGCAGAAAGCCAAACGGGATGTACTAT
CCCCTACAGTGGTGCAAAATCTATGACCACAGTTATGTGCAAATCAATAT
ACTCTCGCCTGTTTTAAGTTTCTAAATTATCTGTTTGACGAGACAAAGTT
GAAGACATGGTTGTTTGCCGAGTTCTCTGTTACATCAGCCTGTTTTGTCT
GGATGACCTTGGTGCTGTACATTTTCGAAAAATTGTTATTGCCCAACAAA
AACATGCCAAGACTTACAGGGTAGTGGTAGATGCGTATTTCAAAAGTGAG
GTTGGAAGACATGTTTGTCTGATAAGTGACACTAATTTTTATAAAGGCTC
AAAGCAACAATGATTTTATTGAAGAGATATTTCTAGGTTGCAATCGATAT
GATTCAATTCTAAAACAAATAAAGATTATTAAACAATTATTAAATATCAA
ACTGCAGGATATAGAAAAAATGTATAAGAAATTGCTAGAAACAATAATTG
ATGTGCTGGAATGTTTTGATGCTACAGTTGACGAACCACAAGCTTTCATT
GAGGAATACCTACAAACTAAAGAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000770XLOC_000770Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001511-exon-sc0000010-1575043694:1007673..1007832TCONS_00001511-exon-sc0000010-1575043694:1007673..1007832Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1006984..1007052TCONS_00001511-exon-sc0000010-1575043694:1006984..1007052Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1006712..1006787TCONS_00001511-exon-sc0000010-1575043694:1006712..1006787Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1006408..1006505TCONS_00001511-exon-sc0000010-1575043694:1006408..1006505Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1005925..1005978TCONS_00001511-exon-sc0000010-1575043694:1005925..1005978Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1005691..1005749TCONS_00001511-exon-sc0000010-1575043694:1005691..1005749Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1005313..1005404TCONS_00001511-exon-sc0000010-1575043694:1005313..1005404Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1005124..1005182TCONS_00001511-exon-sc0000010-1575043694:1005124..1005182Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1004776..1004802TCONS_00001511-exon-sc0000010-1575043694:1004776..1004802Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1004244..1004324TCONS_00001511-exon-sc0000010-1575043694:1004244..1004324Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:1003894..1004000TCONS_00001511-exon-sc0000010-1575043694:1003894..1004000Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:998362..998407TCONS_00001511-exon-sc0000010-1575043694:998362..998407Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:997806..997914TCONS_00001511-exon-sc0000010-1575043694:997806..997914Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:992013..992197TCONS_00001511-exon-sc0000010-1575043694:992013..992197Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:991754..991812TCONS_00001511-exon-sc0000010-1575043694:991754..991812Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:991499..991581TCONS_00001511-exon-sc0000010-1575043694:991499..991581Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:991064..991116TCONS_00001511-exon-sc0000010-1575043694:991064..991116Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:990581..990661TCONS_00001511-exon-sc0000010-1575043694:990581..990661Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:989914..989973TCONS_00001511-exon-sc0000010-1575043694:989914..989973Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:989642..989725TCONS_00001511-exon-sc0000010-1575043694:989642..989725Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:989102..989181TCONS_00001511-exon-sc0000010-1575043694:989102..989181Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:988724..988812TCONS_00001511-exon-sc0000010-1575043694:988724..988812Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:986619..986692TCONS_00001511-exon-sc0000010-1575043694:986619..986692Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1575043694:985935..986273TCONS_00001511-exon-sc0000010-1575043694:985935..986273Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1007673..1007832TCONS_00001511-exon-sc0000010-1510915933:1007673..1007832Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1006984..1007052TCONS_00001511-exon-sc0000010-1510915933:1006984..1007052Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1006712..1006787TCONS_00001511-exon-sc0000010-1510915933:1006712..1006787Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1006408..1006505TCONS_00001511-exon-sc0000010-1510915933:1006408..1006505Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1005925..1005978TCONS_00001511-exon-sc0000010-1510915933:1005925..1005978Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1005691..1005749TCONS_00001511-exon-sc0000010-1510915933:1005691..1005749Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1005313..1005404TCONS_00001511-exon-sc0000010-1510915933:1005313..1005404Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1005124..1005182TCONS_00001511-exon-sc0000010-1510915933:1005124..1005182Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1004776..1004802TCONS_00001511-exon-sc0000010-1510915933:1004776..1004802Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1004244..1004324TCONS_00001511-exon-sc0000010-1510915933:1004244..1004324Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:1003894..1004000TCONS_00001511-exon-sc0000010-1510915933:1003894..1004000Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:998362..998407TCONS_00001511-exon-sc0000010-1510915933:998362..998407Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:997806..997914TCONS_00001511-exon-sc0000010-1510915933:997806..997914Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:992013..992197TCONS_00001511-exon-sc0000010-1510915933:992013..992197Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:991754..991812TCONS_00001511-exon-sc0000010-1510915933:991754..991812Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:991499..991581TCONS_00001511-exon-sc0000010-1510915933:991499..991581Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