TCONS_00001425 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001425
Unique NameTCONS_00001425
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length11913

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001425 ID=TCONS_00001425|Name=TCONS_00001425|organism=Clytia hemisphaerica|type=transcript|length=11913bp
TAGACGGTTTTAtaataaaagatgaaaaataattaatgTGATGATTATTT
GGAGTAATGATGGATGAAAATAGCTCCCAAGATCTTTATGAACGATCAGA
CACCCAAAAGAAGACCTTCACCAGATGGATcaatcatattttgaaaaaaa
aCGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGT
GCTGTTTTATTGGCACTATTGGAATCAACAACAggaaaaaaaatcAAACA
AGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCAT
TGCAAGTATTCCAAGGGTATGATACAAAGCTGGTTAATATAAGAAGCGAG
GAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCAT
CATCCTACAGTTCCAGGTGAAAACGGTGATCCAACAAACACTCCATGCCA
CAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCAC
TCTGTTCACAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATG
GAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAACCCAACT
CTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCA
CATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGA
GCCTGAAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGT
ATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAA
TCGGATGGATCTGAGCTGGATCagGCTAATCGATCAGATAGCCCGACTCC
GTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAA
CGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAG
GAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACA
TGAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCG
TATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGG
GAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGA
AAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAatTACATCAACAAC
TGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACA
ACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGA
AAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGATGATTTGG
AGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTT
GACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGC
TTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGAT
GGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAA
GAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGA
TATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGcaaaaacaaatac
aaaaattaaagGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTT
GGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGA
GTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGA
GATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATTTCCGA
AGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATAT
AGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAG
ATCGCGAACTAGTCGAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGAT
TCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAA
AAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTC
AAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTT
GTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAAT
CTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGtcattg
atttgaaaaataacccaaCAGAATTGCTAACCATACTCGAGGCAAAACAA
AGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAG
CAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGA
ATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAA
CACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTT
GGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTG
TCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCA
GACGACTTGAAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGTCCACT
ATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAG
AAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGT
GCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGC
TATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACT
GGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCA
GAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGCATT
GCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAA
CATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTA
CGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAG
TACtgaaaaacagaaagaaaatctTCGAAATGCGGGTGAAAAGTTCCAAC
AAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGAC
AGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACgctttt
aagcaaaaagcaAGATTATCAGACATACATTACACGACTTGAAGAGCATG
ATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACC
ACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTat
tgaaatcgaaaaaacacgaaaaactATAACCACTTTGAGAGGACGAATCG
AAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTG
AAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGA
GATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAA
AAGAATGTTTATCGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGC
GTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGT
TTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGG
AAGGCATCAGAGAAGGCTGtaaaaagGTTCAACTGATGTTTGAGGGAGAA
ATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATG
GGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCG
ACCTCGAGGATGACTACATCGAGGGTCTAGAAGAGAGTATCTCACTAAAC
GAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGC
CAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTG
AAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAA
GAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATAT
TGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAG
TCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGAGCTTGCAAAACAG
TGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAA
AGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAG
TTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAG
gtttttgcgGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGA
CACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTAT
CCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAG
AGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGT
CAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTG
CCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTG
ACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTT
AGATGAATACGAGAAAAAGGTTGACGATTTGAACACGTGGATCGATGGCC
GAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATT
GAAATGGAAACACAAAAATTCGAGaGCTTGAAATCCATGGTAAATGCAAA
GGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAA
AGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGT
TGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATgcttaaatt
gaaattgaagGAGTTTgatgacaaagaaaaagaacaagaaaTCATGAGAT
TGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGGTCATTCTAACA
CAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGA
CCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGA
TTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTT
TCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGA
AGAGAAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCG
AATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAA
TTCAAAACTACAGAAGAAAATGCACAGAAACTGGAAGACCAACTCAACTC
GTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCA
AACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGT
CGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAG
GAACGCAGATTccagatatttcaaaatgaagaatGACTTAACAAACGTAC
AAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGAT
CCTAATAAAATGAAGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGA
AATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCG
ATTCTCTCATCCCCAAACGACAAATCTCAttattgaacaaaaaattcaaa
ttggtTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAAC
CACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGC
GGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAG
CTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACA
GGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTtggaaaactttcca
aattACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTA
GCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGT
CTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCC
CTGTTGGTGCTATGGCCCTTTATAAAGAAACTGCTCCAGATATCTTGGCC
CGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATT
GACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATA
TTCAAGATGTGATCagagaaattgaagaaattcaTGCCGTTTTCAATGAC
GAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACT
TTTAAAAgAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGT
CACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAA
ATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGC
GCTGGATAAAGAGTTTCGTCACAGATACGTATCGGTGGAGAAGAACGTCG
GTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTA
ACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAA
GGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCA
ATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAG
CTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAG
TGGATTGAATAGCAGGAAGTTGGGATCCCTAATGGATGACCCAAAGATCA
AAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATC
TTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACT
ACAAAAATACAGGGATGACCTCAAGAAATGTGAAAATGATTTGACCGATA
GAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAA
CGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGAC
TTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAGCAAACGAT
TTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAA
CTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGG
CCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGATCATGAAGA
AATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTG
AAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGC
CGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATAC
GTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTC
GCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTT
ACAAACCAGTTTATCTTTCACAACGACTGAAACttcaaaatacaaatatg
aaaTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACG
GCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCT
GAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAAC
AAAACTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGAC
GCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAA
GTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGT
CACTTATTAACCAAGCTCTGGTTGATTGGCGTCGTTACAACGAGTTGCGT
TTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAA
CCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAAC
ACAAGaAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACT
TTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTT
GAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCT
TGGAAACTCGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGAT
CGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATC
TTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGC
AAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGGAA
CTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGA
AACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAG
CTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGT
GTTCGAGTCGTCGATATCAGGGATAGAATGTCATATGGTACTGGTGAATG
GCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAG
CTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAA
GTACAACAACAGAATAAACACCATCagGAATTCAAAGGCAAGCTGAACGC
GCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTT
TGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAA
TTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACA
GTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTA
TCAGCCTTGTATTAGAgCTGGTGAACAATCTGTTGGAGGACATCGAAAAG
ATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACT
CACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAA
GGAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATG
GATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAA
ACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGT
TGAATGATTGCCAGATTCGACAGGagaatttgcaaaatttgatgTCTGGT
TCGGATGCAGGATCAGTTATGTTACAagAAAGCGTACCGACACCATGGGA
ACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAATCATACCACAA
AAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTA
TCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATT
GAGATGTCTGCAAAAGGCTTGTTGTCTTGACTTGTGTGAATTGAACTTAA
ACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAAC
TTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAG
TATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATA
TGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAA
TTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAA
ACTAGAAGATAAATGGAAATATTTATTCCGTCAAATTTCGGATAACACCG
GCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAG
ATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGA
ACCTAGCGTCAGGAGCTGCTTCGAAATGGCTAAAAACAACTCAGCGATCG
ATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTC
TGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGA
CGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATC
gctgtttgaaatgttttaacTTTGATCTTTGTCAGACTTGCTTCTGGTCT
GGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAG
CTTAGCGACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGA
GAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTT
GGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACGCC
AACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCAA
TGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAAC
GATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCA
ATCATTAAACGGTGAAATCACAAACAATAACACAACGCCGAAAAGTCCGT
CACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAA
ATGATTCGAGGTCTTGAAGAGGAACACCAATCTCTAATGGAAGAATACAC
CCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCG
TTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTA
CGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCA
TAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAAC
AGCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCA
CCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCA
CGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTG
CGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACA
TCAAGTTATGAGGATTAACGGAGGAATGGAAATTTTGTTCTATTAGTGTA
TTGTTCTGCTTTTTCTCTTGTGTTAGTAGTGTTTATATGAAAGATTGAAT
CTTTTAGAATTAGCGCTTTATTGTTAATACACAAAGAAATAATGTCATTT
TTCTATCTACCCATTTTCAGAATCAGAAATAAAGTTCTAGGAACACCGGA
CGGTTTTTAGATCCCTGGAGGACCTAAAGAAAATATCCGAAACCTTTTCT
GCTACTGAAGGTTTGGTTTTTGTAAAATAGAATACCAGTCTGGACAATTA
GGTTGATAGATACatgaaattatttattttgaaatttaaaagaaatattt
atagcttatatatatttttatattgtaCCTTGTccatataataatttttt
ttgtcttttctgTTGTCTTTCCTTGTCCTCCCTGAATTCTATGTTGTGTT
TTTGTTTGCCTCCAGAAAAAACGAGGTCGCTTTATTTTCGCGTATTATTT
TGCTTTTtgtaaataagttttttttgttttgtcttatattttttgacaga
aaatcttttttatggaTAGAAATAATTTTATACAATTGAAAATACCTTTG
CGTTCATTATCAT

protein sequence of TCONS_00001425-protein

>TCONS_00001425-protein ID=TCONS_00001425-protein|Name=TCONS_00001425-protein|organism=Clytia hemisphaerica|type=polypeptide|length=3753bp
MMDENSSQDLYERSDTQKKTFTRWINHILKKNGKNIVVRDLTFDLQDGAV
LLALLESTTGKKIKQENGRMRVHKISNVNRALQVFQGYDTKLVNIRSEEI
VDGNIKLILGLVWSIILQFQVKTVIQQTLHATDSTMEVEKTLLQWCAHSV
HRYKDVEIKNFTSSWRDGLAFNAILHHFKPNSFDFQKLVGKPASENLAHA
FAKAQSEFNIPPLLEPEDVNTDHPDKKSIIMYVTTLFETLGKTKEGAESD
GSELDQANRSDSPTPSSVSTMSEWDDYNETLTQVLTWLMQAETQLKQQEP
VSENVDKVKEQFREHEEFMMILTSHQASVGSVLEFGSQLINENIVVGREE
REIREQMSVLSERWENLRVSAMQRQSELHQQLMKLQQLQLQELANWLTTA
ENIIETTGPIGSDLESVKIQVDAHKTFQDDLENQQIHVNSLSHMVVVVDE
SESENATADLEEQLALLGERWSAVCKWTGNRWETLQEVLKSWEQYRNQEQ
RLNDWLYEKEKGLKDISLFDMGDKEEVQKQIQKLKDLENELTQQQNSFGD
FNNAAQGVAQMLDEESPAIQNIQVTMEDFNKRWNTIASMLNAKMKHFRSI
ENNLTALLKEIDDNIEWITDTELLLKPSSPPDRELVESLDQAIKKRRDSI
IVLTEQGETLMTESKNAGQSVVGLEQQLNNFQERWSQLSRTVAEKRDLVE
DNEKKKVFVEQVQKILLVITEITTYIEVIVIDLKNNPTELLTILEAKQSE
VSQHKAALANLLSKSNEIKDPATQAAFQSEVNAVSVKLSATESTIGDKHR
QTNDRINSTPPQEFLDKMTSIKDIVNNIFPCVSKEFKYDQIKSMQTLADD
LKGMVKNLQEQEGPLSLLNKQSKLLMETLSPENAEKCQKDVSELERQRAD
CKKITEARLKRVSEAILQTEELETAMKETVHWMDDVDRFLEEITGTISEG
DAETIESQVQEVEALQQDISTVEKKVDSLIETCTLITNRAEESYAEQLRQ
SLDGLKKRWSGIIDSTEKQKENLRNAGEKFQQIDDGVKKIMESLGQIDSA
ISKEDFSLLKQDTLLSKKQDYQTYITRLEEHDQLLTSHTNTINALITTTS
TPTTPPPTEQPPVCIEIEKTRKTITTLRGRIETNLSKLTSFNTDLEELKA
LLENVNKLADQLKNEIVNLTSKQAGADEEILKECLSSIPAISEQIETGVF
KQFDEMSTRVSKSNVCNQVILDMIDEYKSRVEGIREGCKKVQLMFEGEMK
KHQQLGDDVIRIDEWVRKTSKCVLDRIDGSVDLEDDYIEGLEESISLNED
LITSTRHSIQEIQSANNQSKLDQLGNLSTQIEEIKTNLEKLKSQPSRKEL
ERQFAALEGSVLTDIDNLKRKAKKVKLSSPEVNDIQCAVENLEELAKQCD
EEIKANADRFEEIAKELSGRDDRGLDKQVQEVKTEYEKLQQFLKGREKVF
ADALPLSESVYAHLDTLNEWLSSTVEQLEQVSTNPLPSTPEESVEKVKSV
IEDVTKKAEDVQQLVNNASSLGQMSDEPAFRAMEQRVRDVHEVYQSLLTD
GDEKLDTLKQWIQQLDEYEKKVDDLNTWIDGRMSMLESIGGVTNKWEIEM
ETQKFESLKSMVNAKDADLDQLKAIGDELVQKGRSSVVEPYERQIYQRWD
DLEKKLTSIDVMLKLKLKEFDDKEKEQEIMRLQEEKKRLVADEEVILTQS
SRVVEVHAGVDIDFDQLDSGLPQPETKTDISISSTPTDVIISKQSTNVSV
SVVTTTTTTKRYEREEKVSVERDLDEMITEIESIETMLKDLKANDENEFK
TTEENAQKLEDQLNSLQPDFESLMTDAKELIKQLGHIEKKGPILDLSRRM
SGAHASLAIRKKSLRNADSRYFKMKNDLTNVQVWLEETEKALRSGDHDPN
KMKFIEENIERYAAEMEGVNIRAEQLSDICADSLIPKRQISLLNKKFKLV
SYQLEQVQAPEEKETTYKISVETGDVESADTRASVNIKLFGEYGNSDQLQ
LRQSETKRKKFQRGQVDLFTFRSQPWLGKLSKLRVWHDNEGSNPQWFLAS
IYILDELSGRLFCFVFDSWLSKDAGAVLREIPVGAMALYKETAPDILARK
HKFTEVQWLFDTLKLTSYENKMRTVEELVQDIQDVIREIEEIHAVFNDEC
FSKKPFDQLAQQQELLKEMETRMDSVSPSVTSLMMVQQAYINQTTPEEMH
NIDVHLTTMCARWNALDKEFRHRYVSVEKNVGEWQQFTDDCNSLMLFLTK
AENQLRENQNDDVEKDLYDEINRNEFKLNNLNNTGTTLIALSTDSNAELK
DKLESVNRRWKEIMSGLNSRKLGSLMDDPKIKEFVNKSDQIKTQLDAIFK
LVFHTKPHPVDAGSLQKYRDDLKKCENDLTDRRDEIGRLTDDADRLLERP
DLSANQLDEIKSRSTSMQAQVQDLTTGHSKRFDVVENNLARATRFLDELD
GLSSWMSKTRDLLEGHKENKPGYNVDPEIMKKSLETRKCNVLSINDLLKD
FKAEGELASGNFPQAVGEKIGQLNVDWQIIIRLALALKERPVSEEVVVAE
TVQERQDAPVTFDSLQTSLSFTTTETSKYKYEMYSSTNENSIGGEGETAQ
LHDWLRLVEQKIKSLNVTLGDEDEMAAAVQKQNSIQLEMSNRRKEYDDAI
SMATTSPQDDEKINKLKEHWEGVWGKVLNKKSLINQALVDWRRYNELRLQ
LDNYVYKADMQLNENQQIGTTVTELEAQLDKHKKFQGELSTWANTYNTLR
QLAETILSTYVNEDLNDFKTTVNETNTRWNSLETRSNAHQDSLQEALDRL
LQFHKNMISALTWLSSAESKVAELDSLVESSQAEDTSNVDELQGEMQELE
DDIASHQAMFNGLNETGKQILMDLEVGEVRTALQSKLDDMNDRWNSLGVR
VVDIRDRMSYGTGEWRQLLLDMQEIVDWLSRAGQELMSQQPIASDVEKVQ
QQNKHHQEFKGKLNARRVVIEQALEQGHNFLLKHQSAQDESFIQRGDKLV
VRVASSLREQLTHIQSQWLDLQNNSDKWEKTISLVLELVNNLLEDIEKIN
KTLNESEEIVNHWVLTQDIPVDSVASYLGDTRRMQEQTQSMETQFDSMDG
TVKELRHIHGVLLAKPTEGVIDQLHDRWKHLLNDCQIRQENLQNLMSGSD
AGSVMLQESVPTPWERGQALNKVPYFINHTTKTTQWDHPKMTELYHTLSE
LNDVKFAAYRTSMKLRCLQKACCLDLCELNLNIKKAFEQHNLRLSNDNLV
DVGEIINVLSTIFESIDTNRKESINVSQCIDMTLNWLLNVYDSGRIGKLR
VLSFKAAITLMSRAKLEDKWKYLFRQISDNTGHADSKKLGLLLHDCVQIP
RQLGEIAAFGGSNIEPSVRSCFEMAKNNSAIDSNNFVAWTNAEPQSLVWM
PVLHRLASAETAKHDAKCGICKEYPIVGFRYRCLKCFNFDLCQTCFWSGR
VSKSHRVTHPMHQYSLATTTGEDLSDFVKLMRNKFKSRRYRSRPPKKLGY
LPVQTIMEGSSIETPTEPTTPDLSNFTFDSAMNGHHDSTDFHPNHHGNDE
EIGNEEHHLIKLMCQSLNGEITNNNTTPKSPSQILATLDSSQQEDIGEMI
RGLEEEHQSLMEEYTRLKGIKPSNSFENGQIVPENTQDTVLIAEAKSLRE
HKGRLEARMQILEDHNRQLESQLQRLRLLLEQPPSERERHNSSGSTNPPS
PKGLTPALTPSSSYHGSPELGRRQNGYSDERAMDIHHVTAEIEHAFPTSS
YED
Run BLAST on NCBI

transcript from alignment at sc0000010:243650..358078-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001425 ID=TCONS_00001425|Name=TCONS_00001425|organism=Clytia hemisphaerica|type=transcript|length=114429bp|location=Sequence derived from alignment at sc0000010:243650..358078- (Clytia hemisphaerica)
TAGACGGTTTTATAATAAAAGATGAAAAATAATTAATGTGATGATTATTT GGAGTAATGATGGATGAAAATAGCTCCCAAGATCTTTGTAAGTATTTGAA TTTTCTCTACTATTCCTTTATTCAAAATTTAATTATGTCTTTCAATACTT TTGATATTTTATCTAGTACTCTTTTCTCTGCAGAATTGTTGTCAAGCTAA AATGTCATCAATATTTTTACGTCAAATTTTGTCAACAAACTTGAGTATCT TAGTGTTACATTGGCTGAATTGAAAATTAACTTTCTGTTACCATCAACAA CAAGCAGAAAATAATTTTCATGATTCAAACCCTGAGAGTTCTATCTAATC ACTTTTATTGTATTTTTACAAACTAAAAAACATTGTAGATCTTCCTGAAA GAAGTTCTTTTAAAGGCAACAAAATTGTTAAATATCTCACTCGAATGACA ACTCTTCTTTCTAGTAAAGAAATTGTGTTAAACTTCTTCTCCTGAATAGG AGACTTGTTTTACATGCAGTTGCAAACTTTCTTATGATCTTTATTTTTAT AAGTAATTCGAAAAATAAGCAGCTAAACAAATGTTATTTGTTCTTTGAGA GATAAGGAAGTTTGAATATTAAAAGTTTCATCAAATCTCTCTTATGGAAA CATGCAAGCCAACTCATGATAATTTTTGAACAATGAAGCATATAAAAAGC TGGTTTTCTTTCCAAGAAAGTGAGTTTCTTTCGCTTAAATATGTAGAGAA AAATACCAAGATAGGAAGATTTACAAGTAGTTTTTATGAAGAATAAAATT TGATTTTGTTTTTTAGACGTGACAAGACAGAAACTAGTCGTGGTTAAAAG GTAATTGAGTTATATGGTCATAAAATCAGATTTTCATTGACCTTAGTTTA AGTCTCCCGGGACCTTTTAATCTAATCGTGCCTCGTCATGAGGCTGAATC ATCGATATAAAGGAGCTTTGGTATAAATATTTCTAGTTGTCTTCAGAATA ATTTAGTCTATTTCCAGCTATGTTGTCTAAAAGGTTTCACGAGAAATATG GAGGGCTTCGTGTATTGCAAACAAAAACTATGGAAATTCAAACTGAAAGA CTTGTCACTCAAGAAAGTTATACTGTTACTAAATTGCAAATCAGTCCTTT TAAATTGGTTATTGGAAAAGATACTCAAGTAAACAACAGCTTTGTTGTTA AGACAACAAAGAAGATTGCAGCTTTTGATGAAATAGGCAGAAAAGTTGCC AAGCCAGATGAACGTTTTACTTTGAAGATTGATCCCAATAGAAAAATCAT CAAACGCCCTAAAGTTGCAGACTATATCTTTTTTGCACCAATCAAATTCA ACCAGCACGAAGATATTATAATAGAAAAGGCCCAAGAGTTTAAAGAGACC ACCAAAACACAGATTGACGAAAATCAGAACCAACTAGCTTGTCATTCTTT GGCGCATTTAGACTATCATAAGTGGTCTTTTCGGGCTAGTTCAGCTAATT TGTGTTGTATTTGCACAAAGTATAGTAAGCAAACATATATTACTGTTAAC ATTGTTTTGATTCTTATTATTGAAAAACTTTACTTTGTGTCTTGAGGTAT GAAAATGAATGAATATTGTAGCCTGATGAATACCTCATTACACGAATATT ACTAGGCAAGTATTCAACGGCCTTGAAATTACACGCAAAAAATTAACACG AATTTAATTTGCTTTTTCAAGGACAACACGGCTGGTTTTAATTGAGGGAG TTTCTGTTAACACGAAATTTTTCAATTTGTGTTAATAAAATGACTAGTAA TATTCGTTAAATAAGGTAAGTTATTGCTAGGGATTTTTAGTTTCTTTGCT TTTCTTAAAAATTGTTATTTTCACCTCAATTAGATGAACGATCAGACACC CAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAGTATC CTTTTGTTTTGAATTTGAAATATGTTATATTTCATANTACTGTTAACATT GTTTTGATTCTAATTATTGAAAAACTTTACTTTGTGGTATGAAAAGGAAT GAATATTATAGCCTGATGAATACCTTATTACACGAATATTACTAGGCAAG TATTCAACGGCCTTGAAATTACACGCAAAAAATAACACGAATTTAATTTG CTTTTTCAAGGACACCACGGCTGGTTTTAATTAAGGGAGTTTTTGTTAAC ACGAAATTTTTCAATTTGTGTTAATAAAATGACTAGTAATATTCGTGAAA TAAGGTAAGTTATTGCTAGGGATTTTTGGTTTTTTTCTTTTCTAAAAAAT TGTTATTTTCACCTCAATTAGATGAACGATCAGACACCCAAAAGAAGACC TTCACCAGATGGATCAATCATATTTTGAAAAAAGTATCCTTTTGTTTTGA ATTTGAAATATGTTATATTTCATATGTATGTGAAGAAATTCATAGAATTT CTGTCCAACTATCTGCATACATACATTATATATTTTTTGAAATGGATTTG GAACAAAATCCTGTAGGCTTCGAATCCAAGAAAATTTACAAAAATGAGAC TTGTTCTTCCATTTGATACAGGTTTTTGAATTTATTCATAGTGATAATGA TTCCTTTTGAAATTTGCAGTAAATATTATTAAATTAGAATTTTATTCTAC TTTTTTAAGCAACTTCATTATTGTTGATTAATGGTTTCTTTTTAAATTTC AGAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGAT GGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCGT AAAATTAAACTTTCAAAATTACTTTTTTGCAAATAACCTCCTCTTTTCAT TATGAATTTTGTCACTCTTTAGTCATATTTCTGTGGAATTCAACTATAAA TTTCTTTTGAAAGTTTCTCTTTATATAAATGAATTCCTTATCCAACGAAT TTAGCCAACTTTAAATAATTTTTTACTAATCTCTACCTAATTGACTGTCT CAGGCTTCCCATATGGTAGCAGGTATGAATAGCCCGCCATTTTGTTTTCC TATTTTAGTTGTCATCAGAGGGATCGAACTTTTTTGAAATTGAAATTCTA AAAACTGAACTAAAACAGAAAACAACATGGTGGACTCAGTGTGGACTAAT CGACTTAAAATCTAGAAACACTCAATTAATCCAAACACAATTTAGAATTA TTGTACCGGGTGCGCCACAAAAAAGTTTCCCTCTTTGAAACTAATTTTCT CGAAATCTAAAAATTTTAAAAGAACCATTCCTATTTCATTGGAAAGAAGA AAGATAGACTTAAATTTTGATNACTTTTCTTCTTTTCAATAAAATAGGAA TGGTTCTTTTAAAATTTTTAGATTTTGAGAAAATTACTTTTAAAGAGAGA AACTGTGTGTTTTGTGGCAAAATGAAATGAAATTGTGGCACACCCGGTAT ATATAATGAAAATAGGATTATATCTTTTTTTAAACTATATATGTTTCAGA AACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGA GCATTGCAAGTATTCCAAGGGTATGATGTAAGTATTANCCAATTATGTCC AATTGAATAAAAATGTTACTTTCAGAAAGTGCTCGAAAACGTTAAAAATC GACCTATCAAATTTTTACTTTAAATTTGGCAATCGCAATAGCCTNATTGT TTACAGTTGAATTTTCTCCCAAGTTCCTCTTGCCGCTGGGTAGCTTGCAG CTGCAATCCAACCGGATCCAATCCGTCAAAGCAATATTGGTTAATCTGAA CTGATAAGTAACTGAAAGCATTGGTCCCTAGTCTATGGTTTAGCGCAAGT AATTAGTTTTGAATTAGAATTTGAGAACGTAGTCATGCACAATCTGATTG CTACCTATTCCATAGGTATATACCTGAGGATCTAGGAGGGTATACCCGAG GGTATTGGAGAGGGCGCCACTCATTTCCCTAGATTTCTCTACTTACCCTT GATTTGTCTGATTAGTTGCTGAGCATCAAACAGAGAGACATCAAGTGTCA TTTTGGGAATTTTTGGTATGACCTGGCCGGGTGTTTAAGTTTCTCCCTTG TGCACTATAGCTAGATCATCTACCTTCATACTACAGTCAGTCTCCCAATT AACATTTTTAGTCCCTTAAGGGAAGAAATTTTTGTGGAATTTAATTTTGC GGTTCACAGCTCAAAATTCGGAAATTTCACGGAATTTAATTTTGCAGTTA AGAGGATTTTTTGTTTACACAATGTCCTATTTTTCCCTAAAACGACCAAT TTTAGAGGTGGTTTTTTTAATTCTGAGATTATTCGTGTTTCGCAGAATTT AATTTCGCTGATTTGTCAAAACACTGCGAAATTAAATTCCGTAAAAATAT CTTCCTGCAAAGATTTTTTTCCTTATAAGGTAATGTTTTTTTTCTGGTAT CTCAAAGTTTTATTTTATCATATTTTTCATTATCTTTCTTCAGACAAAGC TGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATT CTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGGTATAAGGTTTTGA AATCTAATGGAAATTTCTGTTGATGCTTTCATGGGTATGTTATTTACATG AGAATATTTGTGGTCATNTGAAATTTTTGTCGGTGCTTTCATGGGTATGT TATTTACATGAGAATATTTGTGGTCATTGCTTTTTAAGTGGTATTATCTC CTTAAAGCTTTTTACAAGTGGAAAATAAACACAAACTTAATCCCATCCAT GCCATACCTTTTTCAAGTGGCGATAATATATGTTTTTCTAATAACAAATA CCTTATGTAGACAGATGTGGAGAGTTTTGTCGTGTGACTATTTGGAGTGG TCTCTATTTTTGGAACCTTTTTGAATTGAAGTGGTATTTCCATTAAAAGA GCCTCAAAGTTGATCAAATAATGAAGCCTTAAAGTTGATCAGATAATGAA ACTTCACATTACTTCCAAAAATCAAAAAATAATCCTACAGTCTACCAACA AGGAGTAGACTATATTTAAGATCTTTAAGCTCGGGCTATCATAACCAGTT GAGCATTTTCTCTAGTATTACATCGAAAGTACAAGCTCGAATAAAATTCT CATGAAATGCAATACTAATAAATAATCAAATAATGACAAACTTCAGCCTA TTATACAAAACTTTATTACTCTCCAATAAAATCTAGACTTAAATATTACC TTGATTGAATAGCAACAAGTGAAACACCTTACCAATGATAAAAGAGTCTG GACTTGTGTCTTGTTTGAATTGTAACAAAGTCTCTAGAACACAGCTGTTA GTTCAGAGGTCCTCCTTTAAATCAATACCCCAATTTGCATCATGCATCCT TGCACACAGGCATGTTTTAAAAGGTGTCCATCCCCTCTCTAATGATTACT TTATTAAAACTATAATAAATTTTGTGATTAGATATTTAAAAGTATTTCAC ACGTTTTTTCATAAGAACAAACCATTTAACATTTTTAGGCCTAGAACTCA AAAAGTTTAAGAACATCTGAGAAAAATTTAGGATGTTCTTATAAAAAACG TGTAAATGTTTCACTTTATTTTTTAAGGACAGTTTTTTTTCTGCAAATCC TTTTTTCTACAAACAAGAGTAATACACATGTTACACCACTTGTATGGCAA TACCAATTTTTTTTGTGACTTCCCCTTCAAACACTATTAAAAAACATTAC TTATCAAACTGTGAATACATGTTTCAAAGAGAAATCTGTCCTTTCGTTAC CATACACGTTTTTCATAAGAACAAACTATGTAAGAACATAAGGCTTCGAT GGCCAAAATATTAAGAACATGCTAAGAACATTGGAGTCAAAAATACTAAG AAAATGAGAACATTTTAAAAGAACATTTTTAGGCTTTATGCTCAAAAAGT TAAGAACATTCGAAGGCTTCAAGAAATTTTGGATGTTCTTATAAAAAAAC GTGTGTTTAAAATAAACTTCTTTCAAATTCTGTTTTGTAACATTTTTAAT GTTTTGTTTAATACATTATTAACAAATCTTGCCTCTACTCTCTCTTATAA TAATTCCAACTAAATACATCTTTAATTCTGTTAGTGTTAACAAAAAATGT CATTCTCTTTCTCTTTCTCGTGGCTAGTCATTCTTTTTTCTTGTGTTTTT TTCGTGTTTGTAATCAGTGTTTGCAATGTAAAAAGGAAATTCAATCATAA AGAAATGACTTTCTCCAAACTTATCACATAGTGATAAAAGCAATACAACA TCCTCTTGATGTGAATCTGCTGATGACCCATCTAAGGTAATAAAACTAAA TTTTCCATGTTTTAAAAATGATGGTACAAGAGAGAAAAAAACGACTCCAT TATAAGTTAATTAGCTTCTATTAACTAAGCGATAGCTATTTGATCATTAT TTCCAGTTTAATGAGTATCCCCCTAATCTATGGTATGTTGTTTAAAGAGA AGTTTGTCATTCCTTTTTTCTTATAATTACTCGCATACATGTATAATGTT TCTTGTGTTCTTTTTCTTGTTTGTGGAAGTGTGTGTGTAAAGGGTTTGGT CGTCCATCAGTCTTACTTTAGTGTTAATATAATATGTATGCTAGTATGTG GTATTAGACTTAGAGAGACTCAAAATCAAAGTCAAAATTGAACTTTTTTA CTATTGAAAGATTTTCCAAAGAGAGAAGAGGATGGTAGGTGTTTTTACAT TTGTTTTCCTTACTGTTCCTTAAGCTTTTTGTTTGTTTTGAAGTAATCAT TCAATCACATAACTCTTTTTTTTTTGTTCAAATGAAAACACACTGTCGAA TGTTGACTAAATGTAAACACAGGGTAAGGTTAAAGGAGGCTAAGGATTTG ATCACAAAATGTTTATTCACGATTTGTTTTTAATGCTATAGTTTACTTTC TTTATCTTTTGATTTTTCATCCATGGTCAGCTCATTTACTTGTTAAGATA CCTATCTATCTAATAGTTGAAGGTATCATCACATCATATAAATGCTCTAT TTTTATTCATCCCTAGTAGAGCCACTATTGACTATTTCTTCTTTAAATTC GAACCTATATCACACAGAAATCAAAATTTAATCTTTGCATCTCCTATTAA TTAGGTTACACCTGGTTTCATATTGAAATTAAATTAAAGTTTTCCAGGTA GCCATAATCTGCAATATTTTACGGTATATCATTTAGGGATTCACCAAATA CCTCCCCTTACGAAGTTTTCCAAAAGAAAATTTATCAGTAGATTGTATTT CAATTGCAATATTATAAGCCTGTGAAAATTTTTGGTGTTACCTGAGCCTT TGAAACCTCTTTTTGCTTCTACGCTTTTTTAAGCATAGATACTTCTTTAT ACTAGAGTATGCGTACGAGCTTTTTTTTACGAACTTTTTTTTTGCAACTC TTGTCATGTTTGACTGTTTGTTTTGCATCATAATAAAAAATTGTGTTTTC TTGATTTTTTTTTGTGATTCCATCCTTCTTGTATGGTCGTCTCTCTTGAG CCCCCTATTTTTTATTGAAGGACAGTCGTCATTAAATAGGATTTACTCTT GATGTTTTTTGTTTACAACTTGTTAGAAACAATTTTTTTTTGAAATCTAC ATTTTGAAGGTTTTTTTGAATGTGTTGAAATTCTTGTAGAAAAATCTCAT GGAGTGTGTTGTTTTTAGATTTTGTTGATTATTATACCAACTAGTATGAG TTTGTAAATTTTTTGGCTCTGTGTTTTTTTTGTTGGTTTTATGTATCACT TATGCTGATGTTATGATTGGTTCAACTAGTTCTGTATATTGGAAGTAAAT TGACTTGGTAACAAAGTATGAATCTATTTTCGATTTCTCATTTTCTTCTT TCCTCTTTTAAGCTGTTAGTGGTTGATCTTGTAAGACTATTAGATTTTAG TTCCTGATCTATCAGCTTAAAGACTATTCAAGTTTTTATGTAATAGGCTC CAATCATAAGATTTAACAAAAACCAACTTTGGCAACACTGTTTTAAAACT CCATAGGCCTTCGTATTTCTGTGCACCCTCTCGTGTCCATTGGAAGAAAA TCAACATTTTAAAACTTTTATCATCAACTTCATCATTTTTCAAGGCTCAG AATCTTCCAGTAGTAAAAACATATGCCCTGCCTAAGAACGTTCAAGGAAT TGGTTTGGCCGATCCAATCTCTCCTCTTCGATTTTATAAGGTTCTTTAGT ATATTTTCAGCTATCGAATAATGTTTAAAAGTTTGTTAGTGAATAACCTA CAAGTACATCCTTCTTGTCTTTTAGTAAATTCTTATCCTCTTAAAGTTTC TAACTTGCCCTCTTTTAGTTCAAAACTATTGATTAGAAAATAAGTTTATA CCTTAAGTTTTTAGAGCTTCTTAAATGCAACAAAAACAACATCAAATTTT TGTTGTATGTAACAAGAAGAGTTTAGATTTTTTCAGCTCAAGTATTGAGA GAAGGTGCTAGAATGCTAGAGTCTGTCCTATGGTTACTTTAATTGTCCAG CTAAATCATGTGAGTGCCAAAAGCCTGATTCTAGTTTGAAAAAGAACCAA AATTTTGCTTCAGATTATTTCATGATATTGTCAGGTTTTTTAGATTGAAT ACAGTTCTAGTCTAGGGAATACTATTTCATAATATTTATAAAAAGCCAGG GTACAGAGTTATATACCACGAATGCAATGAAACTACTGGAATTTAATTTT CATGAAGTATGTTTCCTTGACTGGAATCATAGGAATCCATCATAGGAACT TGAAAATAGATTTCACTTCCTGGCACTGTCTTTATAATTGCACAGAAATT ACATTTTAATGGATATTATTAATAACATATTACTTACCTGCTATTTTTAA CACAAGCGTCTTCTTAACTCGAACAAGTTTTCTCGTCCCTTTATAGTTAA CAATGCCTTATAAACCTTATACACTATAACTCGAACAACATTTGTGTTCC CCGTGTGGGTTTCGCCTCAACTGTATAGTTATAACACTAAATAAAGATAA TGAAGACAATGCTCTATACGCGACTCGTTCTCTTTTCTATGTCTCGTTCA GGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGG AGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGGTAC CTTATACACCTTTAGACTTGTTTGTAAAAAACTTTTATCTAATACGTCAC TTGCAACCACTGACCTTATTATACCCTTGGACCAAGCAAAATCTTTGATT GGAGTTTCTTGAAAAGTGGTCATACCTTATGTACTCGATGTTCATCAATT TATAATTCAATAAAATTTCCGTTTAAAATTGTTTTCACTCAGATTGAGTA TTGCTACCTACCATTAGGGCACCACTTTCCAAAAGTTCCGATAAAAGATT TTGCTTGGTTGGGATAGAGGTGCTTGCAACCAATCAGCTGTTTTGAAAAT TATATTATAGCAATATTGCATTTCTTGAATAGACTACTTTTGATTTTTTT TATACTGGCTTACTCCAGATAGGCCTTGTTATTTGTTCTTACATGCTTTT TGTCCTGCTTTAAAGCTTAGGTAGTTTTTTAGTCTAACTAAAGCGTAGTT AAGATGTGTTATTTTGTGATTTTTAACAGCTACTTGGCAATGCTCCCCAG AATTGAACAACCATTATTTATTTGTGTACAAAGTATTCTTGCCTCCTTTG AAGTAGTTTCAATCCTTTTACAGTGGATACCAAAGTTGATTCCTCTAAGG TCAAGAAAACTGGCACTACCTGACACAATCTGCAGGAATACCAGCCTCAA ATATTGTGAACTCGTGAGTTCTTAGTGAGACTGTGAAAAGTGACGGAGTA GAGTTGAATTCATCGTCTCGAACGTGGTTGAGCAATGGAGACTAAGGCCA TGTTCAGACGTTACTGTTCCGTATCGTTTCAAAACGAAACGGTTCCGAAA CTAGTGTGAACGTCAAAATTCGAAACATCAAAAAAGAAGATGTTACAAAG TAAAACAGATCGTAACGGCTTTGCTCCACTCTTTACATCGGGACGGAACT GCTCCGTTTTCTTGCTCCGATCCGTAATAGAAACCAATATGAACACTCTC GATCCGTAACAGAAACCATACCGGAACTATACGAAACCGTAACGACTGAA CATGGCCTAAGGTTAAACTACGCAACTATTAATGGCTTGAATATTACCCA CAGATATATACTCCGATTCTGTTGTTTTTCCCATTCTAGATACAAAGATG TAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAAT GCTATTCTTCATCATTTCAAGTAACTATATTTAAAATACGAATCATTTCG CACCTTACTTTAAGTACAGTCGGCGCTCTCTAATTTCAATTTTCAAGGGA GTTTGGATTTTCATCGAATGAGGGAACGCATCGAATAGTAGAGCTTCGTT TATGAGAGTTTCTTATCGACGGTGATTTTCAATATTATCGGATAATGGAT TGTATCGAATAGTAGAACGTCGAATTAGAGAGCGTCATTTGTAATTAGAT TAAAGATTTATAAAGGGTTGGCATGACAGGCTTACATCCCAAGACAGAAA GGTTTTACTTATTTTGTTGGCGTTAAATCATATTTATATGTCGCTAACAA GATCTTGGACCCTAAATAATGAAACTCGTCCAAGACCATGCTTCCCATCA GAACATTTCACAGATGATTTCTTAATAACGCGCCTGAATTTAGAATAGCC TGAAAAAACAGACATCTTAAGGCATAACCATTGAAATGATCTGTGATACA GGATATTTATAAGAACCATCTTTATTTAACCCTATTCGTACTAGGGGGGG GGGGCTCTTTCTGTTCGGAGGTCAAACTATTGGTAATAGGTCCTGAAATA ATAGAGCTTTTGCCTTGAAATTTTCTGTAAATTCCTAACTTTTATTTAGC TTCAAAATAAAAAAAAATTTGACACCTAAAGATTTTCACACCTTCAGCAT GATGACATTTCTGACAGTAAGGTGTCACAAAAATTGACACTTTTCCAATA CAAATTTATTTTTAATGTCAAATATATCGTTGAAACCGTAATTTATTGAA TATTTAGAATATTTAGGATAAAATAAGCATTTTAAACTCAGGCAACTTTT TTCTAAAACTTTTGTTAGAATACAATTGTTATTTTTAAGAACAAAGGAAA TTTCCAGTTTTTGCTCACTTTGGGCATGATGAGTGACGTCATCAAAAAAA TTTTTTGTCAAAAGTTACCTTACGTGACAAGGATCTTGTGTGCCAAATTT CATCCAAAAAGACCCACTAGATCAAAAGTTAAGGGGTGGTACAGGAAAAC CCCCCCCCCCCCCTAGTTCTGAACCGCCCCTAAAAGCCTAGGTTGAATAG GGTTAACTCCCCTAGTCCACAGGCCCAAATATCAGTAGGGAGTTTGCATT AAATCTTAAAATGATTCAGAAGGTTGATTTAGAAAGAGAGAAGTGCTTGT ACACCCGCTTGGCATTATCAATCAGTGTTTGAACAAGTGAATATTGGAAA TGTTTATTAAAAGATAATATTCTATTTTTCTATTCTTTTAATTTTCTATC TAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTG AAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCA CCATTACTGGAGCCTGAAGGTTTGATTTTTACTCTCTCTCCTTTCTTTCC GTATAAGGGACCATGTTTGAGAAAAAATCTGATGAAAAAATGTTTTGTGG TTGTTGTCTGGATGATAGATTTCTTTCACCAGTACTCTCATACTTTTTTT TTCGTTTCTTCAAGGGGGTCCAAGGTCCGGGCTCCACTTAAAGCTTTTTT TAGTTTTACAGATTTTAGTTGTTTTTGGAAGGTAAAAACAGTATGAAGCA TTGTTTTTATTTGAAAATAAGTGATTGCAAATCTGTTATTGATGTTTGTT TCTCGTTTTTGATTGTCTTTCAACTGCAAGTAACTTTTTTGTTATTTGGA TTTTTAATATTTTCTCTCAAAATGGCAACCTCGCCAAACGCTTCACTGGA CTCAGCGTCATAAAAAATGATCAAAAAGTAAATTCCAACCAAAAGTAGAC TCTAGTCTAGGGGATCTGTGGTAAACCATGTTTGCTTCCTATGAAATGAA CGGAGTAAAACGGAATCGAACCGGGAACCCCTGGTTTGTTGCGTTTGCGC TTTAGACCGCTTACCCGTTACACCTTTTTCATCAAAATCAAAATCTCTAA ATCAAAAATCCTCTGTCCGACTTAGGAAAGAATATATATCGCTGAACAAT CCAAGATCCTTTTACCCAAAGGGTATAACTTCGTTTTCGTTGAATTATTT ATTACTTTATTTGAAGCAAGTATCAATCAATGTATCAAATCAATGCCATA AGAGTGCTCGATTAGTTAAAGAACCAGAGCCATATATCAATATTCTAAGA GTTATCTTCCATTAAAAAACTAAAAATTACATCACTCAGAGTTCCATGCT TACGCACTAATCATATGTACAGTAATGATTGAAAAATTTGAAATTCGACG TAAAAAGTTTAAAAAACTGGATAATTTGTGCAATAACCATTACTTTATTT GTGTAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTAT GTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATC GGATGGATCTGAGCTGGATCAGGTATTTTTTCTTTTTTCTTTCAATTGAT CCTCGACCGAAATTTGAAATCATCACTATTCATGATCACTGACCTTTATA TATTCCTGGACCAAGTCACTCAATCCCAGCCTAATAAAAATCTTTGATCA GAGTTTTTTGAAAAGTGGTACCCTAATTGCGGCACTACTCAATAGCGGTG AAAATGCATCGAGAGCGCTAGATCTACTTTTCCTCGAATACTTTTTATGA TGTAGCGCCGTTAGACGTTAATTTTTTGCTGTGCAATGGCTTTTTCTCGG GTACCAATTCCAAAAAAAACTTCGATCAAAGATGGTGGATATAGCTTGGT CAAGGGATATATAAAGGTCAGTGTTCGTGATATGCACCACTGCAATGTCT TCTGACACTACATCACCGACCCAATAGCTGATTGGTTGTATATGACGTAA AATTGATCAATACGTCACTTTCAACCAATCAGCTGTTGGGTCCATGGAAG ACATTGCAATGGTGCATAGCATGAAGTACTCACAGATATCGAAATTTGAC GTCATTTAGCTGTGATACGTTGAGCTTGTGCCTTTGTGTGCATTCATTTA AAAGTAATGTCTTCTATAGCTTATGATTAATGGAGTTAGAAGTTGTTCAG TGTCTGGCTCACATTCCATCAGTATTTTTGGAGAGCTGAAACGTCTGTTA GTTAATGTGTACTGATCTCATTACAAATGACATTTTTGATCTCATTCCTC ATAAATCATAGCTAAACGAACTCTTCATTTTATTGAATTTCTTAAATTTT TCAACAAAAAAAACGTAGTTATCTGCTCATGTCAAAAAAGTCTAATGTGT TGACAAAAAAGGACTTCCTGTTCTGTCAGTCTAATAGTGCTATTTTAGTT ATTTTTTTTGGTGGAAACGAGGTAGTCTCTCATCATTTTAACTCAAATCA TTCTACCCTTTGCTATGCAAAATTTTTATCATGACTAAATCTCGGTTTTC TAGTTTCACTCTGTGATTTTTATGGGATGACACCAATTTATGCAGCTCCG AGTCTCCTTACAACAAAAATTTTTTTCGAACTCTCGAATTCTTGACATTG AAGCAGCAACTTTATGATCCAGATGACAGAATAAAACATCCATTGATTGC TTAATAACTTGGTATTTTAAATACCCTTTTAATTAATGTAATTGCCTGAG AACAATACTTAATGATAATAATACGTCTGTATGATCTTGTTTATTGGGGT TTAGAAGCACAAGTTTATTTTTCGTCTGATTATTTTTTATGTTCTTATTT CAGCTTTGTCCCTTGAGTTCTTAGTTAGAGTGCACAACATTAGAAGCCGA TGTCTTGGAGAAACTGAACAAGTTTGTACCAAACTTGATTGTTTTAACTT TAAGAATTAAAACAAGCTCCACTGAAGCTGCAAGGCCAGCCACAAATAAA CGTAGACCGAACCTTCAAAACCAGTGCATACTAAACTCTTATAATTAGAG CTTCTAGAAGAATGCAACAAGTCAACACGTACAATTCTCGAGAAGAAAGA TTGAGGAAAAAAAATTTCTTTGGAGAAGGCCAAGCAATCTTCTACTAATT GTATCAAAGTTAGAGTAAACAGCCAACAACCGTAGCCTAAATAGAATTGA CTTTCTGTTAACTATTGCAACACATCTAATGAATCTTTTCATGGACTTTT TAGGGTTATGAAAGGGAACCCTTCCCTTCGCATTTGCCAAAGTTTATAGT GCGATTATGGTGAAGCTATACCTTCACTAAAAAGTTAGGAACTGCATGAT CCATAGCTAGATTTCTTCTTTTGGTAAGAATCCAACATTTTCATCATCTC TCAGTTTGTTTTATATTTTCTTATAAAAAAGTCGATTGAAGGGGGATTTC ATTTGATTACTATGGCATTTCTTTATTGTCAATAAATAGTCGTATATTAA GTACATCACACACCACAAGAGCGTAAAGTAGGGGAGAGTAGGCTTTTTTA TGTTTATGAAAACATCATAAGAAGCTTTATAATACTCTGATTAAAATGTA TTAAAGTAGTTTTGGCATCGTATATACCACCATTTTGCTAAAAGGAAGAG AAAACAAGAGAAGGAGACGAGCTTTTTAATTTTCTTATTGTTGTGAAATA TGGAATAAAGGAAAAATAAATCTGTTGTCTGTTGGAAAGTCGTTTGATTG CATATTGTATTATATGTTTATATTTTGCTGCAGCAGACCGTCCAGTTGGT GAGACATTGTGGAAAGCTTTTTTTGACTTTATTTTGTCTCCACAAATTGT TGCTAACTTTAGCGCTGGAGGATTTTGAGACGGACTCGGAGACATTTATA GACAACAACCGAATCTCGAGTTACGCTAATTTTGTTATTGCTTATTTTCA ATCTGAGGAGGAGCTCAATATTTTGGTTTTTCGTCAAACCTATTGAGTAC GTCTTATTTCGGCACCTCTTATTGTTTTTGACGGCATATTACCGAAGAGC AGATACACAGATTCGATGACTGTATCCAATCGTGTTTAGATATTTTGACT CCATTAAAATAATCAAATACGAGCTGCATGTCTATATCCTGACACCGACG ATAAGGAATTTTCATCTCTTTGTGTTTGGTTTTAATATCCCAGTTAATAA AAGCAGTAAATTTTTTTGGTGGTTTTGTACAAAAAGGACATGCTGATTAT TAAAGGACATCCAGCATGGTTCTAGATCAACAAACTGTGAGTTTTATTAT TGTCATTCCAACCAAGTTTCCTCTTTAGATTTGATTTTATGATATGTTGC ATTTTTTTCTCAGCTTTTTTTATATTTGCGTGACACTTGCATCAAAATTT TTTTTGTAATAGATAATTATGTTAGTAAGATGTGTATGAATGATTTGTGG TAGCAACAAGCTAGCTTTGTCCACCCGTACCCGCTCATACCGAGGAATCG TTTTGTTTTCAAATAGTCATCGGTCTTAAGAAGATCTGCTACTGAATTTT CCTTTTCTGTTTATGCCATCTTTTGGTTCAGGAGAATTATGTGACGCATA ATGAGCTTGGTATGTTTCGTCTATGTTTTTTGGAATAAAATTTATACACT GTTTTCTTGTGTAGAGAGTGTTGTAATAACCAATCAATTAAATGAATATT TACGAAGAGTGGTCGAAACGTCTGCAGAGCCAAATATCAAAATTTTTTCT CTTTAAACAGGTCCCCCTAAGAAAAGGATTTTTAGAAAAAACAGCTTTTG AAGAAAATGAATTTCTTGGAATTCTTATAAATATTGCCCTAAAAAGGTGT GTTTAAAAGGTTTATTGCAAATGTATGGTGAGCAATACTCAGTGTTTATT TTAATACCAGAAGTTTGAATTAGAGAGATTCAACTGTACTGCAAATACGC TATAACCTGTCTCTAACTTGCAAACTAAAACATACCTACACATCTTATTG GAGATATTCTTTTTAATAGTAGCTTATTCGCAAGATTACTGGGTTTGAAG TTATTCTCTAAATAAATCATCTAAACCATCTAGGATCTCACACCATATTT TTAAATTTCTGTTAAAATGCTTTTGTTATGAAAGAAAAACAATCAACAGG CCTTTTTTCAATCCCTTGTTTTTAGTTAAAATGATTTTATGTTTGTCTTA TAAATCCTACGGCCATTACTATTCAATTTTTCTGTTCAAAATTTTTTATC CTTGTTTGTTGAAGTCAGGTCTGTGTAAGTTCCTATCCCTTTTTTGTGTG TAATTGTCGAACATTCATTTTTCGCGTAGACTGAAAGTGTGACTTTTTTG ACTTTGAGTTTTCCTGCACAAAGAGGTAAGACTGTTGGCATTCAGCAAAC CTGTACAGTGGAGTCGAACGCTCACGAGAAATGCTGACTTGTTCCAGTTA TTGAAAATTCGAGTTATATTGTGTTGTTGTTGCCTGAACTGAAGGGACCC TGAACCATGTTTGAATTCAGAAGACATTCAAGTTATAAATGTTCGAGCTA TGACGACTCTACTGTACTACAGTCATTGCGAGACTTGTTCAGGCAATATT TTTTATCAGTTGAGTGTTATGTCGTTGAAGTGATACGAAACTCTGCTATT TGTTACTTTGGTACTAATGTTTTGGCTAGTGATTTTGAAATTTAGGCTTG TCAATGTGAAATCGTTTAGATTCTTTTAACTGGTGAAAATTGCTATTTGC CAAAGCAAAGTATAAAACACTTTCTAATCAGCGTTCAGTTTGAAGTAGAG AGCATGGCAAGATTTCTTTTCAATTATAACGAATGCCTTCTAAATGTTCC TTAAAAGACGGTCGATCTAATTAGCAGACACCTTTACTTTTTCCATAATA CTGCCAGCAATGTTGGCTTAATAGTTGTTAACTGCGCCTCTAAGAATTTC CCTCATTTTTTGTTAAAGCTGTTCATATTTTGTCGTTGACCTTGGTTTAT CCTTGAGCAAGGTATGTGGGAATGTTTTTAATGATATGTTTGAAACACTC TGTATTTAATTAAACTTAAATGCTAGGCAGTATTTTCTGTCTCTTTCCAA TTTTGTTTGTAGGGAGGGTTGTTTTTGTCTTTGATTCAATTGTAAACTTT ATTGGATTGCTTTGCGGATAATGGTCACTGGGATGGTCAACCCAGTTGAC AAACAACCCCAAAGCAACGTCCTTTGGACGTTGAAACAACGTAGGGATAT TAGTTTTTGGAATCCTCTCATAGACTTTGAGGACTTCTTGCATATACCTG GTATTTATTTCTGGAGATTAATTCCTACGAAAAATCTCACTTTTTTGTAT CGATTAGTCGACTCATCTAAACGAGTCAATGAAAGGTTTTAGGATTTGTA TTTTAATGATGTTAAACTATGTACATAAGATGTATAGTGGACTAACAACC TGATTAGCATTTTGATCCTAATTCTCTTAAAGAGCATGGAANTTTAGTTT TTGGAGTCCATTGATAGACTTTCGAGGACTTCTTGCATATACCTGGTATT TATTTCTGGAGATAATTCCAACGGAAAAATCTCACTTTTTTGTATCGATT AGTCGACTCATCTAAACGAGTCAATGAAAGGTTTTAGGATTTGTATTTTA ATGATGTTAAACTATGTACATAAGACGTATAGTGGACTAACAACCTGATT AGCATTTTGATCCTAATTCTCTTAAAGAGCATGGAAGATGCATTATATCA CCTCATATGAAATTAATGCCTTATCATTTATTGATTTTAATAAGCTTAAA AATTAAGATTTTTCAAAACTTTCTGAGCATTTCAATTAATCTAAATCTTC TGTGAATCTCTTGGGGTCCGAAGACGGACGACTGGTGTATAAACAAAATA CAACATTACGCTAGCGATTTTACTTTGTTCCGATGCGTGAATTATGGATG TGTCAATTGAAAGATTCTAGTAGAAAATACCTAAAACATACAATAGCCTT CATGCTCATCATAAAACTCGTCTACTGTTTATCTGTGTTCTGTGGGTTTC CGTGTGGTTTCTATTGTTAGCAGTTTCGTGATCGAATTATAAATAAAGTA ATGCTCCATTTTGTAAACTTTTTGATTTTCGAGGTACCTTACAGTAGACT CAATTATTTAAATACCAAAGGATGAAAATGATAAAACAGTTTTTGATCTA TGGAGTTAGAGGAAAGTAAGTCAGTCGGTACTACTACATGAAAAAGGCAA CTATTGGGAAGGTGAAATAACCCGAAAAGGAAACTGTTTCCAGATTGAAA ATTTCATCACTTTTCTGTTTCCCGTTTTGGTCAAGAACTTTTCATCGTCC CCAAACGGGAAATAGAATTTTTGTGAACAAAGCAGATTTTTGTTTCCCGA TCGAGAAAAAGTTTCCAAATAGGGAAGTTTTCAATTGGGAATGGGGAAAG TAGAATTAAAAAGCGCTTACCCGGTGGATTTCTTAACTACCTGGTGAATA TTATTTATTTTCCCTCCTTTACAAGAGGGACACGTTTTAAACTTTACACA GGCAATACTGGAGTGCTCAGAGGCCACTTTCTTGATCGGTAAACTGGTAA ACTTCCCGATTTGGAAAGTTTAGCCATTTCTGGAATATTTGCTTTTCCAT ATAGTGGTTCCGACTGTAAGTGACTTTAGTTCAAGTTGTATAAAGTAAGC ATTAAGTTTGCAACTGAACGACCCGAAGGCAACTTTTTCTTTAACTGTCT CTAGCCGAAGGTATCGGACGCGACTCCTTTCCATGGATTTCTCCATCTAC TTTTGATCTGTCCCTCTAGTCGCTAAGCTGAGGCTGGGCGGTCGAACTTA CAACCTTGTGAACCGTAGCTAAATGCTCTAACTACCTTTATATTAGGGTC GTTCGAGTTATAGGGAATGGTTTAAAGGTTAGTTGTGTTTATCTTTAGGG TATATTGTTACACGTTTTCTTTTATAAGAATAAACTATATAAGAACATTA GGCTTTGATGGTCAGAATCCTAAAAATAAGTCAATAACATTTTAAGGCAT TGCGGACTCTAAAACACCCAATTTCTTAGGAAAATGAAGGCTTCAAAAAT TTTGGATGTTCTTATAAAAAAAACGTATTTACTTTCGTTTCTTGTCTTTA GATTAGAATTTAACGTTGCTTTTACTAAAAGTTCACTTAATGGAAAGTCG AAATAGAGGATGAAAGTTTAAAGCTTAGAGAAGTTGTCTTCAGTTAAAAA AGAACTTATTTTAAAATAAGATTGACTTAAAAATCACAGCCTTAACAAGC TCTCATAACAGAGAGTTTCTGAGTTTTGTGTTTTTAGTATTTAGCATATA AAAAGAAAGAAAAATATTTTGTGAAAACACATTTTAAAGTAGATGTCGAT TTGAATTTCAGGTTGTTGATATTTTTGGATTTTGAAATAATTCCTTTTCT GCACCTATGCCTGTAAGCTGTTTTGTAGTTCTTTAGAATCTATTCCTTTG CGGTTCTCCTCCGACCAAAAGGTTTCATCATCTGATACGGTGGAGTCTCT ATAACTCGAACACGCACGGGGAACACAAATATGTTCGATAAGGAAATTTC GAGTTATGGAGATTGTTTTATAAGGCATTGTTAACTGAAGGGACTGAAAG GACAATTGTTCTAAGTGTTCTCAAACTGTGCTCTTAGAATATTTGCATTA TCCACGATGGTAACAAGGGACCTGAAATTAGCATTTTCCGAAATATGAGG CTTTGATTAATTCTTTAAAACAAGCAATCGTGTATCGCCTTTATGTTGCA ATCACTTAAAATGTCATTAAGACTTGGTGCTTACAGAATATGACACTCAT GTCATATCATTCTATTTAAATACAAGTGCCTTTTAATCCCCCATCAATTC ACGTAGTCAAATAACAATACCCTTGGCTTTTAAATTAGGTCTGTAAAATA CACAATGATAATTTCTTAGGTCAATCCCATTATTCTTCTTAAATTTATAA AATAGTTCTTGTGGGCTTCTTCCAACACAATTTTATACAATTATTCAATC TAAGGCTGGAGGGAGCTCTGTCTGCGAACACAATTATACAATTAAATAAA CGCCTTTTAAACTCAAAATTTTCGAGTCCCTTTTTTACCGCTTGTTCCCT ACTGTGCTGTTACCCAAGCATACATGAATTCACCAATGTTTACTTTCTTG TATTGATGCTAAAATCTTTTTTGTGTACCTAAAATGTAGTATTTAGCTTA CTACTCTGTGCGATGATACCATAATATCTCTTGTTTTGTTACTAAACAAA CTCTAGCACAAAAATGTAAATCACGCAGTCTCTTCTCGCACTACTCTCTT TTCCTTGTCGCATACTGCACGTTTTTTATGAGAACATCCAAAAATTTTGA AGCCCTCGGATGTTCTTAAGTTTTTGGATTTTAAACCTAAAAATTTTATT AAACATGTTCTTTTATTTCCCGATTTTATGAGCATTTTTGCCTACTTTTC TAAGAAATCGGTTGATTTAGAGTCCACAAAGCCATTAAATGTTCTTAACC TGTTCTTAAGATTTTGGCCATCGAAGCCTTATGTTTTTATACAGTTTGTT CTTATAAAAAGACGTGTATACACCCACTTTTTGTGTAACTTTTATACTTT GAATGCTGTCAGTTTTTTGTTGTAAAAGACTTTACAAAAGTCAGTGCACG TTGAACTTTTTTGTTGAGTCTTTTTTACTTAAGTACGGATATAATATAAT GATATGTAGATAATGTTGGGTATTACATTTCAGATGGTTTTGTAGAATGA GTTTTTTGAGAATAAATGACCACCATTCTACAGAGGTAATGTTTTCGTTT