:991064..991116TCONS_00001511-exon-sc0000010-1510915933:991064..991116Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:990581..990661TCONS_00001511-exon-sc0000010-1510915933:990581..990661Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:989914..989973TCONS_00001511-exon-sc0000010-1510915933:989914..989973Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:989642..989725TCONS_00001511-exon-sc0000010-1510915933:989642..989725Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:989102..989181TCONS_00001511-exon-sc0000010-1510915933:989102..989181Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:988724..988812TCONS_00001511-exon-sc0000010-1510915933:988724..988812Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:986619..986692TCONS_00001511-exon-sc0000010-1510915933:986619..986692Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1510915933:985935..986273TCONS_00001511-exon-sc0000010-1510915933:985935..986273Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1007673..1007832TCONS_00001511-exon-sc0000010-1491911889:1007673..1007832Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1006984..1007052TCONS_00001511-exon-sc0000010-1491911889:1006984..1007052Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1006712..1006787TCONS_00001511-exon-sc0000010-1491911889:1006712..1006787Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1006408..1006505TCONS_00001511-exon-sc0000010-1491911889:1006408..1006505Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1005925..1005978TCONS_00001511-exon-sc0000010-1491911889:1005925..1005978Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1005691..1005749TCONS_00001511-exon-sc0000010-1491911889:1005691..1005749Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1005313..1005404TCONS_00001511-exon-sc0000010-1491911889:1005313..1005404Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1005124..1005182TCONS_00001511-exon-sc0000010-1491911889:1005124..1005182Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1004776..1004802TCONS_00001511-exon-sc0000010-1491911889:1004776..1004802Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1004244..1004324TCONS_00001511-exon-sc0000010-1491911889:1004244..1004324Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:1003894..1004000TCONS_00001511-exon-sc0000010-1491911889:1003894..1004000Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:998362..998407TCONS_00001511-exon-sc0000010-1491911889:998362..998407Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:997806..997914TCONS_00001511-exon-sc0000010-1491911889:997806..997914Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:992013..992197TCONS_00001511-exon-sc0000010-1491911889:992013..992197Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:991754..991812TCONS_00001511-exon-sc0000010-1491911889:991754..991812Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:991499..991581TCONS_00001511-exon-sc0000010-1491911889:991499..991581Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:991064..991116TCONS_00001511-exon-sc0000010-1491911889:991064..991116Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:990581..990661TCONS_00001511-exon-sc0000010-1491911889:990581..990661Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:989914..989973TCONS_00001511-exon-sc0000010-1491911889:989914..989973Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:989642..989725TCONS_00001511-exon-sc0000010-1491911889:989642..989725Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:989102..989181TCONS_00001511-exon-sc0000010-1491911889:989102..989181Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:988724..988812TCONS_00001511-exon-sc0000010-1491911889:988724..988812Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:986619..986692TCONS_00001511-exon-sc0000010-1491911889:986619..986692Clytia hemisphaericaexon
TCONS_00001511-exon-sc0000010-1491911889:985935..986273TCONS_00001511-exon-sc0000010-1491911889:985935..986273Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001511-proteinTCONS_00001511-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:985935..1007832 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
11.9726 11.143 11.5027 12.6969 57.5549 44.9366 30.1742 32.5507 22.7302 26.7583 24.4738 20.1453 6.10078 6.08034 6.28857 5.95465 7.03164 7.20721 6.28872 8.4609 8.18819 9.59038 7.9943 8.53437 41.6259 34.7713 10.671 8.5026 5.54998 4.75859
Blast
BLAST of TCONS_00001511 vs. Swiss-Prot (Human)
Match: CFA99 (Cilia- and flagella-associated protein 99 OS=Homo sapiens GN=CFAP99 PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 4.465e-45
Identity = 106/250 (42.40%), Postives = 169/250 (67.60%), Query Frame = 2
Query:  932 DNIPIRLNAATIMREGVLIQKKEEEEYKKLADLAQGGRDASEFLSWQQDMRRKDLEEKLAEIEANRISGQLSYEEAILARQSLVDENRKKVQSIKKETREMMDEFLKQKFQKQQDMRMLVEDIMEGHENAXXXXXXXXXXXQSIVEQVTNESKALMRKALEEAEIEMREKIALIAKIRAIESVPRIRCKQVDLTESSGIGLLGEMSVAELRERLGILKVXXXXXXXXXXXXXXXNKVDKNQYLMDTLESI 1681
            DNI ++LN   I+REG L Q++ E+E +++  L  G  D SEF  WQ+ M+ KD EE+LA  E  R+ G+LS+EEA+LARQSL+ EN+++V+  K++  ++M +  +++ ++ +  + LVE ++EG +NAK A+ KL K +Q  V++   ES+ L+++  + A+ E R +  LI+++RA+E+ P  + K VDLT+  G GL GEMS+ ELRERL +LK  ++  EE+KR +IIQ K  K+Q L + +E I
Sbjct:   36 DNILVKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQAKDREEQLAASECRRLQGKLSHEEAVLARQSLMQENKQRVEQQKEQMAKLMLQRAERRLREDRSRKELVEQVIEGQKNAKAAQTKLAKGRQQTVQEAIEESRGLLQRRAQAAQEEQRRRCELISQLRALETQPTRKGKLVDLTQIPGYGLEGEMSIVELRERLALLKENQRRKEEEKRDQIIQGKHTKSQELQNMVEQI 285          
The following BLAST results are available for this feature:
BLAST of TCONS_00001511 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CFA994.465e-4542.40Cilia- and flagella-associated protein 99 OS=Homo ... [more]
back to top