TCTTTTTTGATACACCGGGTGAACCGGCAATAGTGAAAAATTTCTATTAG ATGGGGTCAGAATTCTCAGACCTAACGGTACGGGTCTGTAAATATCGGCT GATCTTTTTTTATGTCCGTGGCGCATTAAAGGTTAACTCATCACTCTCCC TAAAGTACAAGTACTTTTCTCTCTGCCAGTAGACTTAAAGTAGGACTCTT TCAAACTTCTAGTGAGTTTTTGATATAAACATTAGATTTTTCGTATCTAG GGAACAAAGATTTGTTCAAGTTGAGGAAATTTCGAGTTATGGAGTATGCT TTATAAAGTATTGTTAACTGAAGGGATGATAAAACTTGTTCGAGTTACAC GTTTTTTTTTTATAAGAACAAACTATATAAGAACATAAGGCTTCGGGGCC CAAAAATTTAAGAACATTCTAAGAACATACTAAGGCTTTGGAGACTTAAA AACATGCAATTTCTTAAGAAATTACATCAAAATTCTCAAAAAATGCTGAA AATAAGAACATTTTACGAACATTTTTAGGCTTCAAATCCAAGAAACTAAG AACATCCGAAGGCTTCGAAAATTTTTGACGTTCTTATAAAAAAAAAAACG TGTAAGGGGAAACTTGAGTTATAGAGACTCAACTGTTTATACTACATCTT ATTATCCAAAAGCTTTCTATTTCACCCGTCTTATTGAGAGTGCGATTCAA ACCAGCCTCCTGATGTGGGCCAAATTACCAAAAATGCCCCATTTCAAGAA GCCTCTTAATCCATTTCAAAGAATGACAGTACACACATATGTGTTGAAAA GTGAAGCAATTTGTAATTGAAGGTTTTGCGTTTTATCTTGGACTCTTATC ATAAGCTTAGTAGGATGACGAGTTAAAGCGTTACTGATAAAAAACTTCAA CGGTTGACAATATCCTAGACTGTACCAGTGTGTGTTTCTCCCTTTTTTCG TACATCAATATAATATGACTTGAAATCAAGGAGCTAGTCACGTGCTGGCT AACATTATGCTGGGAATTTTAGTTGATAATAAAACCGTCTAAAAGATTAT AAGATCTTTCTTCAGTCACTCACATAGACGTATCATAAGAAATTCACATT TTCACATTTTTTATATTGTCATAAACTGTGAACTGCGTGGACGATTTTTC TTGATAGAGAGAATCTCGTTGAAGCTTGTAGAGAGTCACAAGAGTTCTTT TGGGAAAGTCTTTCTAATAATCATCTTCGATCATTAAAGCAAACGCTCTT TGAGATTTCAAAAAACCTGGAATGCAAACATGTTGTACTCTAAAGAGGCT TTTGGTGTACCTATCTTCTGGTGATACTTTTGGATTAAAAAAGGTTTTGG CTTTGATTTCTAGGTAGGTTTAAAAACTAAAATTTTAAGATTTTACCATC AAAAGTTTGACTTTTTAATATTTGTGAGGAGTGCGATGTCATGGTGGATC TTGGTAGTTGCTAAATTCACGTTTGTGTTAGACAGGGTAGTCTATACTGG GCGTCAAGGCTTTTTTGTACGCAGAAAAGTCTATTTTCCCAGTTTTGAAG AGATATTCGCTAGAGACAGGGATGTTTGGGTATTTTTACAGCCGATTCGG TGCGTTTACACATCCTTGGCATTTGGCATCTACATTACTTGCAAGGGGGT TTTCCTTTTGTTTTAGCGTATTTTTCGTACATGGAGCCGTTTCCCCTTAA TTCCAGGCAGTGACGTAATCAACGCAAGCTGATGACTTGCACTTACTATT ATTTCCCCGTTCACGATCAATAATTGCAATGATTGGGCAAAGACTCACTA AAAGGAGAGTAACGCCCTCAACACCAACATCATATTCGTTCTCGTTCGTC AATAATTGCAATGATCGATCTCCATCACGTTCGACTTTGACAAAATCCTG CGCTAAACAAAAGAAATACTATTAAAACTATTCCAACTAATTATGATATA CCAAATGCCAGGAATGTGCAAAGACGCGCCCATTCCAGAAGAGTTCTTTT ATATGAGACTTTGGATCGATGTAATACGGTAGTTTTCCGCTGTATATTCG CATCAAAACCTCTTTAGATAAAAGAGAAATCAAGATTCAAGAGTGTATGA CATTGTGTTTGATTTGGATACAGGCTTTTCTAGACATCAACACAATCTCA CACATCTCAACATATCCCTGTTTTTATATTAATGGATGACTATGCTTTGA GGTTTATTAGGATTTATGAAATTTAAGTCTCTTTTTGATTTTTGGTTTTG TAACTTTCTATAAGGAACGCCTTATGAAAATAATTTAATGATGACCTCAC TCATCAGGCTTTCTTTTAAACATTGATTGATATTTTTATTACATTGGGCA TTTTTGATGGAGTTGATTCCACAAATATGGATGAAAAAGATAGGTCACTG AAGTTTTAAGTTTGAGTCGATTGGGTCGATCTTTTCTTTCAGAATTTGGG ATGTTAAAGGTTAGTGTATTGAAATTTTTGATACAAAACTTGAAATTTCT AATTTTCAATTTTAATGTTTTTTTTTTTTCCTCAAAAATATGGTGATAAG ATTGATCAGTTGATAGTAACCATAGTAACCATGTCACTGGGCTTTTTCCA TTTCATCATGGATATTCTTAACTTTTTGGGGAAAATCATCTAGAAGTATC CTTAAGGCTTTCTTAGGTTGGGATCCAGACCCAACCTATATTTGATATGT AATACATACTACAAAAATAATGCATCTTTGTGAAAATCTTGAGAATTGAT GAATAATTGGCAATTTGCAGTTAAAAAAGTCCCCAAAAAAGGCAGTTTTT AGTTTGATTTCCAAATTTCATGATGGTGGTATTCTTAGCATATTCTTAAT TTTTTGATCAATTTCATCATTAATATTCTTATGTAGTATAAAAAAAAGTG TGTTATTGGAATGTTTGGCAATCCGAATAACTTTGTATTCTCAAGGTATC TATCTGAGCTTGATGCATTATAATCATTTGTTTACTACATGTTTACTGTA TAGTTTGAGTACCAAATACCCAAAATTCAAGTAGTAAGTTTGCGATCGCG GTCAAGGGCGATCCGAAGGCTTAGGAGAGGGTGGTGCTACTTTCCCAGGA TTTCGCCATTTACCCTTGATCCGTCTCTCTAGTTGCTGAGCATCACCATT TTGGGAATATGTGGTATGACGTGGCTGGGGATCGAACTCACCACCTTGCG CACCCTAGTTTGATGTTCTATCTTTATGCTACGGCCGCACCTAAAATGTA CAAAATGTTTATGTTATCATTCTATAAAAATTCGTGTTAGACATCAGGTC TTATTTTCAACTCATCATGATTTCTGTTGTCAGGAGTTCACAAAGCCCTT GTTGATGTAAGTTATGTTGACGAATAAATCTCTCTATCAACACAACAATT ATTGTTATCCTTTTCAATGTGTAAACTAACGCTGTTTTTTCTACGTTCTT GAACTAACATTTTTTTTTATGAATAAAATTGGAGAGCTTGACTGTAAAGA ATTTTGGACCATTATTTTTTATATTGTCTGAGTGTGTTTGCTGATAAGAG TTGTGTCATCTTATCGTCTTGCAGAAACTGAAAACTTAACCTATACCTTG AAGATGTTTCACGATATATTTTAAGTGACTGCTGAGATTTTAGGACATTT TTACATTAGGGACAGTTTTTGGAAAAACTAAAATTGATAGAGGTTTGTAC TATTCATAGAAATTGAATTCTTATCGCTTTTTTTCACGGTGTCTTGCAGC GGTGTCTCTATAACTCGAACCTCTGTTTAGGTTCGAGTTATGGAAACTTC ACTGTATTATGTAAATCATTTTATCATCCGAAGACTTTGAAAGGCTAATG TGAAGTTAGAGCTATGATGCATCGAAAATTTTGGTATGACAATTGATATA CCCTTGTTGTATGTTGACATTTGTGATGGCATTGCAAATTATGGGTTAAG CGTCACGCATCTTTTGTTTTTTGTCATGTTTGTGGACAATGAGAGTGCAG AAAATTTTTGGAAGCTTCAGCGCGTTCTCATTTTTTTAAGAGAAAGCCTA AATTCTTTATAAAAAGGTTTTAAAATATCAATAAAAATCAACTTCTCAAG TCTTAGCAATCTAGACTCTAACTCAATTCGTAATACTCGTTTTTTTTCTC GTAAGAACATGCTCAGCTTCAGTTTGGAAAAAAATGACAAGAAACTACAA TTGTTTCCTCTTTTCAAGCAGTTTTAACTGAATTTAGGGATGGATTTTCT AAAATCGAAAGTCAAATATTGTCTAAATTTTACCAATTTTAAGTGCTCTT TATTTTGCATGATAATGTCGATGTAGAGTAGTCTGAAAAATTAAGAACCC ATTTAAGAACATTTTAGGCTGAAAATTTAAGCACAAAAAATAAGCACAGC CAAATTTTAGGTGTTCTAATAAAAAAAACGTGTTACAAATCGTGCTGTCG TGTTCAATGGCATTGAGAATGTATTGTCTTTGCTAAAGGAGTCAAGCATA AAATGGAGCTTGGCATGGAGAGTGTCCGAGTGCAAGAATTACAGCAAAAA TACTGTACTACAGTTGAATTGACGCTCTCTAATTCGATGTTCTACGTTCG ATAATACGATAATATTGAAAGCCACCGTCAGCTAAAAATTCTTCTAAATG ACTCCTTTATTCGATGAAAATCTAATTTGCCTTGAAAATCAAATCAGGGA GCGTCGACTGTACTTGGTTATCCGAGCTTCATCTGTCGTCCTTGACTACA CAGACTATCCACAATCCGAACAACTTTGAGTGTTCGCTGAAAGAGTGGGG CTTAGAGAACAAATTTATTGGCATTTTTCTCCATTGTCTATCCATTTTCT ATTTACCAATGGACCTTTTACATACGAGAGTCGGATTACACTCTTTACAC ATCATCTCTCGTATTTCACCAAAACTATATTTCACGTTGATTGGTGTATG TGTGTGTGTGTGTGTCTAATAGAGACATTTTTTTCCTCTCTCATCGTTCG CTTTAAATTGTTCAGATAGTGCTTTGTAAGCTTGTGATTGGTGACGAGTT GAAAAATGTAGTGTGTTTTTCTGTTATCAGTGAGATTTTGTAATAATATA TTTTGCGAAATGTAATGTCTGTTGACTTCATGGGCTTATCTGTTTTTTTA TACAGATGTATTTTTATGACTTTTCCAAGTTCTCCTGGGACTTTAGTTCT AATTTTGACGAAAAGAAACCAAAAAGTGATCCTTCGTTTAAGTCTTCCCG ATTTATCTTGAATCTGAAGAAAATCTCTTTCTTAAAAGGTTTTTTTTAAT TTTTAAGTAAAAAGTGTTTTACGTACTCAAAGTCTTCACTCTGTAATATC GTAGACAGTTCTGTTTAAATTTGGATTTGATCTTGCAAACAATCCGGGTA CATAATGGCTTTACCGTATGCATGAAAATAATATAACATCAAACTTAAAA TTAACTTTTAATTGAATTTTTGTCAACTTTGTTTTTCAACAAAGTCAATC ACCATATCTACAATGAAATATTTTATGATTTATACTTCATTACTATTAGA CGTTGTGCTATAAATCACATTATAGGAGAGATGACATTTTCTCTGATTTG TTTTGCAATGTGCCTCTTGCAGACTTTTTGAGGCTTCTTTTGCTTTTTTA TATCTGACTCAATAATTTTCAGTAGATAAAACCGTACAAGGCTTGGTTCG CTCTGATTAAACTGTTTTAGATTCTGAATTTGCCAGTAAAGTAGCTTTTT CTAGTGCATAAGAAAAGGAAGTTTACCTAGGTCCTCACGATAGCAAAAAA GTTTCGGACAACGGTTACTTCTTTAACATGATTCAACTTTAATTGCGCGG ACGGCTCCTGAGGGACTGGTATTGAATTTACAAAGAAATGACGTCCAAAT TCTATGTCTTCGAGGAATATAATGCAAAAACTTCAGAAATTTTGACGTCA TTCTTTCCTGGTAAATTCGAACCCAGATTCCTTAAGCGTTGACAGGTGTT ACTTACAATATGGTACTTCTTCTTAACCAAATTTTCTTCTATTTTTTCTA TAGGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTC AGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCA TGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTG GACAAAGTCAAAGAACAATTTAGAGAACATGAGGTATTCTTTTGATGCTT ACGCAACTGTGATCTTATAGTTTGAATTTGTTCCAGAGCATTTTTACATT TTTTCACTTCTCTTCTCTAACTCGAACCTCACNTCTTACGCAACTGTGAT CTTCGAATTCGTTCCAGAGCATTTTTACATTTTTTCACTTCTCTTCTCTA ACTCGAACCTCCCTCTAACTCGGATTTTTTTTAACAAACCATTTCAAACG ATCATCTAATACAAGAAATCTCGCACAAGTTTATCTATAATAACCTTTAG ACGTTCGGCTCGAATTTCAGAAATCACGATTTAATCTATATCACCCTTGA GTACAGTTACCGCTCTCTAATTCGATTGTCAAGGGTTATTGGATTTTCTC GAGTAAGGGAGCGTATCGAGTAGTAGAGCATCGTTCGTGAGAGTTTTTTG CTGATGGTGACTTTCAATATTATGGAATGATGGAGCCTATTGAATAGTTG AGTGTCTAATAAATTTTAACCAACCATTGTTTCCTTACTCTTCTTTTACT ACAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCG TATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGG GAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGA AAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGTAAGGATTTTAGA CTGCATTCCCTTTCTTTTTTACTGTCTTTTATGACAATTTAGTGAGGGAA ATTAAACCCTCCTGTTCAAAAGAAAACAGTTTTACCCAAATAAAGAGTAA CTCTGATTTTTTATAATAACAAAATATATATACATGATGGTTCGATGGCA AAAATATTAGGAACAAGTTAAGAACATCTTAAGGTTGTGCTGACTAAAAT TAAACAAAAATAATCACAAAAAGGTGACTGATAACATGTTAAGGATATTT GTAGCCTTCAAACTCAAAAAGTTAAGAACACCCGAAGGCTTCAAAAATTT AGGATGTATAATATATATGTATAAATGAAATATGTATACAGAAGAAAAAG TATGAAATAACAAAATGACATGATCACTATTGTCTTTTTGTAGATTACAT CAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTG GCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAG ATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGTA GAGTTTGTAATAATGATTTTGTAATAGTTGACGCCTTTGTATACTATTCT TGCTTGGAACAGTTCTATAAGAAAAATTTTTTTTACAATGTTCTACGGCA CGATTCTTTTTGACAAATTCTGCTTTGCAATGTATTATTTGCGAGCTATG TTCTGCAAGGTAACTCAAATTGACATTATCTGTGAAAAATGGAATATTGA AATAAGTATAACACGTCAGGTTGTTTTCTACCATTTAAAAAGCTAATATA AGACCATGTGGAGAAGTAACAGTTCCACATTGTTCCGAAACAAAACGTCC CCAAGAAAAGAAGACGTTACAAAGCAAAACAAATTGAAACGCTTTCGCTT CACTATTTTCATCAGAACGGATGCTCGATTCTCCGAAACATTCTGAAATC AGTATGAACACTTTCTAACTTACAATAGGGGCAATAAGTTAGAGTAAATT TGGTTTTATAAATATATAAGATAAATAATTGAAAACAATAACCTCTAGTT GCACTAGACACTGTAGCTAGCAGCAAGTGACAATGAGTCCTAACCTAGGG TCTAACGAAAATGACCGATTGAAAAAGAATGTAATAGCACAACTAAGCAG TTGCGCCGGGCTGTAAAGAAACAGAAACTTGAAAATTTCATAAAAACTCA ATAAAATTTATAAAAAAAAAAAATTAATTCAGAAACATTAATTATTACTA ACTCTTGAACGAGAGTTAGTCAGTTCAATATCATTTGTATTCAGTTCTCT ACTCCAAATGGAACGGGATCCACGAATACATAACAAAGACGATCTCAACA AGCTGAATATCATTCATTTTGATCGAATAAACGAAATTGATTCATGGAGA CGTACACCACGTTTTTCAGCAAGCATCACAGCCAATCTTTTGTAGAATGT TTGGCATTCACGTCCCATACCTCCGTTTGTAGAAAATACTAATGGGGTGA AGGTACCATTTTCGATACTGTTCACACGTTCATTGTAATGTCTCTTTTTC TCGTTTTCGTTTCTTTGGAAGCACTTGCTGAGCTCCAAACCCCTGTACCT TCGAGCGCTTAGGTCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNTATATTCAAAAGAGGTGTTATTCCAATTGCGTACACT GCCATACCGATCGGATCTCCTTGAGTGGTTCCTTCATTTGACTTAAGCTC GACACCACCGATAACGAAAACACTTTCTATCCGTAACAAAGGCCGTACCG GAGCGATGAGAAACCGTAACGTCTAAACATGGTCTAACCTGGTCTAACCA AAATTGACATTACCAGGAAAGATGAAATGTTGAAAAAAAAATGTAATACG TTAGCTTGTTATTCATGATGGAGAAAGCAAATCTAAAAGTACATTTTCTT TATACCTTACTTTCTATTCTACCAGGATGATTTGGAGAACCAGCAGATCC ACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCT GAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACG ATGGTCTGCTGTATGTAAATGGACTGGTAACAGGTTAGTATACGTGATAT AAATGACGTGATGTTTTAATATGGAAGCGCCCATATTAAAAGGCCGGGTG TTTTTCACTAGTTCTGAATTTGAACAACAAAAATCTGCATAAAGAAGCAC CCAAAATTATCACGGCGTTTACCACTAGAAACGCCCTGGTTATTTTGGGT GCTTTTTTATGAAACATTATGTCTAAATATCAGGAATTTCTCCATGCCTA AATAATTGTTTCAGGCATAATACACGTTTCTTTCTTGGACCATCAAACAT CGAAAGGCTTTCATGTTTTTTTGCTCTATAAGTTTATAATGTTTCCCTAA AATACCATAAGGAAACGGCTTTTTCAACCCTTTTTCAATTATCTAAAGTT CGTGGTCGTCTAGTTTAAACTAAATTCCACCTTGCTTGACACTTTTAATA GGGAAAAATTTTCGAAATTAGTCTCTCAAAGGATCGGTTTTCAAACTTTG GCTTGTCCATATATCCGTCAACTCGCCAACCCAGTAACACCCCCCCCCCC CCGGAGGGGATTCTTGAGAAAATCGCGAGGGCATTTTATACACGATTTAT TTTCATTTGCTTTCGTTTTTCCCTTTATAGATGGGAAACTCTGCAAGAGG TTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGAT TGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATAT GGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGTATCAG AAACCTTTGCTTCTTTGAGATGTCGTGGAGTTTTTACAAGATACTTCACT TTTGGTCATTTAAAGTCATATAAAGAGATGACGCGTTCTTTAGAAAAAGT AATAAGATTCTTTTATTACATCTTAACGACCAACCAAATCAAATAAGAGC TTGTAAAAACTCCAGCTTGTCCCGCTTCTTTCGGTCAAAAGTTTCTAGAT TCGATGAAATGTTAGCGTGCAAAATTTGAGAGCCAAGGAGTCATTTGCAG TATTCTTATTTGCTAAGCCAGCCCACTATTCTTCTGAATAAGTTTGAGTT TATCGACCCAGTGATATTCATATTGGAGATGCTTCGTGGTTTGGATCACG AGGTAATCAGAAGGGCTTAGTACAATAAGAAGTGAGGAAAACGCTCTCTA TATTCCCCGGTAATGGGTGAAGGCTCTTTCAAAACGTTGCCAAACGTAAA TCTCGTGATCTCAACCATGATATACTTTCGATAAGCAACCTCTTTGTTGA ATGAATTTTAACTCGGCAATCAAATATTGCGAGTTCATACAAGGAACTTG GTTTTTCGAATACTTATCAAACTACACATTTAATTTTCACAGATATATCT TACGGTTGTGTCTTTATGTTATGTATGTTGTGTCTTCAAATTTATGTAAT TACAAGAGAAATTTTTGATTGCGGAAAAGTTGGTATTAATGGTTAATGGT AAATACAGTTGACGCTCTCTAATTCAACGCTCTACCATTCAATGCGCTCT TTTATTCGATGAAATTGAAAGTCACCGTCAACAAGAAACGCATAAGCGAC GCTCTACTATTCAATGCGCTCCTTTTGTCGATGAAAATCCAACTTCCCTT GAAAATCGGATCAGAGAGCGTCAACTGTATCTCAGAGTTGGGTCTTTTGC AAAAATTTTCACATTGACGTCATTTGAGAAACTTTGTTCTTTTTCTCGAC AGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTC AACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGC CATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATA CCATTGCTAGCATGCTGAATGCCAAAATGAAGCATGTAAGTTATTTGATT ATGTCTACTCCCGAGCAAATCTATTTTGTTGGTGATGAGAAACATTTTTG GTCACAGTACTAAAGTCTGTCTGCGCAGTTCTTCAAGAAGTTAATTTTTT TCTTCTTCATTTTTCATCTTCATTTTCCAAAGCTTTTTCAATTTTTCTCT ATTTGGGACTATTTCAGTTTTCAACAAGCACAAAACTGCAATTTAATTCA AATTCTACCAAAAGTTACAGTTTTTTGTCCGATCTCAGTCCTTTCGCTTG AAATAAGAAACATTTTTGGTTGCAGTAACTATGATATTCTCATGTATGGT CTCCGAAGCTCCATCATGTTATTAAGTTTTTTGCTTATCAGTTAGAACTG TCATTTCCTTAAGAAAGAGACGTTTTTATTAGCCAAGTATTAGATTCATA ATACCTTCATAGAATGTTTGAACTTACTCTGTACCAGAGTGTATCTCACG TTTATCGCTTCGTAGTACACTCTGTGCGCATTGTCTGTTTGATAAAAGTT TTTCCGTACGGAGACCTCTGCGATGAAGTATGATTTATGAATAGCAACAC TTCCCACATCGTCTCCCCTCTCTCACCAACACTCCATCGCAGCGGTCGGT TTGAAAAATCGACAATGAAAAAAAAAGACAATGACAACAGACCCTCTACG GCAATGAATTTTGAAATAAGCCGTTTATACTGGGTTTGAGCGTAGTCTAA ATGAAATTCTGCACCTTTATTTTTCTACAGTTCCGAAGTATCGAGAACAA CTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAG ATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTC GAGGTAAATAAATATCTAAGATTTGATCATCGCTTCTATAGGGAGCTTTT AACTAACTAACCAAATAGTAACTGTAATTATTGTAAAGTTTTGAGTGTTC CGCTCTTATTTGGTCGTGCAATTTAGAAAAAAGGAATTTTAAAACAGCAT AATTGAATGACTCAGGCTAGTGAATCTAAAAACTTAGTTGTATACACAAA CATTAACTCTGAAACAAAAGTACTTGAAATTCAAAATGTCTTACGAGGTG TAAGCAACACAATTATCATTGTGAATATGTAATTTTATAGCAAACACAAT TATCATTGTGAATATGTAATTTTATAGCAATGAAATCTGTTTGAAAACGA GGACAACAATAAATTTATGCATCTCGAGAAGAGTGTATTCTACCTTGTAA ACTCGAGCTCAGTCTCCCCGTGCTTTTACGGTTAGAAGGTATGCATGACG AAGACCTACACTAAGCAGGTCGAAATATTGTTTATATAAAAAATCTATAT AGAATGACCATAAAAATGTGATTTATATTTTAAAATACTTCATTCGTATG ACACTAAAGACAAGGTACATAGGTGTAATATTGTGTTGTGCTTATAGTCT CTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGA GCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCG TCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTT TCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAA GAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGA TTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACA GAATTGCTAACCATACTCGAGGTATAACATTTTCATTTATTTATTTGTTT TGGTTCAATATCCTTTGAAATTTCTTCAACTCGGCGACGATAGTATNTTT TTCATTTATTTATTTCTTTTGGTTCGATATCCTTTGAAATTTCTTCAACT CGACGACGATAGTATCAAGTGGTTGTTTTATGCTATGGGGTCGAAAAACT TTGAAGTTCAAAACAGTAATCAAAATCAAATGCAATATTGGCTGTATGAG TTTTGCTTTCATGTATTTTTTGTACACGATTTTAGTTCTTTTCACTTTTT CGTTCGATGCAGCTCTTGAAAATGTAATATTTTTGTGTCAGTGGCCAATT GTTTTGAAAAAGCAATGCCATTGAAACAACCAATCAAATTTGGCTGATTC ATAAAGGAATTTAATCGATTTTTCTGTTTTCGTGTGGAGAAATTTTGAAG GATATTAATTTTCACTCGTTTGTATTTTGTTATCTCTCATCCGCCGGTTC TTTGTCCAAAATTCGACCAAAACCCCTCACAAACACACACGTTTAATAGT ATTATTTTGAGTTTACAGAAAAAAACTCCAAGGTCAATCTTGGAAGCTCT AAGAGATACAAAATACAACCTAACAACGACTAACCACCGCTAATTACCTT CTCTACTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCG TTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTT CGTTCGTTCGTCAATTCATTCGCTCGCCAATTCATTCGCTCGCCAATTCA TCCTTTTGGATATTCATTCGCTCGCCAATTCATCCATTCGCATATTCATT CATTCGCCCACCCATTCATTCGCTCATTCATTCATTCGCCCATTCATTCG CCCATTCATTCATTCATTCATTCATTCATTCATTCATTCATTCATTCGCA AGTACGAATTGATGTATCGTAGAGGATACGAGAATCATGCATCATAAAAC CAAGGTGAGCTCCATTATGTTATCCCACTTCAAATGCTAAATTTAAAAAA TACTTTTTCAATATCCTTTTTCAGGCAAAACAAAGCGAAGTATCACAACA CAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACC CAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAA CTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGA TCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTA TTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAA TACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGGTATA TGTCTACCCCTTGCTCATTTTTGAATAAATATTTTTAGCATCAGTAATGC CTTCTTTTGATAGTGTTTCCAAAGATTTTGCCAACTTGAAGCCAACGATC AGTCTATGTTTAAAGTCACGTGTCTAAATCAAAGCTCATTTTGTGATAAG CAATCTTCGTTTAGATATAGATTTAAAGGTCTTTGAAGGTGCAACTGTTT TACCTACTTTTCTGAATTGCCAAGTAACGTGTATGATTTTGTTTTGTCGT GAAAATACATCTTCCATCAATTTATAGTACACCTTCTTATTACCAGATGC TCTATATTAGAAAGTTTTCTTTCCCCGGCCGTTTCATAGAAAAATTCTTA TACAGTAGAGTCTGTTTAACTCGAATGTGTTCGTAACTCGAATAGGATTG CTGGTCCCTTCCGTTAAACCCTTATAAACTTCACTTCATAACTGGGAATT TCCTTAACGTGAACAACCTTTTGTTCCTCGTTTGTATTCGAGTTATGGAG AATCCACTGTTGTAATGAAAGAGATAAAAGATAAAAAATTTTCGCCACTT TAGTAGCAGACATTTGCCCAAATTGGATAAATTGGATAAATTTCCATTTC GTTCTTATTAGACGACATTGGCGAATGTTCCGTTGTTACTTTCTCACTTA TTAAGCAACCAAATTCGTCCATTTATAGGGGATGGTCAAGAACCTACAAG AACAAGAAGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATG GAGACATTGTCACCAGAAAATGCAGAGAAATGTCAGAAAGATGTATCAGA ACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGA AACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATG AAAGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAAT CACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTAC AAGAAGTCGAGGTAAGACCTCAANACGAACGATCGGATAAACAGTACTCC TCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATA ATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGC ATGCAGACATTGGCAGACGACTTGAAGGTATATGTCTACCCCTTGCTCAT TTTTGAATAAATATTTTTAGCATCAGTAATGCCTTCTTTTGATAGTGTTT CCAAAGATTTTGCCAACTTGAAGCCAACGATCAGTCTATGTTTAAAGTCA CGTGTCTAAATCAAAGCTCATTTTGTGATAAGCAATCTTCGTTTAGATAT AGATTTAAAGGTCTTTGAAGGTGCAACTGTTTTACCTACTTTTCTGAATT GCCAAGTAACGTGTATGATTTTGTTTTGTCGTGAAAATACATCTTCCATC AATTTATAGTACACCTTCTTATTACCAGATGCTCTATATTAGAAAGTTTT CTTTCCCCGGCCGTTTCATAGAAAAATTCTTATACAGTAGAGTCTGTTTA ACTCGAATGTGTTCGTAACTCGAATAGGATTGCTGGTCCCTTCCGTTAAA CCCTTATAAACTTCACTTCATAACTGGGAATTTCCTTAACGTGAACAACC TTTTGTTCCTCGTTTGTATTCGAGTTATGGAGAATCCACTGTTGTAATGA AAGAGATAAAAGATAAAAAATTTTCGCCACTTTAGTAGCAGACATTTGCC CAAATTGGATAAATTGGATAAATTTCCATTTCGTTCTTATTAGACGACAT TGGCGAATGTTCCGTTGTTACTTTCTCACTTATTAAGCAACCAAATTCGT CCATTTATAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGTCCACTAT CACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAA AATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGC AGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTA TTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGG ATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGA AGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGTAAGAC CTCTATTAGTATACCGCAATCTTGATAGATCTTTTCTTAATCACATTTTC ATGTTGAATGAATTAAAAACTTCAACACCCGGCCCTTTCTACGCCAGCCC TATTGGCGTTATTCTGTCGTCACTGGCGTAATCCGTAAAGGATTGGAATA AATAAGGGCCGTGGTAGAAATAGAAATAAGGGCCGTGGTAGAAATAGAAA TAAGGGCCGTGGTAGAAATAGAAATAAGGGCCGTGCTAGAAATAGAAATA AACCAGCCGAGGCTGGAAGGTCAGCCAATAGAGCTTAGCTAGATAGCTTT AATAAGTGGGTTAACAGATGTAAGAGATGTACTGAAACANNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAAATGAAAGT GAAAATTAGAAGCTCATATATGGCTCAAATGAAAGATATTTATCCAAGGA TTCCAAAAAATATCACAACATATACCTGAAAATCAATATTCGAGAAGCTA TGAAGGAAAATAGCTTGAAAAATGACGTCATCGATGACGTCATCGACAGT AAAAAAATCGTCGAAATCGAAAAATTTTCCTTTCGTTTGAAAGAGGACCA TCTAGTGAACAAAAAATATTACTACAAAAAAATCTGAATTACTCCTTAAA AGCCCCTGTCAGCAAATTTGTATTGTAATTCATTAAATTTGCCTTTGAAA GGTTAGCTTCGGGCACGCCCAGGAATCTTTAAAAAGCTTGAGAGTCAAGT CAAACGCATTTCACAGAATAATTTCCTATCAAGTGAAATTCAAGGTTTNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNAGGTTTTCAGTAGTAATATTTTTTGTTCCCAAGCAGGTCCT CTTTCAAATGAAACAAAAATTTTTCGATTTCGACGATTTTTTAATTACCG ATGACGTCGTCATCGATGACGTCATTTTTGAGCTATTTTCCTTCATAGCT TTTAAATATTGATTTTCAGGTATATGTTGTGATATTTTTTGGAATCCTTG GATAAATACCTTTCATTTGAGCCATATATGAGCTTCTAATTTTCACTTTC ATTTTCAAGCCCCAGCAAAAGTGCGTCACATGAGGACCAGCAAAATGGTC AAAATTTTTCTCACCACTTGTTTTTTTGATCTTATAGACCTAATTGATCA TTTAAAAAAGTTAGTTTGCTTTTAACAAGTCTGTGCACACGAAGAACATT GTAGCTCTCACTATTTGGTAGACTTGGTCAAATTACAGAAACCATTTTTC AGTTGTCTGCAAGGCCAATGAGGTATGTAAAAACTGACTGCTATTCAGTC AAAGCCAAAATTTGGCAAGGTCAGAAAAACATAATTTACATCCAGTCTTC NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNCAAAGTGAGATCGGGAAGTCGGATTTTTTTTTTGTCGTCTTATGATG ATGGAACTGGAAAATTTTACCTATTTGAATGCTCAGCTTCGGCTGACCAA TAATCGAACTTTGGTGTATTAAAGGCCGGCGTGAAAGGTGCCGGCGTTAA AAGGGCCGGCGTTAAAAGGGCCGATATGGTATTCAACATGACATTATTAT AAGGCATAAAAGATATAAATAGGCACTGATATAAAATTATGATTCTCGAG TAAAAATTTCAAATTTTAAATCCAGAACTAATTGCGCTTCTAGGTACCCA ATCTATGTTTATGTTAGTGTAATGTTTCGGGAAGAAAGATACCTGAGTCA AAAACTATAAATGGGCATTTTGACACTTGTTTGTTTTGACACTTGTCATT TTATTTTTCATTTCTTACCATTATTTCCACAAAATATATTTAGAAATTAA ATATTGATCAGAGATCTGACCTCAAGAATTTACAGTTCTCAATATACAGT TTTTTGAATTTACTCTGACACCCTAAACACCAAACAAATAAAGATAACAT AACAATGGGCAATGAAATGAATTAAAATCGAATATTAATTAATAATGAAT AATTCAATAAATTATACACAACAACCACAGTGATCTATTTATATAATCTC GTGTTATTTTTCTTTCCAAGTCAAATTTATGTCATGGAATTCAAAGTTCT TTTGAGCATTTTTACTTTCAGTGTGTCCTTGTGTGCATAAATTCGTCATT CACACATGTCCAGGCGGTAATATCATCAATATCGCGATATCTTAAATCTT AGATTTCAAGAGGCTTGAAAAAAATACTGATTTTGCTTGCTAACATCTAT TAAAAGTTTTTGAAAAAAAAGAAAGAAATTTTCAACCAAACTTTATCGAT CAGTTTAAATGTACCCCTGTTGAAATTTCTCAACTTCCGGAAATGAAGCA AACTCTTTCCTTGCATGTGTTATCTTAGCCTGTACGAAACTCTTCTTTGT GAAAATAACCGCGAAGTACGGAAGGGCACCGTTTCATTTGTGCTCTTTTT TCTGCCTCTGCGATGGAGAGATGTTTTAATTTTAACATTCGAACTACCTT AAATAAGTGACATTGCCTTATCCTCCTCAATGCAATGGTATCTTTCGTTT TTTTAAAGAGTACGCACGTGTTTTTCGATAATTTAGTACCAGAAAGTTGA TACTAACCACTGACCTTTATATGTCCCTGGACCAAGCTATATCCGCCATC TTTGATCGAAGTTTTTTGAAAGTTGGTACCCGCAAAGAAGCAATTGTAGT GTTTGAAACTTTGCCTCACGACAAACGGCGCTACATCATTAGTGTAGAAG CAAAACTAGATCTAGCGCTTTCTCCGCGGGTACCAATTTCAAAAAAACTC CGATGATAATATTTTGCTTGGCCGGCATTGAGTAACTTTGTCCAGGGATA TATAAAGGTCAGTGGTACTAACGAGACACAGAATTTCTAACCGTAACAGA CCGACCCACGGTAAGATTCTTCTAAAAGGCAAAATACGCCCGTGGGCGTT CGAGTTTGTACAGAATAATGTTATCTTGGAGCACACCTTTGACTAACTTT TCTAATCCGGGACAAAGAAATTCCCTAGCTGCCGTTGGAAAGACCATTTG ATTTTGACTAACATCTTTAGAGCATCTCAAGTACCGGGTGTGTCAAAACA CCCCTATTTTACAATCTTTGACGTACATTTTTCTATTATAGAATATAGAA TATTGATTAATTTTCTCTAATCATTAAGAGAGTTTCTTTCAAACATTTAT TGTGATTGTTTCCGAAACGTTTGTACCAATGAATACCAGTTGCTCTATCA CAAGCTTCTTGTTGCGAGTAGGCTCCGTTCATGAAATCGTAGTGACAATC GCTAAACCACCAACCTTTAAAACAATAAGTAGAAATTGCACGTCAGGATT CACACAGCTCGAATAGTCGATCAAAAAGACTACCTTATCGGCCCTTTTTA CGCCGGCCCTAATTTAACGCCGGCCCATTAAACGCCGGCCCTTATTACAT CACAGCCTGATTTTGGAGTAAAACAATGGATAATAATTTTTGTCTTCCAA TCATACCTAAAATCCTTTGAATTGAGAAATAATGATAAAAAATTAACTCC GCTTTTAGGTTAAAATTGCAAAATCTTGGCCCTTTTAACGCCGGCCCTTA TTACGCCACAAGCCCAAAAATAACGCCAATAAGGGCCGGTGTAAAAAGAG CCGATAAGGTACCAGTCTTCGTAATAAACAGCGCTAGTAGGAAGGAAAAC ATGACGTAGCCTAAAAGACGGCCGTTTGTAATCCAAATTACGGCAAATAT CTTTTTTCGACACAAATTCAAAATATTCACCTACCCTAAGGTCTCGAAAA GAACGCACCCCTTCCCCCGTTTATTAAAACTTTATTAATATATGAAATTC TCCCCTTCTTCTTATCAGGACTGGCCCCGCCAATTAGGTTCGCGGTTCAA AAGAAATTTCGGGACCCTTCCCTTTTATCCGGACTCCCTCCCCTCCTACT ATTTGGGACCTTAGAGTATAATGCTTGCCTCCTGGAAACCTAATAGCACA AGTTGGAATTGGTGTGTACAAATCGTTGTCACGGGTCGGAGTGCTGAATT TCATGCCCTTCGCTCTTTCAAATAAACTATGATTGCTGTATTGAGTTCCA CTGTAGATAGACTGGAAGTCGAATTTGTATCTCTCCATTAACTCAGAGCC GATGGTAAAACCGGCGAATCTTTTGCTCTCCCAAACACCGGAAAAATCCA TCGCCCTCGCGTATAAGTCATATGATTGCGTTGATGTCAACTGATGAAGT GTTTCAAGACCTAACCAATATTCTCCTGTGAATTTGATGAAATAAGAAGA AAACTTTAACTCTGCACTATGAGTATTTAGGTTTCCTTTATCCTACACGT TTTCAAAATAAAAACAAACTATACAAGAACATAAGGCTTCGATGGCTAAA ATGTTAAGAACAAGTTGAAAATATGTTAAGGCTTTGTGGACAACACCCGA TTTCTTAAGAAAATTGGCACTCACACTCACAAAATGGGGAATTTAAGAAC ATATTAAGAACATTTTTAGGCTTGAAACTCAAAAAGTAAAGAACATCCGA AGGCTTCAAAATTTGTGGATGTTCTTATAAAAAAACGAGTACTTCTTTAA ATGCTGCGAATGTAAAATGAACATCAAGTTTGGTCTTGATTTTCTTTTAG TTTGATTTTCTGTTATTCATTACAAAAGCTTGTTCAGAAATATCTTACCT GACCCATCTCCAAATCCATCTTTGTACTCTGCCCATTCTTTATCTTCAAA TGAAACTGAACCATCATAACGCCTTTGAAACGCCATCCACCCTCCGCCCT CGCCTTCCATGAAGCAATAAACATCACGTCGTGTTCCTAACAAATCTACT TCGTAAACGCCATTTTTCAAGTGTCCTTTTTTTGAATAATCAAGACAACT TTTACATGTCGTACAAACTTTTTCTAACGGTTTCGAATAGATCTTTGACC CCACTTTCATATCCAACTCTTTGAATTTGGTATAATACTCGTACACAAAA TCAAACAATCGACATTCGACTTTTCGAGGAACTGTTTGATAAACCTCGAA TGAGAGACATTTTTCATTGTAAACGCATTGACCAAAACATTGTCGCTCAT CCATAAGAGATACTTCGTAAAAAGGCTGCCAGGCGTACGCCTTACCAATA GCAGCATGGTTCCAAATTTGTTTTGAACATTCACACCAGTAAATGCACAG AATACCTAAGAATACAGTTCTAAACATGATTCTCCGAGAATAGAATCCTT TTTTCCTCTTTGTCAGATTTTTTGTTGTTTATGATTTGTTGCTTGATAAA CTAAAATTTTCAATTTTTTTTTGAATTATTTATTTGAATTTTAAATTGGA AACTAAATACTGAATAATATTGAATGTTAAGTTAATCTAGTTTTCTTCAC TTCAATCTAAAACAAATGGCTTTTTTGTGACGTCGTTCAGAAAAATAATG TCATAGCCTCATTGTTTTTTGGCCTTATTTTGCCCGAACAATTATAAATT CCTCCTGGCCTTCAGAAGAACAGAACAATATAAATTAAAAAAAAATTAAG ATCCGTACAATAAACCTATTAAGTGTTGCGCCAATGGCAGAGTCTTGTTT GAGTTTACCATGTTTAAAGTGCTTAAATTGTATTAACCAACTCACAGATA CAGATATTTGATGCAATTCTACTCTGTTAAAGGGACATAAAAGTACTGAC AAAATTTGTAAACAAACCGTATGCAGCGGGATACAAAATCAAAACAAATG TCACGTCTCAAAATAAAAAATAAAAACAAATATGGCTGATTTTGATTGTT TCAATTGTTTTACAAGTTTGTTTTGGACACGTGATTTTAATTGTTCTTTT TAATTACACGTGGTTCGCGCAATGTTTACATTTTACTACTTTATGTCCCT TTAAACTTGAGCTCCTCAATCCCAGCAGGTTGNATGTTTACATTTTACTA CTTTACCTTTAAACTTGAGCTCCTCAATCCCAGCAGGTTGAAGTGTGATT TATTACTGTAGTCTACTCAGTAAAGACGGTGCATTATTTTGCTTCATCTG ATGTGGCTTGAGAAAGACAGAGTAGCTCTATCTAGTGTTTTGTATAAGAC ATCAGGACTGATAAAGCTTAGGATTTATTAATGCATTTCCGAAAATTCCT CGATGTTGAGGAAAGCCCGACTTTTTTCGGAATAGCCAACATTGAAAGGT GTGCCCTTCTGATAGATGGATAGATATTTTACGTGGATAGCCCAGTAAAC TAGGAATCTTAAACAACTTCTCTCTTGATTGTTTTCACGGGGTCCACGGC CAGCTGGTTATCAATGAACTGTACAGATCAATGGTAGGGAGTTTGAATTC GAACCTCTGGATTTTGGTGCTTTCACCTTGACAATTCTGCCATCAGGCCA TGAAATAATTAATCTCTATGAAAATTTCCTTCATTCAGGCATTGCAACAG GATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTAC CTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGA GCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAA AAACAGAAAGAAAATCTTCGAAATGCGGGTATTTTGATCATTTCTTATTC CTCGGGTTCTGTTAGCATGCAGCATCACATGAAATAATCAATTTACATTC ACCTTCGTTGACGGTGAAAAGATACAACCTATTGAAAGATTCGTTACCGT GTATTTCATCCAAAATAAGAGTTTTCACTTTTCACTCAATTGTTGACCTA ACCTAAGCCGAGTACGAGCTTTAGATCAATGGTAATCTTAGCAATGCAAC GAAGCTAGTCTTAATAACGAATAAAAAACTGGGAACTAAGATTTTTTTTC ACCAGCATAATGTTCAGTGGAGAAAGATAAAACCTTTACTATATTGAATT TAAAAACAAATGATACCACAATAAGTTTTTTTAAGAGCAGAAAACTTTTC GATTTTATTAAATCATTTTCAACGCTAAAAATCTTTTCTCTACAAGATAG ATGGTAAATTTTCGAAGATATTTACTTTATTGAATTTGAACTTGTCTATA AACAGACCCGGGAATTTTAAAAATTCATTTCCGTACTACAGCACGCTATA CGTGAGATACATTCTGGTGCAAAGTAAATTCGAATACATTCCTTCATTTA CCTTTAGGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTAT GGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTC TACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGTACTG TCTCTCATATAGTTTTTTATTTGAAGTGGGAATTGAAGTTGAGTTCACTA TTGAATGTCACCAATGATTCTCGTCTTTTTCTTAAAAACTATACGTCTTT AAACATCTGGCGCTATTGCTGATTAGAAAAAAATACGCGAAATAATTTTT TTACAAGTCGAGTTTTGGCTATATCGACCAATAAGATTCAAAGAATGAAT CACTTTCGATGAACTACACAAAACTTTGCAAAATATCCTACATTTTAGTT GGAAATTCCTTAATTAAGACTTCGTCGGGGACAGAATCTCGCGTTACTTC ACCGAAAATTATGTCAGAGTTTTTTTTGAAAAATCCTCCCCGGCAAGGTA TTCCTCCCTTAAATGTACGATTCCTGTTTCCTTTAGACATACATTACACG ACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACG CCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAA CCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTT GAGAGGACGAATCGAGTAAGTTATTGTTGAATTATTTTCTTATGGAACGT TTGTGTTATGGTAAGTGACGTCATTCCAGCTTCCAAGCTTCGAAAACACC TTTTTAGAGAGTTTCTTCTGAGAGCTGACGTATTAACCTTAGCAAGTCCT GTCTGGAGATTACAAAGTATTTTAAGACCTTTTTAAAACCGGGAAGAAAC ATCCACAGGGTATTTGGATTCTAGGGGATTCAAAGGAGACACATTTAATC TTTCTTGGGGTTTTGTAAAAAATATGGTTTACAAAAATTTCGATTTAGAG TTTTATTTATGTTTTGCTTATAGTCAAGCAGATGCGATCGAGAAATAGTT TTGGTCGAGCGTAGGAATTTTCTATTTTTTTCTCGAAAAAGTCAATAAGA ACATTTGTTTTGAGTATTTGTTTTGAAAAGTTGGAAACGAAAATCGATGA AAATTTTCCATTGGAGAAGTAAAGGAATTATCGAGAGCTCAAATTTACCC TTCCTTCCTATCTCGGATTCGGATTTGCATGGCGTAGGGGAATTTTGAAA TCCTTAGTGCGTGAAAAAGCTTTTACAAGGTTTATGGTTGGTTGTTCGAA CTTTTTAATGTGAAGAATCAATCCTGTTAAAAAAATGATTCTGGAAATTT TGGAACGATTTCAATTACTTGTCTTTGCGTTCAGGTAAAGCAACATTTAT TGCATCAAAATTATTTTAATTACTCCAAAACGTAATAAAGGTGCACAAAG TTTGTACCCGGGATGGATTTCAAATTTATGACCGATTTACTTTTACATTT TAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAAT TGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAAT GAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATT AAAAGAATGTTTATCGGTTCGTTGATAGTCTCTGTTTGTCCTTGATATCA AGTCGTGTGTTTTGGCTTACTTACCACTCTTTAGAGATTAAAATATAGTT AATTAATTCCAGACATATCCATCCAAGTAAATATGCATTTTTTAATTTAG AATTGATTGTGACATAATCTTTTTTTACTTCAACCAATTAGACAATTAGA CTTATTTCTGCCCGTGTGCGTGTGCCAAGTGTCCGCTTATAGAGATGTAA TATAGTTACAAGGTACTTAAAGGAATCAATGGCAATCAATAAAAAAGCTT TCCCTTCTCAGCGAAGTAAATAAAGAAACATCTCCGTCTCAAAATTCGCA AAAACTGCAAAAATAAGTGCTAATTTCCTGTGTAAGATCTACACTTTACG TCTCAGACGAAAAACCTTGTTGAAAAAAAGTCAAGATTTCGAAATAGTGT TTTTTATTTCATTCGAACTTAACAGCTATATCTTTCCCTTTTAGAGTATA CCTGCCATTACAGCTATATCTTTCCCTTTTAGAGTATACCTGCTATTAGC GAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAG AGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATG AATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGGTATAA TTTATACCCAAAAGAAGCATCATTCGATTTACCATGTACCAGAGTATATC TCACGTTTATCGTAGCTTAGACCATGCTCGCATGTGACGGTTCCGTTTCG CTCCGAAACGAAATGAAGCCATTCTATTGGTTACATTCAAGTGTTACGTC ACTTCTAACCAATATAATGGCTTCCTTCCGTTTCGAAGCAAAACGAAACT GTCACGTGCGAACATGGTCTTAGTATGAGGATAATTTATTGTCTCTATAG CAATGTTTTTAAATCTTTCAGATGTTTTGTCTAGTACAGGACTCTATAAC TCGATCTTCAAGGATAGTTTTTTTTTGAACCAGTGGAATGTATAAAGATT ATCAAAGCTGATGTTAGGGAGAAAATTTTAGTTTGAATTTTTAAAAGCCA AAAATAGTAGAGGCTCTAATAAATGGAATTACTAAAATATTTAGTCCTGA ATCATATTATGTTTGGAGCCACAATTGTGTCAGTAGTCCAGGATTTCATC AATACTTTTTTCACTTTTTTTATGACGCCTAGGTTCAACTGATGTTTGAG GGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGA TGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGAT CTGTCGACCTCGAGGATGACTACATCGAGGTATGAGATAAAAAACTTAGC AAGGTTAACAATGCGAATGGAATCTTCAAAGAATTTTTTCAAGGAAATTA AACAATCCTCATCGCAATGTCGGGGTCATAAGGTGTTCTGATTTTTTTAA ATGAAGCTTCCAAGATGAAGATCCATAGGTTAAAGAACTCATTATAAAAT CATATTAGTACTTTTTAGAAAATATTAAATTACACAAAATGGGTGCATGG TTAATTTTTCCCAAATTTTTACAGGGTCTAGAAGAGAGTATCTCACTAAA CGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTG CCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATT GAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAA AGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATA TTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAA GTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTAAGAACTGCAGA TATGTGTAAAAGGCCCGAAGGTCAGGTGCATTATGTGTGCCATGTCATGT TGCCTGACAGACAACCAGGGCTTCTTCCTCGACAACGTTCCGTCTCTGAT AGAGATAGGCTAGAAATTTCGCCGGTTTGAGGGGATCACGTTTACCGCCT ACTTGTCTTTGAAAGCTATATTCAATCTATCGGTACTAGATATTAAAGTT AAAAATCCCGCTTCAATTTTTTTCTGGAGAAAGGTTAAAGTCAAATCTAC ACCATTGGCAATGCCAATCTTTTTATTGTATGGATAGACGTTGAGAGAAA ATTGATCTGTATTCTTTTTTTTTTAATTGAAATACATCTTCTGGAGCTGT CAAAGAATCTGAAATCTTCCAGCTTTTCTGTGCATTTCAACAAACCAACT TAATTTGTATTACTAGACTTTCCTCGTATTTATTTGTTTAGGAGCTTGCA AAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAAT TGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCC AAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGA GAAAAGGTATTTGGTTATTTCCTTACCCCTTGAGAGCTTAGTGTTTGCAA GTGTTTTTAATTTATCCGCCTTCATTTATTAGGCTTCTGCTCATCCTCCG ACGAGAAAGTTTCTAATATAGGAAATATATCTATAGAGGTCTGCAATTCA AGCTAGTCATTTATCAGTAAATTGATTTAACGTTCAAATCTATTCAAACC TGGAAGGTGACTTCTCAAAGCATACATAAATTTCGGATTTTTTTAGGTTT TTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACA CTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCAC CAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGTTT GACTTATATGATAATTACATATTTTGATTCTTGTATAACTGACTTTTACA TCGTAAAATATCGAATCTACTAAGATAAGTATATGATAAGGCTATCATTG TGTCTCACTAACATTCTGCCGATTGGTAGTGTGAAGGTTTCGGTCACAGA CTTGCACTGCAATGGACTGTGCTCGAATTCCAAGTACTTACAGGCAGTAT GTTAGGGAAGCATAGTGATAGACTCTCTACCTTCACTCGTACATCGAATC TGCTCTTTCCTTTTTTAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGA AGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGG ATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAA GTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAA ACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTGACTGAATTTG TGGCGCTCATCTTTTTTTTGCTTTAAACTATCTATAATGGACTCTCACTG ATTCGAACTTCCTTTGTTCGAATTTTTTTATCATTCCAACAAAGTGGGTT CCCGACATTAGAGTTCGAATTAGCGAGAGCCAACTGTACCTAAAGTCTAT TCACGATAAGTGTGCACTCTTTTTTCTTTTACCTATAACTTTTGAAGGAA TTCTTCAATCTTTATAAATTTGGTATCATTGGAAAGATATTANNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNATCATTTTCACTGGAGAGATTCTTTGATCTTAGGAGATCATCA CTGTGAAGAAATTTCATTAAAATGTTTATTCAATATAAAGTTATGATACA AAGTTAATAAGTGATTGACCCCAAAAAACAGCAAAAAACTGCAGAAAACA GCGTTTTTAGACGTCAATCAGCTTATAACTTTGTTTGATATCTTTTGACT GAATAAATATTTTTGAGAATTTTTTTCACAGTGATGACGTTCGATGATTA AAGATTCACTTCAGTGAAAATGATAGTTATAGCACTTTTCTACAAGATCT TAATTTTTTTCTTCTTCTTTTTCATCTTCATTTTTAGAATTTTTTTAAAG ATTTTTTTATTTGAAATTGTTCCACTCACTAATATCTTTCCAATGATACC AAATTTATAAAGATTGAAGAATTCCTTCAAAAGTTATAGGTAAAAGAAAA AAGAGTGCACACTTATCGTGAATAGACTTTAGTTTATGGTTTATAGTTAT TTGACTAAAATTAACGTCTTTTTTTTCCCTCAAATAAAAAGTCAGCGTGC TCTGTTAAATTGTTTTATAATATCATTTGATATTTAGACTCACAAGTTGA ATTTTAACTAAATACGTCATTTTACCTTGTGCAAGGCAGAGTACCTAGTA TTGAACGATACTTTGAATTCTACTAATTTCCCTAAATGTAGTAGTCTACC ACTTGAAAAGTCACGCCGCCACTTTAGGCTGACTTGTTTTAATCAGTAGT GCGGTCACTCTTAATCACCTGCAATCATTAGAATATTAAAAATCTACCAA AAATATTTGTTTCATCATTTTTTGAAACCCGCATGCTACACACCGTGTAG AGAGTTGCGTGTGTTTTGGAGAAGTTTAATTTATGGTAAGAGAAGAACAT ACAACGTTAGTAATACTTTGTTATGTTTTGAAAAGTTTGCAAATTTACTC TGGAGTGTTCTTTATATAATAGTACAGTTGAGTCTCCATAACCCCTGCGG GGAATACACAAATTTTTTGCAAATTTTGAGATATAGAGTAAGGTTTTTTT TATGGCATTGTTAACATTGAAGGGACCAAAAAACTTGTTTGAGTTAACGA TACAAGTAATAAATAGAAGTTAGAGTTAGAGGGACTGTAATACAAGTCAT GAATAAAATACTGTCTCCCTTTGATTTCCGTTGCCATACCCTTTGCATTC GAAATCTAACTTGGAAAATATTATAAACCGGATTTTGTTCTCTAATATCT CTAATATCTTTAAACACAAGGTTGACGATTTGAACACGTGGATCGATGGC CGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAAT TGAAATGGAAACACAAAAATTCGAGGTAAATCATGTAAATTTAGATTGAT TTTGGGTTGTAACCTAAGAATACCGTATGGATATCCATGATGAAATGGAA AAATACCATTCTTATAAAAAATAGCGTGTAATCACTTCGATCAACTTCGA CGATTGGATTGTTTGATCAACATCTCTTGTTTCGAAGGGTCCTAAACTTA GGAATTATTTTTGAGTTGAGGCAGCTTCATATATTCTTGCACTTGAACCT TTAGCTTAGGGCAAAAAATAAACTCTCCTATAAATCGAGGCTTGCGTCTG CTTATCATAATAGTTCCCTTAATTAGTTTTTACGTGTCACTTTGTCAAAA TCTAAGGTTCTCAAGTAAGCATCTTATACCTAGATATAGTCGCTTATAAA GATACAAAAGGGTATTCTGATAATTATAGGGTATTAACAACTATCATTAA TGGATAAAAAAGTAGGATCAATTTGTTTACTGAAAAATAAATCATTAATT GATAAAAACAACATTTGTCTTTTATAGAAGAGCTTACCTTTTTGCAAAGA ATAACGCTTTTAATGATTGATTAAAAACAATTTTTTTTGTAGAGCTTGAA ATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCG GCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAA AGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTAT TGACGTCATGCTTAAATTGAAATTGAAGGTTTGTGTGGNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNGTCGAGTCTCCATAACCCCTGCGGGGAATACACAAATTTTTTGAAAAT TTTGAGATATAGAGTAAGGTTTTTTTTATGGCATTGTTAACATTGAAGGG ACCAAAAAACTTGTTTGAGTTAACGATACAAGTAATAAATAGAAGTTCGA GTTAGAGGGATTTGACTGTAATACAAGTCATAAATAAAATACTGTCTCCC TTTGATTTCCGTTGCCATACGCTTTGCATTCGAAATCTAACTTGAAAAAT ATTATAAACCGGATTTTTTCTCTAATATCTCTAATATCTTTAAACACAAG GTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCACGCTTGAGAG CATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAAT TCGAGGTAAATCATGTAAATTTAGATTGAATTTGGGTTGTAACCTAAGAA TACCGTATGGATATCCATGATGAAATGGAAAAATACCATTCTTATAAAAA ATAGCGTGTAATCACTTCGATCAACTTCGACAATTGGATTGTTTGATCAA CATCTCTTGTTTCGAAGGGTCCTAAACTTAGGAATTATTTTTGAGTTGAG GCAGCTTCATATATTCTTGCACTTGAACCTTTAGCTTAGGGCAAAAAATA AACTCTCCTATAAATCGAGGCTTGCGTCTGCTTATCATAATAGTTCCCTT AATTAGTTTTTACGTGTCACTTTGTCAAAATCTAAGGTTCTCAAGTAAGC ATCTTATACCTAGATATAGTCGCTTATAAAGATACAAAAGGGTATTCTGA TAATTATAGGGTATTAACAACTATCATTAATGGATAAAAAAGTAGGATCA ATTTGTTTACTGAAAAATAAATCATTAATTGATAAAAACAACATTTGTCT TTTATAGAAGAGCTTACCTTTTTGCAAAGAATAACGCTTTTAATGATTGA TTAAAAACAATTTTTTTTGTAGAGCTTGAAATCCATGGTAAATGCAAAGG ACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAG GGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTG GGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGA AATTGAAGGTTTGTGTGGTCTTTTTTACATTTCCTTCATAGTTCAACTTA CTTTTTGATTTGCATTACTGCAACTGTAAGTGTGCATTTTTTTGTTGCTA CCATAAAAAAACCATCTTCAAGGGAATTAGCAATCTTTTACCCAGAGCCA CTTGAATCACTTGTTAATTTTATTAATTTCATATGATGTTACAACCTTTC GTGAGCAATCATAAAAAGCGAACTAAGGGACTGGTTTTGAGTTTGGGGAA TTAGACTAATTACGCTGGTATGGAATGGCCTTATTTTTTCTGTTGATTTC TGACGAAATTTGCGTTGACGTAAAATGATGTGATTTCCTTCTTTTGCTGG TTACTGTATTAAAACTTTAACTTTATGGCTACGTAATGGTTTCTTTGCCT TATTGAACGCTGGGAGTCCTTCACTCTAAGCTACCTGTCTGAACAAAGGT GTCACTCACAAGCATAGATATTTTATACAAACATGAGATGGAACTTTTTC GTCTCGAGCTGAAGCAAAAAAATGCAGGTCGTTTGCTTTGATTGAAAAAA TCGTCAGTCTATTCAACAAATATGGTGCATTATTTTTCTTGACTGCTTTT GATTGGTAAATACAGAGTAGTTCTATCTAGTGTTTTATGTAAGATATCTG TGGTCACAAGGCATTTTCTATTCATGATTCTTTTTCTATTTTCTTTAAAT AGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAA GAAAAGAAACGACTGGTTGCCGATGAAGAGGTACGATTAACTTACAGTTG ACGCTCTCTAATTCGATTTTTAAGGGGAATTGGATTTTCGTCGAATAAGA GAACGTATCGCATCGTAAATGAGAGTTTCTTGTTGACCTTAACTTTCAAT ATTATCGGATAATGGGGCGTAACAAATCGTGGAACGTCGAATTAGAGAGC CTCAAGTGTACTTTACTTTTTTCATCGCAAGTAAACTGAACCAAAAAGAA TTACAGTTAACATTCTTCCTAATTATATCAAAGGATCGAGGGGATCATCC AATGATTTTCTTTGAAATAGAGGAAGGTTCGGATTTGATGAAGTTCAAGA CTTTCCAAGCTGAGGTGTGTCCAAGTGTGTCAGTTGTGATATCTAAACTT CGATCCACAAGGCTTACTAATGAATCCTTAGTGTTAGTTAGCTAAAGGAT TGTGTTTGTTTTTCTTGAGGAAAAGAATATACCGGTTCAAGATCGTTCGA AAATCGTTCAAATTGCGACAAAGACACATTGATTTCCAATGCTAACATAC ACGTTAGATAATTAGTTTTTTAGAGGATACTAATTAATAGTAATAGCTTT TCGAATGCAACCAGCTAATTAAGAGTATATAGGTTTAGCATTGAGATGTA AATTTTTTGTATCTCAGAGAGAAGGTAGTTGAAGAATCGAGTGCATTTTT TTTTGTTTTCTGAAATTAATTTTGTTACATGTAGTTGTTCCAATAATGGT TTGGATTGGGTTCTGGTTTTCCTAAAAATTTCAGTATTATTTGGACGCAA CATTTTAGGGAGCTTTTCTGAAAGAATGGAAAGCCTTTCGGTTAAAGGTA TAAAGGTTAAAGGTTATTTAAATTAATGGTGGGGGAGAATGGGCGAATCG ATTGTTACTTGTTATTTGGTATTTGAGGTTTTGAGTTTTCAAGTATAGTT TGATCTGCGTGGATAACTTTCTTTGCATTCGAATTAATGGTGCTACAGTC TTCTTGAAGAAAAACACACACTTTTTAAGCTTTTTTTACGATATAATTAA CCAAGATTATGACATTTGTATGCAAGCAATTTCCGTGAAACAAGTTTGCA TTTCCTTTGCGAAAAAAAACAATGAAATTATACTCGCACAAGTAAAGNAA TTTCCGTGAAACAAGTTTGTATTTCCTTTGCGAAAAAAAATTGAAATTAC ACTCGCACATAGCAAGTAAAGAAGTGAAGGAGTTAGAAAGTTAATCCTCT CCACTTCTCAGGACACAATATTCATTCAGACAGCATTTTTAATTTCGCTT AGCGAAAGTATTACGATAGCCTTCCGTGTATGTATGTATGTGGCGAGACA TTTTTTGGGGCGCAAATTATGGCGTGGNCGTACAAAGGACATTTAGATCC AGCCCACCATACACCACTGCACAATATGCAGCAGTCCCTCTTTAAAATGA TGACAGTTTTTTATCCGATGAATTTTGATTGGTGCTAGATGAGTTTGGTT AGTAAAAGTTCCAGCTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTATCACAAGTTCCTTCAAA GCACAAAACGAGGTTTCTGGCATCAAAGAATGAAAAGTTCATTTTTTCTT TTTCATTTTCAAAAAAAATTTTAATTATTTTTCTCAAGTATATTGCAGTT CTCTGAATTATTCTGAATTGAAAGATCTTGTTTACGCTTTATAGTATGGA ATTCTTTAGTCGCATTTTTGAAGGAATCTTTTTTTTAATGGATTGAGATT TTTCATTAAAAAAAAACAGGGTATCTATGACCTGTGTGTACAATATATNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNTGTGTGTACAATACATTGTGTATATTTTGTGTAACGCTTCATTCA AAATGCATAATGCTGCAGGAGTCACGTTTCACGCGTCTTCGTCGTTGATG TTCGAGTATTATGCGAAATTTTCGACTTCAAGTCGTCTTGTTTGTATGTC AACGAACGCTTATAATCCTGTCTTTTTCAAAAAATCTTTCTTCTGGGATA AGCAACAAGATTTTCGAGTTGTCCTAAGTAGCACTTAATAAAAATAGGAT TTCAGCAGGATTTCAATTTTAAAGACTGTTTGTCTGCGTCTTACACGGGA GAAAGTAAGGTTTATTCATTTTATGTTTTTTTTATCATCTACAGTGGCTC GTTTTGTATGCTCTTGACTCTATGACGAATAATAGTAACCACTTCTGCTG ATATTTTCTCCAAAAGTATTATAAAGTTTAGTTACATGGTTGGACTTCGA CAGTACGTTAGACGCTAGTACAGTGGAGTCTCCATATTCAAAAATTTGTT CGAATTATGGAAATCTTGAGTTTTGGAGATTGGTATATAAGGCATTGTTA GTTAACTGAAGGGACCAGAAAACTTGTTCTAGTCAAGGAGACATTCGAGT TATAGAGGTTTGAGTTATGAAGACCCCACTGTATAAAGATTTTGAGGTGT ACATTTGAATCGTGCAATCTTTCCGAAGCAGTAAAAAATTGTGTTTATTC TGTTGTTTGCTTATTTTTCCTTTCATTGGCAGTGTTGTACTACAACTAGT TGATATTAATGTGTTATTTGCCCATTCAAATTTTTGTACCCTAGTTGTTA CTAAAAAAAAACATTTTGCAAATCTATTTGAGGGTTCATTTTTAAGGCCT TGTTGCAAATCATTTTTAGAATGTTTTGATATATTTTTATATATTTTTTT AGCTTTTTCTCATTGCAGCTTGTTCTGAACTGAAAAAATTTCTTTTACAC GAACATAGTTGAAATCTCTTTACAACAGTACTGGTATCTCCATACTTGTC TTTTAAGATTGTATTTTGAGGGATAAGAAGCATAAAGTGAAAAATTACTC TAGTTAATTACAGAAAGTTTTTTTCCCTTTATACAGAAAAATGTCCTTTC CCTAAATGGTAGCCAGGAGAAAGATCAAAGCAGTTGATGATTATGATTTT AATTCAGTAGAATAACTAGAGGTTCTTCATTTTGCTTTTTTAGGTCATTC TAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGAC TTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATAT TTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAA ATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAA CGAGAAGAGAAAGGTTGGTCTTTTTAACATTTTTACTGTTCCCCTGTTCT GTAATTCGATCACATGCTAAGAGTAGTTCGAGATATGGAGAGCTCGAGTA AAGCTATTTTCGGATGCTTAGTGCAAATGATAGTTTACGAGTCTAAGGGA GAGTTCTACTTTTTTGGTTGGCATGTTGTCACAGTCTTTTTGGGGGACAC AGGGCCCATGCCACCAAGGCAACAAGGGCTATGTTTACTTGGAAGGGACT TGGAGTAAGTTCGTTGCTTGCAGTAGTAGAGTGTCTACTATAGAATTTAG AGTCAAAAGGATGGCCCCAATGACAATCATCTTCAGGAGGTATTAGGCGG GACACAATTATGAGAAAGAATCACCCAGGTTATTTACAAGAAGGAAAAAT CACTTAGATTTTTTGGTCACCGTTGGAAACACTTCAAGCATTCATTGAGA ACAAAAAAGTATGAAAAAGGAAGAAAGAAAAAATTGAAATCCTCAGTCCT CCTGTGCTTTGGGTTTAATCCATATCAATGAATGAGATTTATTAAGTAAG CAAGCAGTGTAATCTCTCATCTGTTTTCAAATGGTATCTGACAAGATTAC ATAAAAAATGGATCAATACGATACTTTTTCATGTTATGTTTGTTAAGGAT TCAAAAGGGATAACATACGATTATAATTTAGCTTCAATAATTTAATGAAC AAGTTTATTGCTCATTTGGCTCTCCTTGAATGTAATATCAACTGTGCTGC ACTGTCGGGCTCAATCGAACTTGCTTTCGTTTTCAAAAATAAAATGGACA TACCTATCTATAGTACATTTTTCCTATAAGAACTTTAATCAAACATTGAG GCAGATTTTTGTCAATGTAACATTGAAATGTCGATACAAGTAAGGTGAAG AAGTAAGCTGGACATGTTTTGGATAACCAAATTGATTATTTCGAAACTGC AAACTTTCCTTATTCCTATACTGGAAGGTGTCATAAACCTTCATTATCCC TTAGGTTGTTCTTATAGAGCTAGTTTTTTGTGTTTTCTATCCTTTAACAT TGGACAACTGAGTGTCAAACTGTTCAAGAGAAAGTCTCCCAAGAAACAAA TTTTAACAAAGTTTATGCTATATGGGCTGCTCGTTTTTTATTTTCATACT GTAGTTCTTATGATGAGATTTGGAGAGATGTATTTCTATCAAAATAGAAG ATTTTTAATGAAAATTTTTTTTATATCAGTGCCGGGAGACAGACAACATA TAAGTGATATTTTTCATACGTTTATTTCTGTTCATAATAATCAAAGTTTT ACTATGTTATTATTACACACTGATGATTGAAAATGAAGAATTTCGCATTG GTGATTGAAAATGAAGAAGAGAAATTTACTTTACTTTAGAGATTCCAAAA GCAGAATTATATACTGTTATTGAAAACAAGAAATCGTATGGAATCATTTT TTCACCAGTATTATAGTTATAGATTGGTGTTATGACGTGTTATGAAAATA TCGAAGAATTTTTTCAAGAGGAGATTATTATGATATTTTGAAAATAAAGA ACCCTAGAGAACCTCTTTTGCTATTTGGGGACCAACAAGGACAGAAATAA AAAGGGGAAATTAATTCAAGAAATAGAAAAGAATTAAAAGGACAACAATA AAAGGACAAGGAAATCTTAAAACAAAAATGAAAATCTTATCGAAACGTAT TTTCAACAAAGTCTTTCAAGCTCATGGTGTGTTTCGTTCTTTGTTCGATC TCATTTCTTACAGTTGACTCTCTCTAATTCGATCTTCAAAGGCACCAAAG ATTTTCTTCGAATAATAGAGAGTATTTTGCATGGCTTCCCCTTGACGGAA ACTGGGAATCATTTCGAATTACAGAAAGATTCGAATAATAGAATTTCGAA CTGGCGAGAGTGCATTATATTTCTTATTGAGTACTTTTTCTATACACAGA AGGTCTTATTCGATGGGCAGGGCATGTTGTGCTGCATTTTTCCAAGGAAC TAAGTGATTTAATCAAGTCAACTAAAACTCCCTGAGCTCTCTCTAGAAAG ACCCGTCGTTTGTTAAACCTAATATTTGATCCATTCTCATAGAGACCCCA AGGTAACTTATAGATGCTTTCTCTAGATTTTAGCTAATGCGATGGAGAGA AGTTAATACGATAGTCCACCTTACTCCAAGTCAATCTTCTGCTTTTTGCA ATAAGTTTTAAACCGAACTCTGAGGTCAATGATATGGCAATGTTGTTTGG GAACCTTGTCACAAACTCGTTAACATAGTTGTAATAGTTTTATCCTCTTT CCCTTTCCCCGAAACTAAATGGTGGTCTAGTCGAAAATATTCTTAACAAC GTAAACTCAACGAGATTGTCTCCTCCACAGATAAACTTCATGATTTTTCA TGCATCTTTGTTTGCTTTTCTTCATTGCAGTGAGCGTCGAACGTGACTTG GATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTT AAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGG TATGTATAGCCTAGAAATCTAACCCAGATTGATTCAGTCACTTAGTAAAA TCTGATGGTAAATTGTGACTGAATATCTGTTTTTCGAGGCAAACTTAAAA TTCCGTACGTATCATAAAAATCATTAAAGCGCCGATAACGCTATATTGCC TTCAGCCGTATCTTAGCCTTATAGAAACTGGCTTGGTTAACCAGGCTAAG GTATATAGAGAAAAGAAGAAAGGAATACAGTGTTTTTTTTTCACTTTTGC ACTTTTAAATAAAAGAGACAACATTTATTGTCCACTAGTTTTCCCTTCCC TTATTCATTTTCTAGAAAATTCTATACCCCTCATTGTATTCCTTGACAGT ATTTTCAACAAGTCTATAGCCCTCTTTACATTCTTTGAGAGGATCTTCCA CACCTTGATACTTTAATCGCCATCCATGAGAAGCTTCTTTATTTGTAATG CAAATGACTTGNAATCTTCAACACCTTGATACTTTAATCGCCATCCATGA GAAGCTTCTTTATTTGTAATGCAAAAGACTTGCTTTATTCTGCTATCTGG CTATGTGTCAGAGGTTTGGTACAAGGAAATTTGAATTCTCCTAATAAAGT CAGCTTAAAGTCGATTTATTAACATATGAAGCTAGACAAGCTGGCTGATG TTTTTAAAATGGTATCTTCCTTTCATTTTTTATTCACTAAAGCTCTTCAA AAAAAATTATTTTAAATTTACAAAAAAGTCTTCTATGAACGAATAAAAAA GAAATTTTTGATATGTGCCCTAGCAGACTCTCATGATACTTTTAGTGGGG CTTTGGGATTTTTTGTGATACAGTTGGCTCTCTCTAATTCGATTTTCAGG GGACCAAAAATCTTCTTCTAGATAAAGAAAGATTCGAATTACAGAGAGTA TTTTATACTATTTTTCAGCTGAGGGAACCAATATTTTAGTTCAAATTGTA GAAAGCTTCAAATAGTAGAGGATCGAATTAGAGACTGTTGTTTGTAATAT CAAACCTGGTTATTTATAAATTTTGAGCGTCAGAGAGTATGAATTTTAAA ATGGATCGCAAGTTCGATTTCATCTTTAAATTAAAAATGATGCTTGTCAT CTACCTTAAGGTACCTTTGTAAAATGTTTTCTCTTTTTCAATTATTTACT TCATCAAAAGCTAATATTGCATTACTGCCGCTTTCTGTGCGATTACCTGC TAGTAGCATCCCTTTGCTAAGACATTCCTTCCGTCCGCGCGTCTAAAAAA TCATTTTGATAAAATACTTCCGCGCGTGCGAAATTTGATTTCAAATTTTG TTTCACGAATAAAATTCTTAAGCAAACAATTGATGTTTAAATGTTGCGTT AGATTAGAATATCGTGTTTGGCTAAGAAAGAAAAAAAAGAATAAGATATT TTTGAAAGTAAAAACTCACATGAAATGAAAATATTTTAATGTTTTATCGT TTGTCAAAGGTCAAAATGATAATTGTATATTAAGCCTCGTTTTGATGTAG CCTCGTTTTAAAAATATATAAAGAATGCCAGGAAGTGAACGTCCGTGCTC CATTGATCTCTATTTTCAGAAACTGGAAGACCAACTCAACTCGTTGCAAC CCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTA GGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAG TGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAG ATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGG TTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAA AATGAAGGTATGCCCGTAAACACGTGTTTGCGCTTGTGGTGAGCGGAGAA AAATAGACTACTCCTCAACAGGGTCTTAAGAATAGACCTTTTCATAAATT ACTTTACGGACATCACTTGCCTCGTTTTGAAATTATTGCCATGTATGGTG ATTAACTCCCGGCAGATTTTATTAAAACTACTTTCTATCTGTTCATTAAA AAAATCGTTTATGTATCATGAATACGAGGCAAGTGATGAAAAGGTCTATT CCAAAGAACTAAAATTCTGAGCGTTACTTCTATCCGCAGACACGTGTTTC TCCCTTCCCAGTACTCATCAGTGTGGCTCCGGTAAGCGAGAACATATATA AATAAACGGATCCGTCCCTCGTAACTTTTGGTTTGACAAACTAAATAGTT CTCTAAAGATATCTTTTCCTTACCTTAAATTTTCCTGTCCCTTCCTATCC TATGTTTGAGTTTCCCCTACAGTATTCATCGTTGTTCGTTACTTATTTTG TACACAAATCTTCATTCCAGTTCATTGAAGAAAACATTGAAAGATACGCA GCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATG TGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAAT TCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAA GGTTTGGAAGTGTTTTCGTCTATTTCCTCCATGCCGTAGATCACTGACCT TTATATACCCTGGACCAAGCAAAATCTTTGATCGGAGTATTTTGAAAAGT GGTACCCTAATGGCGGCACTACTCAATAGCGGTGTAAATGCATCGAAAGC GCCGCTAGGTCTACTTTACCTCTAGACTAGAGTCTACTTCTGGCTGAACT TTGCTTTTTGATAATTTTTGATGACGCNTAGGTCTACTTTTCCTCCAATA CTTTTGATGATGTAGTGCCGTTAGACGTTAATTTTTAACATCGGGTACCA ATTCCAAAAAAACTTCGATCAAAGATGGCGGATATAGCTAGGTCCAGGGA TATATAAAGGTCAGTGCAGTAGACACATCCTTAAGGGAATTTTGGTTTAG TATTTTTACCCTTGTATCTCTCAATATATTCTTTCAATGATATCCTGCCT GGAACTGAATGGTTGGGATAGAATTGTCTAGAAGTTGATCAACATTTCTG ATGGTTGTTGACAGAAAGGGGACCGTAGATTTCACTTAAAACTAATTTTC AAAATAACATTCTTGCCCTTTACAACATATTTCAAGGCCTTTTAAATTGA TTTAACTTTTTTTTCTCCATAGAAACCACCTACAAAATCAGCGTCGAGAC AGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTAT TCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACA AAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTC ACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACG AGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAA CTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGA CGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATA AAGAAACTGGTGCGTTACTTTANAGGTGCCGTTTTACGTGAAATCCCTGT TGGTGCTATGGCCCTTTATAAAGAAACTGGTGCGTTACTTTAAGATTCCA TTTTTCAATTTTTTTTTAATCTATCACAATGTCGAGTCTCTTACCTCGGA CTACAACTCGAATGTCTCCTAAACTCAAACAAGTTTTCTTGTACCTTCAG TTAACAATGCTTCCATACTCCATAACTTGAAATTTCTATAACCCGTGTAA ATTTGTGTTCCCCGTGTGGGCTTGAGTTATATAAACTCAACTTTATATAC GATGGGCGTGTATTAGTAAAATACCACAGGGGATATTTTTTAGAGCCCCC TTCAAGGTCTTCTAAAAGTAACCGTAATATTGTTACAATTGCTTCCTCTA AAGAATGCATTGTTTTGAAATTGGTCCCTTCACCGGCTACAGTGACGATT ACTTTCAACAAGTTCGATCATTTCTTTTCAGCTCCAGATATCTTGGCCCG TAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGA CCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATT CAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGA GTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTT TAAAAGTAAGATGATTTTTTAACATAGCATGTCGGGTCTTCCCTTATCTA GCCCGGGGCCACTTATAGCTTTTTGATTGACTTGAGAGATCCAAATTTCG GTGGTGTTTTCATATTTTTACTATATTTTTATAAACTTGGGGTTTAAGAT TACTATTTTATTGCTTTGATTGATGTTTTTATATAATTTTTGAAAACGAA AGTGAAAAATTCCAAGATGTCGATATCCTCTATTCTACTTAGCTGGACCC GTTTGGAGATTCCTCGAATCACCAATATTTGAGATGAATTTTTTTCATTT TAAATTTGTTCTTAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTT CGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACG CCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCG ATGGAATGCGCTGGATAAAGAGTTTCGTCACAGGTATGAGTTCAAGCCAT TTTGGTCAAACTCAGCTTTAAGAAAGCGCGGAGACAAAACCCTATCTTTT TAAATCTACGCTTTCTGTCTGCATACTTCTTATAAATTTCAAAAATTGGA ATATGGCAAAACCATTGCGTTCTAATAGATTTAGAACGCCATGGGCAAAA CCAAAGTTTGGCCTTTTTAAAAAGACATTCAAAATTTTTGAAACCTTCGG ATGTTCTTCTTAAATTGTTTTTATTTTCACCAGTTTTGGTGAGTATTTTT ATATTTTCTTAAGAAATCAGTTTTCAGAGTTCGCAAAGCCTCAAAATGTT CTCAACTTGTTCTTAATATTTTGGCAATCAAAGCCGTATATTCTTATATA GTTTGTTCTCATATATAAAAACGTTTACTAACGTGTACATTTCTTTCTAG ATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATG ATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGA GAGAATCAAAATGATGATGTTGAAAAGGTTTGCCAACTTGTTTTGTTCTC TTTTTCAGATGGATTTCCGATTCAGCGAAGTAAATAATTAGGCTTTCCCG TCTCAAAATACTGCATAACTAACTCGCTCAAGTCTCAAGAATATATGCAA ATTTGCTGTGCAAAAACCATTTTTCGGGCTCAGACAGGTAGAAAACCCTG CTTTGACCACTGATTGTGTTTTCCTTTTTTCATTATTTTATCTTCACGGT AGGCTAGGGGCTCAAGTTGTGCTGCTGAATCTGTAACATCATCGAGGAAC CATTAAGATAGTGACACCATTAGATTCTCTGACTACTTCTAAAGACTTAT TTTTAAACAACAAAGTAATTCAATAAAAGTTTTAACAGTGATGTTTCAAA ATATCAAAAGAGACTTCACTTTCAGACTACAATGCAATGGCTGAACTTGT TTCAGAAGTAGAAAGAAATCTTAAAACATTCTACGATTTCATTGAGCTTC ATTTGGATTCAGAATATAGTATTTTAATAGTCTATAATATTAGCGGGATG CTAGTTATGGAAGCTTATTTCAGATCACAAGACTAGACAGAGTCTTAGAA CTAAAAATCATCTTGTCTAATCATGATTCACAAAGATAAAAAAGAAAGCT TAAGATGATGAATTAATCATTCTATAGACTAGAAAGAACCGAGAGGATGA TCACTACTTTGGTCATTAATTGTCCATTCTGCAAAATTTAAATCTCACTT TTATATCTTCTACAGCACGCGTGGTTTGCTATTTTCTAAATCAAATAATT CTCAATTCATACGAAACAAAGACTTTTAAAAGTCGCCGGTTTTAAAAATT AAAACAAATCGATTTGGTCCCAAAAATGCAAAACTTTAAACTTTTAGGCT CGCAATTTGTTAACTTTGTTTACCATTATGTAATTGCAATAATTTGGCAT TAGTCAGTTTAGAAAATTTCTATATTCTTATAAAACATGTCTACTCTATA AAGAATACGATGACATCATTTTTCATTAGTTTTGTTTGTTTGTTTATCTA CACAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAAC CTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGC TGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCA TGAGTGGATTGAATAGCAGGAAGTTGGGGTAAGTCAGTTTCATTGTTGTA TATTTTGTATTGATATTTGAACGTTTGAAAAAACTTGTGAACTAAAGATA AGCTAATCCATTGGTTTCAACTGATGATTTTCAACAAACTATCTTAGAAA GAGAAGAAAAAAGTTTTTTTGAAGTGAACCAAGAAACATTCTACTAATTA CTCAAGTATAGAATAATTTAGGGATCGGGCTATTCCAGAAATAGTCTGTA CCCCCTATGTTGAGGTCCAGGGCAGTCTGGGAAATGAAAAATCTAGGGTT TTCTGGTTTTTTCGAGTTTACAAATCCAGGGTGGTCCAAAAAATAAGTAC AAAAATCCAGGGGGTCACCTTCCCCAAAAAAGACCTCTTCGACATAGGGG GTACAAATCTTTTCTGGAACAGCGAATTCCTAATTTAGTATTGGAAGTGA CGCCACGATTGCACTCTCTTGTCATTGACCTAGAAATTTTTATATGTCAA ATTTCCTTTCAGTTCGCTACTCAAAGCTGAGCTGATCAAGTGCTTTAAAT ACAGCAAAGTGAAAGCTCTTAGAGCTTTGTCCTATATAGTACTAGCTTTA CTCGTTAAGCCTATCATCAGCTAAAATATATGTAATGGTTGTAAAGAAAA AATTCTGAATATTTTTATAAAAGTGATTTTATAAGAACAATCTTATAAAC AATATTTCAAAGGTTTTGATTTAGTTCTTTCAATAAATCCTGAAGAAATA TTTCTGGAAATTTATGTTTGGTAAAATGTCACAAATTCCTAACTCTTATA TCGTATAGATTATTAGTTTAAAACCAACAAAACTATTCTTGGGCCATTCC ACATTAAGTACTTACATACCTTCATGACTGATATACGTCAAAACCTTTGG CAAAATGCGGGGGCGAGCTTATTGTTCTTAATCTGCACTTAAGAGTGTTT TCTCCCTGCTTTTTTTGATTTTGTTGTTCTTGCTCGAGAGCTTTTTTCAG CTATGCAATTTTTTTTGTAGAGTACAATTTTTTTAGTAGAGTTCACTTTG ATTTAGCTGTATACACATTTTTACTGGAGAGGACTTTAAATTAGTATTCG TTTAGATCTTGTTGGTATGCGAATAAAGGTTATTATGATATTTGTTCGTT TTTCATTGTGTTTAATCACACAGATCGGCATTCTTGACTACACTTTTTTT TACAAGAACCAGGAAATTTTGACAAGGCTCGTTTGTTCTTATTTTTTGGT ACTTTCAGCGTCAAATTGTTCTTATCCTGTTCTTATTTATAGTGTGAAAT TGAATTATTTCATGATGTATACCCAATGTTTACTACTTTGACCCCTAAAT TGCTTGAAATTGAGTCAGTGTTCAAGCATTGTTCTTAAATTGTTCTTATT TTTGGCGATTTTGAGCCTCGTTGTTCTTATAAAATTGTTCTTAAAAAAGG AAAAAAAAGTGTATTAGTAACATATCATATATTTCATATTCATTAACTTT CATCTCTCCCTTTAGATCCCTAATGGATGACCCAAAGATCAAAGAGTTTG TTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTG GTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATA CAGGGATGACCTCAAGGTATGTGCTTTTGTACTTTTAATCTTTTGCTGTT GTAGATCTTTTGCGGAAAACCTTGGACAGCCATCCTATAGAACAGGATGA CTAAATCAAGGAACTTTAATAAAACAGATTAAATTGGAAAATAAGCTGAA TTTTGCTCTTCTTTTGTCTAAAATGATTTATGATAATTTCAAAGTCTGTT CTCGTTAACGGTGTATTTCTTTATGGCCTTCATACGAAAACTTTGTCAAT GCCAGTAGACTAACACCTTCGAAAGTGGTTAATATGTGGTATGAAGAGAA ATACACAATTTGTGAATAGACTTAGCTACTAGCTAATATTTTGCGATTCT TTTTCTCCTTGCACAGAAATGTGAAAATGATTTGACCGATAGAAGGGATG AGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGAT TTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCA AGCTCAAGTACAAGATCTGACCACAGGACATAGTATGTCTCTTAGTTTTT TGGTTGTTTGTTTTTTCTGGTCATTTTGAATGCATTGCTCCCTTTTTTTA TCCAGTAATTCAGTTTTCAATTCCGTTAACCTTAGAAGATCATTTCCTCT ACTTTACCATTACTGAATTCAATAATTCCAAATTATTTTAGTTTTTTTAT GTTATTTTGATTCATGCCGTCCGTATGAACTAGAATTATCAGCCAAAACT TCTAAAAATTCAGAAAATTGATTTATCAAAATATAAATGATTGTTTTCTC GAGCATTCAAAATTTCATTCATTGTTTTTTTTCTTCAAACTTTCAGGCAA ACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTG ATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTG GAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGGTATT GTTGACATTGTTTTTTTTGACTCGTAACTCTTTTTTTTCTGATGATCTTA TAAATTTTAATTAACTCTGATAACTGGAGATATTGGTCGTGAGATCTTTC AAAGAACCATGAATTTTCTTAGTGTTTTTAATTTAAAAAAGGAATAAGCA CTGTATTAAATGAATGAACCTGAGAAATATTATCTCGCTCAATTTACCTT GATTACCCTGATTACCCAGATCACAGCGATCCGCCAGTCTCTCGTATCTT ATCGCATCAAGCCTTTCATAATCTCAACAATTTCTCTCATCACAGATCAT GAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACC TTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCA CAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCAT TATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCG TCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGAT TCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAA ATATGAAAGTAAGAGAATTTTTCCCAAAGTGAGTGTCTAGGATAGGAAAT CTTGGTCAAAATTTTAATGATACCCTCGGACACCCTATGGTTTTGATCAT AATTCATGTTATGCACTATTGCAATGTCTTCTGGTATTATATCACGGACC CAATAGCTGATTGGTTGTATACGTAAAATCAGTCAATACGTCACTTTCAA CCAATCAGCTATTGGATCCACGGAAGACATTGCAATGGTGCATAGCATGA ATTCATTCAGTTAAGCCGTCTGTAATATTTGTACATTATATTGTATCAAT TAATCTGAGTTGCTCGTATTGTCTCTTCTTAGCAGATTCATTGGTAAAAA TAGAAAAGCCCGGGAAACAATTAATCTTAAGTGATTTCCTAACAGTATCC ACTTCCAGAAGCAATAACACCAGGCCTTCAGCGATTCGAAATAAATGGTG GTGGCTCGATCTAATACGCTTCATTGGAACTCTGCGATCCTTTCTTGGTA CTTCAAATTTGGTTACCCATGAGTCTACATGGGCTACCTTATCTTTGAAA AAAATGAAACGATAGGTCGCTTTTGTCGTAGTGCGTTTTATTACCTAGTA TTATATATGCTTATAATAAAAATCAACAAAAAGTCATCTAATTAGACCCA TCATTATCACTTAAGATTGTTTTCAACGGTAGGAGGTAGTTATAGTAATT ATTTAAAAAAATTTTTTTCCCTTTTACAGTGTATTCTTCAACGAACGAGA ACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGA TTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGA TGAAATGGCGGCTGCCGTACAAAAACAAAACGTAAGTTGGTGCTGATTTA TGGGATTGAAGAATTTTAAAACCCTTTTTCATTAGGTCTTGTATTGGTTC AGTGGATCCTCTCTGTGTCAAAGATTTTTATAAATTGAAGTTTGGAATTT CTCTTTGAATCTACCTTTCAAAACAGTCCTTTCTATGGGCGAAAGTTTAA ATTTGAAAAGGTATTTCAGCTGACAACGTTCTTCCCTTTTTCGTTCTCTG CATTTTAAAGACTATCATGTCTAGTGTTTTTACAAGTTCTTTATAAATCG AGTCTCGTCGGTTTGTCAAGCCCTGCTGTGATGAACCTACCGAGTTAAAC TATCGGTCCTTGATGAAATAGAGAGAGATCACTGTACAAATATTTGACCA ATCAAATTGGGTTTAAACTAGTCATAGCTTTCACTAAATGCCCACGCAGA AGATCATGTCAAGCACTTAAAGCTTTTAATGCTTTAAAGATTAAAGTAGT AAAAATAATCAGGAATAATTGATTGATTTAATTATTGAATGATTGATTAA TTAATTGATTGAGGCATTGTTTGAAAAAAACATTATATTCCATTAACACA ATAGACCTTTTTTTAAAGAGGCAGCCATGTTGAATAATTATGTACTCCAG CATAAAAACAATGATACAGCCATGCATAATTTTTGAAANNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATATATTT CAAAAATTATAGTATCATTAGCTTACTGGTTTTCACATCTTGTTTGTTTT TTTTCTCCCAGTTTCTTTCTTACAACAATATATGTCATTATTATTATTAT TCACAATAGACCTTTTCTGATAATGCCGCAGACATCTTAGATTGTAGGCA AAATATATAGCGGTGACTGAATAAATAAAAAAGGCAACCAATCAGAAATA GCTTGTTTTTTTTTTCATTGGCTGCTATAGTTCAACATTTCTCTGTTGCT ACTTTGCCTAATAAACAATAGTCAAGAATACTGCGTATAAAATTTATCAA AAAGTTCTGCGCCATCTTAAATTGGGTGAAATAGAAACCAATCCTAGTTA AGGCCCGGGCTCCACTTGCGTANNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACTAAATTACAGTA GTTAGTATTCAGTTTCAAAGACAAGAAACTAAATTTGACATACCAAACAC TTTTTCCAGTCAATGAATCAGCTCATCATTATAACCTTCCATTATAACCA GTCTGCCATTTTGTTTGTTTTGATTCGCACAAGTAATATTGTAATTTGTG TTATATCATACACCTGTTATAATTTGCATTTATAACACTNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNCTATGAGTGCCTCCTCGTCGCTGCGCTCCTGCGGGGGCAAAAA ATTTAGTCGGAAGAAAAAACTTTAGAAATTAGTTAAAGAAATTGAAAAAA TTTGTGATTGTGGTGACTTTTTATTTGGTTTTGAACATAAAGAAATGGTA CGTCAGCAGCCCTCCGAAACACTTCAAACATCAGGTAAAACTAACTAAGA ATCAGAATATGTCTTTTCCACGTCTCTATAGAGGACGTTACCAGTCAAAA ATAAAACCTCGAGCTTATGAATCTTTCTTAATTCTATGCTTGCGTCGATT ACAGCATCTCAAATTCTTCTGAAATTTGGTACGAAGATTTGTCAAGATTT TAGCTACTGTATTGAAAAAATGTTTTTAAAATATTTCCGGGACACCTACT AATGGTTGCTAGTCATTTTAGGAAAATAATGATAGCATGTACCAAACTTT TCTTAATGTCGTAAAGGAATGGTCAAAAAATCTAATTTTTTTTTAGATTC TACACGTTTTTTTTTTTATTAGAACCCAGTTTATAAGAACATTCAGGCTG AAATTCGTCGAAAAATTAAGAACGTCGCAAGAACATGCCCAGCCTCAGTT TGGAAAATAATGACAAGAAACTACAATTTTTTTCTCTTTTCAAGCAGTTT CAACCGAACTTAGAGATGGGTTTTCTAAAATCGAGAGTCAAATATTGTCC AAATTTTACCAATTTTAAGTGCTCTTTATTTTGCATGATATTGTCGATTT AGAGTAGTCTGAGAAATTAAGAACGCATTTAAGAACATTTTAGGCTGAAA ATTGCTTAAAAAAAGCACATCCAGGCTCAGCCAAATTTTAGGTGTTCTAA TAAACAAAAAACGTGTACTCGATAGCCTCCCCATAAACCAAAAGTAACTG TGAATATTTAAAATATTATTACCAAACGAATCTTTAAAAATTAATTCTTG AAAAATATCATTTTTGATGACGCAAGTTTTGATACTATTTTCATTCAGTT TTCAGTCGATATAAAGATTTTTTGACAGGTTACACGCAGTGTCGGTTTTT CTTAACTCCCCTGTCACGTAGAAGGATCATTTTCTTTTTTGGGTATCAAA TATTTAAGAAAAAGATTGAAGAATTTTGGAGAAAAAAATACTTTTGGGGT TTATCCATGCAGAGAGTTTTAACAAAAATATCCATATTTTGTGGGTATAT GTTAGTTTTAAGGCGGTACCAAAAGCAAAAGGTGTTTTTTTTCTTTTAAG TTTTATTTGGATTTTTCTCACCCTTCTCCAAAAATCTTTGACGATTCTTG TATTCATTACTTATTTGTTCAATCATTAAATATTGAAATCTTCATTTTAT TTGTAAAAGAATTTTGATAAAATATCATTTTGAAAAAAGGTTTATATAGC TGTCTGTTGTATGCCGGAGAAGGTTGTTTTTTTATTTTGAAAAGCTAAGC TTTGGTTTATGAGCGACCATAAAGCTTTATAATTGATCGATCGGTAAGAA ATCGGAATCTGAGACTTGGGCCATTGGAACCTTATAAGGCTCTAAAAAGG ATTCATGACTTGAAATCGATGGAAAATTACCAATTTTATATTTTCTTCCA AAAAGTACACCAAAAACTTGTTAGGGAAAAATTGTCTGAAACCTTTAGAC TTTGACACTATAAATTTCATTACTGAACTTTTTTCATACCATAGTCCATC CAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCAT GGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAAC ATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAAC CAAGCTCTGGGTAAGGCATTCTTACACTTTTGATTCCGAATAGAACTCAT TCATCCGTTCGTTCGGCTACGTCAAATGCACCCCTGTCTCACAGCCTCGG TAAAACTTTTTTCCTCACTGGGGATAAATTCCTTTTGAAATCCCAATGGG GATAGAAATTCTATTGTAAAAATCCAGTGGATATGATTTTGGAGTACAAT TTTCAAACATTGAAATTTCGAATAGGGATAAAATCAAAGTCAATTTCCCA GTAGGCTAAAATTCAAGGGTATCTTCCCACTGGGGACGAAATTTTGCAAA ATTTTCCAGTGGAATTTTCTTGGGTCCCAGCGGGGACAAATCTTCCTTTG TTTCAAGCGTGACTCTTACTCTAGTAAGGCCTAAAAGTCTTAAGCTGTCN CGGAGAAGGTTGTTTTTTTATTTTGAAAAGCTAAGCTTTGGTTTATGAGC GACCATAAAGCTTTATAATTGATCGATCGGTAAGAAATCGGAATCTGAGA CTTGGGCCATTGGAACCTTATAAGGCTCTAAAAAGGATTCATGACTTGAA ATCGATGGAAAATTACCAATTTTATATTTTCTTCCAAAAAGTACACCAAA AACTTGTTAGGGAAAAATTGTCTGAAACCTTTAGACTTTGACACTATAAA TTTCATTACTGAACTTTTTTCATACCATAGTCCATCCAATTGGAGATGTC AAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCAC CACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTA TGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGGTAA GGCATTCTTACACTTTTGATTCCGAATAGAACTCATTCATCCGTTCGTTC GGCTACGTCAAATGCACCCCTGTCTCACAGCCTCGGTAAAACTTTTTTCC TCACTGGGGATAAATTCCTTTTGAAATCCCAATGGGGATAGAAATTCTAT TGTAAAAATCCAGTGGATATGATTTTGGAGTACAATTTTCAAACATTGAA ATTTCGAATAGGGATAAAATCAAAGTCAATTTCCCAGTAGGCTAAAATTC AAGGGTATCTTCCCACTGGGGACGAAATTTTGCAAAATTTTCCAGTGGAA TTTTCTTGGGTCCCAGCGGGGACAAATCTTCCTTTGTTTCAAGCGTGACT CTTACTCTAGTAAGGCCTAAAAGTCTTAAGCTGTCTATTGAGTAGACTAC TGAAGGCTTTCTTATTCATTTGTTTGGCTAATCTCAAACGCATTATGCTT TAAAAAGTCAAAAGCAAACTGATTTCAACAGCGCTTAAGAGAATTTCCTC ATGGAATTTGTTAATCCGAAAATAGATTTCTGAATTTTTTGCTCCAGGAT TAATCAAACGAGGCTTCTGTAGACTCCTATGTCGTCTTGTTTGCATTTCT ATTTCCGCTTTGACACCACAGGCTTGTATGTTTAGGATTAAGGCTTTCAA CGAACGAATAGCTGAAGTATAAAGTTTGATATTCTGTCTATCCATTGATG AGTTGAAATTGTGATCTCAGTGATAATACACAAAGATTTTTGTTGCTGTT TTTCATGACTTGCATCATGTACTAATTTCATGCTAAATCAAAACCAATGA GTTGTTTGTAGTTATACCTGATTGATTGCCCTTTTAATCGTTTGGGTAAT TTTTGATGAATTGATTGAAGCTAAACTAACTAATTTTTTTTTTTTTTTTT TGCTGATTTCTCTTAATTTCTTTTTTTTCTCTCTCTCCATACCTCTAGTT GATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTA CAAAGCCGATATTCAATTGAACGAAAACCAACAGATTGGTACTACCGTCA CCGAACTAGAAGCACAACTTGAAAAACACAAGGTGAGTAATTTTGTACTG CACCCTGTTTTTGTTCGGTTTTTGTGTTTTTATAGCGAGTTTATGTATTT GCACTTTCGAGGACGGTGGCAAAGCGACTGAAGCGATTTAGAATAACCTA ACCCGGTTCTGACCCATAAAATCGAGGACGGTAAAAGTGCTGATTTACCA TCGTCCTCAGTTCAGTTGATCAGGATCTAAACAAATCAGAAGCTAACCGT CTCTATTGCAGAAAAATATACAAACATAAACTCGCTTACATCATCAGGCT GTAAATTAATTCTGGATAAAGATAAGACTTTTTTTTCTGTGGAGAATCAG TGCACTCTTACCTTCTTGGTAAGCTTAATATAAAACATTCCAAAAATAGT TATCGAATTATGACCTAATGCACTCGTGTCATTTATACTGAAAGAAAAAA AACCACAAAGTCTTAATATTAAAGAGATCTGGGTCTGAACTACACTTCTC TATCTTTCCAAGCACACTCTTCGGTAAAATCAAGTTTGGAAGAGAGGTTA CTACCAAGCAGTGTTGAAATCTTCTCTATCTTTCCAAGCATACTCTTCGG TAAAATCAAGTTTGGAAGAGAGGTTACTACCAAGCAGTGTTGAAATCTAC TCTATCTTTCCAAGCATACTCTTCGGTAAAATCAAGTTTCGAAGAGAGGT TACTACCAAGCAGTGTTGAAATCTAAACTTGATATCTTTCTATCTGATTC ACTCAGAATTTGTTTTCCTCAGGACGAATTAAGAATTTAAGAGTTGTTGA TGTCTTTAGACAAAGTAATGCTATGATGGTAACCTTTGGTGGATTTGTTA ATTATTGCATTTCTTGCGTATTTCCTGCTTATTGAGACTTAAAATATAAA AACTTGCTTTTAGTATTTTGGCAGTCGAAGCCTTACATGTTCGTGTATAC ACTTTTTTTAACAGAACCATTAACATTTTGCTGCAGCTTGGCTGTTCTTA TTTTTTTGTCACTTTGAGCCTCAAATTTTTCTTATCCTGCTCTTATTTTT TGGAGATGTTGAGCCGTATTGTTCTTATGAAAAATAAAGTGTACTATATA TCTCAATGTGGGGGTCCTATTTTGGAAGTCCTTCAAATGTGTTGAGTCAT TTTCTGAGCAAAGATACCAGCTATTCCTTTGATTTGGACTATGTATCACC TCTTTCGCAGATGCTTTAACTATTATCAAATGTCATACCAGCAGACAAGA TTTTGTTCGGAAACTCGAACTCCCTTATCATAATCTTGAGCTCAGCTATA TCAGTTTCATTGTTCCAATTTTTCGTCTCCCCTATTATTAGTATAAAGTN CTGATTTCAACAGCGCTTAAGAGAATTTCCTCATGGAATTTGTTAATCCG AAAATAGATTTCTGATTTTTTTGCTCCAGGATTAATCAAACGAGGCTTCT GTAGACTCCTATGTCGTCTTGTTTGCATTTCTATTTCCGCTCTGACACCA CAGGCTTGTATGTTTAGGATTAAGGCTTTCAACGAACGAATAGCTGAAGT ATAAAGTTTGATATTCTATCCATTGATGAGTTGAAATTGTGATCTCAGTG ATAATACACAAAGATTTTTGTTGCTGTTTTTCATGACTTGCACCATTTAC TAATTTCATGCTAAATCAAAACCAATTGAGTTGTTTGTAGTTATACCTGA TTGATTGCCCTTTGAATCGTTGGAGTAAATTGTGATGAATCGATTGAAGC TAAACTAACTAATTTTTTTTTGCTGATTTCTCTTAATTTATTTTTTCTTT CTCTCCATACCTCTAGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACA ACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAAC AGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAG GTGAATAATTTTGTACTGCACCCTGTTTTTGTTCGGTTTTGTGTTTTTAT AGCGAGTTTATGTATTTGCACTTTTGAGGACGGCAGCGAAGCGACTGAAG CGATTTGGATAACCTAACCCGGTTCTGACCCGTAAAATCGAAGACGGTAA AAGCTGCTTGTTTACCACCGTCCTCAGTTGATCAGGATCTAAACAAATCA GAAGCTAACCGTCTCTGTTGCAGAAAAATACACAAACATAAACTCGCTTA TATCATCAAGCTACCAAACTTATTCTTGATAAAGATAAGACTTTTTTTCT GTGGAGAATCAGTGTACTCTTACCTTCTTGGTAAGCTTAATATAAAACAT TCCAAAAATAGTTATGGAATTATGACCTAATGCACTCGTGTCATTTATAC TGAAAGAAAAAAACCACAAAGTCTTAATATTAAAGAGATCTGGGTCTGAA CTATACTTCTCTATCTTTCCAAGCATACTCTTCGGTAAAATCAAGTTTGG AAGAGAGGTGTTACTACCAAGCAGTGTTGAAATCTAAACTTGATATCTTT CTATCTGGTTCACTCAGAATTTGTTTTGCTCAGAGCAAATCTAGAGTTTA AGAGTTGTTTTTTGATGTCTTTAGACAAAGAAATGTTACGATGGTAACCT TTGGTGAATTTGTTAATTATTGGGTTTCTTGCGTACTTCCTGCTTGAGAC TGAGCTTGAGTGGCTGAAGGAGGAAGTGTTTCTATCATTAAGAGCTGATA TTTACACCCTTTAAAGCATGGCGTTCTAAATCTTAGAACGCTATGCTTTA AAGGCATGCCATTTTACCGATAGGCTTGCATCAGTGTAGTGGTTTGTTGT GTCTAGTACTACTGATTTTTATGTAATCATGTTGGTTTTTCTGAGAATAG AATGAATATTATATACTCTATTTCCTATAAGAACATCCAAAAATTTTAAA ACCTTTGGATTTTCTTAACCGTTTGAGATTTAAGCATGAAAATGTATTTA TATATTTATTTTTTTATCATAATGTATAAAGTGTTATAGGTGTAATTGTG GTGTTTTAAGTGTCCATTAAGCCTGAAAACATTCTTAACTTGCTTTTAAA GTCTGTCCAGATATAATTGGCAGTGGAAACAAGAATGCCTGTAACTTTTG ATAGTCAAATATAATTATGGAAGTTTTTTTTGCTTGTTTTAGAGAATCAA AAGCGCTTTATTTGAATGTATTTTTGGTTGAAAAATTCGCGATTTTTAGT GGTTAAATTTGCGATTGCAAAAATTGAGCTTTTTTTCTACTTATGCTATA ATGTTCATTTTTACACCAGTGGTAGTCCAACCTTAGGTTAAGAAGTTTGA CAAATTTCAAGGCAAACAGAAAAGTCCTTCGGAAGATATGGGACCCGAAA TACCCCTTGGTAGCGCTTTTCTGTGAAATATCAAATCTCCAACTTATTAC TAAAAACGGGGGTAGTGATATGATTGATAAAACAGTTTTTCGATCCTAAC ACATTTTACGATCTTTTTAATGACCTCATAGCCAAACTGTGTTTAGTGTT TTGGGAATTAGCAAAGTTCTTTAATGACTTAAAAATAACAAAGGCAATAT AAGTTCATGCTTATCTTTTCAATAAAAACAATTATACTGTGATTTCACNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNGCTGCGTTTAGACCAGCCTGGCAT TTGTAATTACTTGCAGTATTCTTTTGAATTCTATTGTTCCGTGCAATTGT TCGGTTTGTCAAATGCCTAATGATGCCAGCTTGTTGGTATTTCGTTGGCC TTTGAAATGCCATTTTGAGCAAAGGAATCCCCTTTTCTGGCATTTCAAAT CAAACAAAGGAACCAAAACAAAGAGAAAAAATGACATTTTTGATTTTTTA NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNGGAAATTCCATGCTTTTCATTGTTTGATCTGTCAAAGTTGAACTTG AGGGAATCACCTTTTCAGTAATGACTCTAAAAAGACGATTCCTTAAATGC CATGACAGAAAATACAATGGAAAAGCTATTAAAATTGAATCCCTCATGAG CAAATGCCAAATTACAAATGCCAGTTGGTCTAAACGCAGCCAATGCAACA CTTAACATTTTCCAACTTTTAATTGCATTGTTCAAAAAAGATAACATATA ACCCCCGTTTTTAGTAATAAGTTGGAGATTTGATATTTCACAGAAAAGTG CTACCAAGGGGTATTTCGGGTCCCATATCTTCCGAAGGACTTTTCTGTTT GCCTTGATATTTAACAAACTTCTTAACCTAAGGTTGAACTACCACTGGTG TAAAAATGAACATTATAGCATAAGTAGAAAAAAATCTCAATTTTTGCAAT CGCAAATTTAACCACTAAAAATCACGAATTTTTCAACCAAAAATACATTC AAATATAGCGCTTTTGATTCTCTAAAACAAGCAAAAAAACTTCCATGATT ATATTTGACTATCAAAAGTTACAGGCATTCTTGTTTCCACTGCCAATTAT ATCTGGACAGACTTTAGTATTTTGGTAGTCGAAACCTCACATGTTCGTGT ATACTATATCTCGATGTGGGAGTCCTATTTTGGAAGCCCTTCAAATGTGT AACTTTAACAAGTCATTTTCTGAGCAATGATACCAAATATTCCTTTGATT TGGACTATGTATCACTTCTTTCGCAGATGATTTAACTATTATCAAATGTC ATACCAGCAGACAAGATTTTGTTCGGAAACTCGAACTCTCTTATCATAAT CTTGAGCTCAGTGATATCAGTTTCATTGTTCCAGTTTTTCGTCTCCCCCT ATTATTAGTATAAAGTGTAGTATCATAGTCGGTATAATTTTCTGATACCG TTTTAGAGTCACTATTACATTGTGGTTTAACAAGAAAAAAAGTTACGTTT GAGGGAGCTTATTTCATTAAAAATACCTGTGATTTAGTTATGATTTGAGT ACATTTATGGCTGAAAACATTTCTTGCTATTGGGCTTAGTACTAATCTGG CTTTTTGATGCCATTTTTGCAAGTTTGTTTAGGTTTCTTTCCTGTGTTAA GTACTAATAGCTGTCTCTGCTTTGTCACATCAAGTCAAATGTTATTTTAT CTGCAAGTTGCGAATATCTTTCGTTTTGTCAAAATTTGATTTTGCATTCA ATTTTTGATCTCCTGTGCCAAGGTTGCTGTTATCTTATTCGACTCGCTAC TATTTCTATCGTTCATAACTCAAATAGTTTCTAGGTTCATAAAGAATTCT AGTACAGTTGACGCTCTCTAATTCGATTTTCAAAGGGAATCGAGCTTCAA TCGAATATCCCTATACGTATCGAATAGTAGAGCGTCGTTTACGAGTGTTT CTTGTTGACGTTAACTTTCAATATTATCGAATAATGGAGCGTATCAAAAA GTAGAACTTCGAATAAAAGAACATCAACTATATCTGCAAACCTTCACTGC TTCTAAATATAACAGGAACAAAATCATCTAGCTTTTCTCTCTCGGTTTAC CCAAAACATTATAAATTGTCAAGGGGAATGATTTTGAAAATTCGCTTTTA AGAAGCAATGGCTTCAGCTCTAAACCCTGTGTTATGCCATAAAGTTAGCA TTGCTTCACAGATCAAAATGCTTCTGTTTTGATGTTTAATGTTAGTCGAG ACATCTTACTTATACCTAATAAAACATGAACTATGATTTTTAATACATTA CTTTCCTTATGCTAATTTAAAATTGAGTGATATACAGCTTAAAGTCATCT CACAAAATAGGTTTTTAATACGCGGATCAAATAAGCCTTTATAATGTGCA TTGATTTCGAAGGGCTTATCTTAATTCGATTTTTGAGATATGTCCTTCTT TTGTGTGAATGCTCTCTGATTTCAGTTAGTACGCATTTTAAAAATCTCAA TTTGCTATTTAGAAAAACCCTTGATAAAAAGGTTGTCTGGTCAAATAATT GATAAAGACACGATTAAGTCGTTCTGTTGAAAAGCTTACGAGGAGCTCAG TTTAGTTTTAGTGGATTTCAAAGATCTCCTTCTCTCATAGATCACTTGGT CAAGTATTGATCAAGAGCTTGTCTTGTTCGCCGAAAGGTTCTTTTTTGTT GTGAAATACTGTCCATCGCAGATAGTTGTGCAAGAGTGCAACAGAAAAAA AGTATTAGCAGACACTCAGACAGACAGACAGACAGACAGACAGATAGACA CAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACA GACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGA CAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACA GACAGACAGACACACAAAATGTTCTGTTATGGTCTGCGAAAAGAGTGTTG TGGAAACTTGTATTCATATAACTTTATTTCTTTTCCTTTTCAGAAATTCC AAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTA GCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAA AACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGGT ATGCATCTTTTATCCTTGTTTATTCTATCTTTTTTGAACAAATATTTCCT TTAATATGGAGAAGGTATACCCCTTTTATGAGGCTAAGATAAAATGTTTG GAGTTTGAGAACCCAGTGGCTTCAATTGTTGAAAGATCATTCTGGATTGA GGTTTTCACTAAATGATTTGTGTGACACTGAATTTCGTCTCCCTTGCCCG GTACCGTTAGTTGGTCTAATGTCGACATCCCTCTTCTAATTCCGACACCC AGTTTTCGAGATAGGAATAATAGTAAGGTCTGAGTCACTGATAGATAAAA GATATTTTCCTCTCTGGTTGCTAAGCAAAGAAATATAGCTTCTATCAGCG ATTCCAACCTTCCTACTATTCTTACCTCTAAAAAAGGGTGTCAGGATTAG AAGAGAGATGTCGACATTAGACCAAGTTACATTACCCATCCTGGTCTTCC ATTCGCTAAATAGAAAAGCCTCTCATTAATCTTCCGGATTTATGTACCTC TACGTGTATAAAAATTCCAGTTATCAAGTGGAGAAAAAATAAAAATGTCG GAATCTCTGACATGAATCTTTGCAATCTTGTTAGATACGAATATTTAATT GACCTTCTGTCATTTTTAATCCGTGTAGATAAACCATTGTCTAGTTGTCT GATCGGTTCTTGGACTTAATGTTTTTTATTATAATTTTGATTTTTAAAAC AACATTTTTGGTCTTTCTTACCCGTTTCAACTTTTCTCCTTGCCGATGTA TGAACTTGAATTGATACTTTTGAAAAAAGCTTGTGATAATTCTATTGCAA AATTGCGTGTGCAGCCACTTGAATTCTCAAAATAGTGAGTGAGTGTTCAA AGTTTTTTCAAATCTCTTTCTATCACACCGAAAAAGCACTAGAAACCTGC ATTTTGTTGATTCAACATATTCCGTGACTTCTCAAGAGTTCTTAACAAAG AAGATTAGCCTGTACCTAACCAGAGATGGTCACGACTTAAATAAGATTCA TCAAACAACGATACAGGCTTGAGAACTTTTTCAAAACTTGATTCGCCTTT TGCTGACGGGTTTACTGATTGACACAAAGTCTTTTAAACATTCATAAAAC GTCCATACGAGCCGTAAGGGATTTAAAACTTCACACAGAGGCTGTTAACA GACTACATGTTTTCTCGGCAGGCAGTTGTTTTCTTTGATGACAGGTACAT CATCACTGGTTAATTGAAACACGATTTCTCAACTTTTCGATTGATTGTTT AAGAGACTTGGTGCGAAAAGCACGTGGTTCATTTATTCGTCCGCCTCGTC TAAATTTAAAGTCTTTTCACGATATGTAAAAAACGTGAATTTCAGTTACG GTTTGGCTTTCAGTTACAGTTTGGCTTTTAAACTTGCTGAGTTTTTTCGG AGATACTTGGAAAAATGAGTAAACATATTATTTATGAGTTGGCTCTCCAC AAAGATTTTGACCCTTCCAAAATATAACTATTATACTGGTTTGTGAAGGC TATAAAACTAAGTCTTAAAAGCTCTCGATATATTGTATATGTTTTGTGTA GAGAATATATTTTGTTGGACTACTGTAATTCGACGTGGGCAGAAGATTGA CTGTATCGTGAGAACGTGAACCAGTTTACCGTGAGAACTTTGTGAATTGA ATCACCGCAAACGTTGCCAACTTCTCTGATGAAAGTTTACTTTATAATTT TGTAGAGTTTGCAGAATTCCTTTTGGAGTGAGGACAAAAATGACTTCGTG GTTTTGTTGTGTTTTTTTCCTTTTCTTACAAATGATACAGACCTCTCGAG TCTTTTGGCATCTGATGGTATCTGAAAGAGTTATTTTTGCGTAATATCGG TTGACTTTTCCCTCCCCCTCTGCTTCCTTCTAGAGGTATTTATATATCTA CTTGATAGACATTGGAAAATTGGTTTGAATCAAGTTTGAAGTTGAAATTG AAGTCGTGTACTGTAATATTGTTTCAGATTAGTTTTTAAAACATTATGTA GTTTTTAGTTTGTTTTACTAGAGTTTGGTTTGTGCTCAGGTCTCAAAGTC TTTAAAATATTTTCTCATGGTTTTTCTAAGATCCATGAGACTTACAAAAC CTGTATGAAAACCACAAAACTAAATACCAATGGTTTTTCTCCTACTTGTG TTTCATATACCATATAAAGGATCTTTGTCTTTTCTTTTTGAAAGCCAAAC ATTCTAACTTGTTAAAGTTTAGAAAAACCATTAAATACTTTAAGCTTTGG TATATACAGTTTCTCTCAGCCATACAAAAATGGTAGTACTTGGCTGCTTT CTGGACTTTTAGTTAACTTAATCTCAATTGGTCACCTAATTTTTCCTTTA TCCTGGAAAAATTAGGTGCCAATTGAGATTAAGTTAACTAGAATTACCAG TTAGTTGATCAATAAGAGAAACCGAAAATCAGTTTATGAATTTTTCTTGG GAGTGCGGTACTTGCTTTTACAGAACGGGACATCGGAAAATTCCACCATG CTTCCCTGTTATGATAGTTTTACTTAACTTGGTTACTTTCCGCTTGGTGC TGTAAAAATCTTGACGGGAAGAATGACGTTATGGAAATGACGTTTATTGT AGAAGTGGTACCCTCGAGAAATATTTTTTTCGTTGAATTTAGCATTGTTT ACTTTTCACTCTAATAATTGATTAGATTGACATTTTGATGTTATGTTTAT GTTTTGTTTGTAGTAGTAATGTATTTATGTTTCAAAAGGTTGCATTGTTA TATGAAATCTCGGCAAGCACCGTTCTTAGTGACTCGATTGCTTGTTAAAC TGGGTCCAGTTGTCTCTACTGATTATACTTTAACAAGAATAGTTAAGTTT GTGGAAGAAATACTTTTTTCAGGCAAATAAATTGCTTTTCTTATGATTCT CAGTATCTTAAACTACATCTGTTCACTTTAAGAAAATTGTGGTTAATTTA CTATCCAGTCAATTTTTGTCGGTCAGCCGGGCTTTGTAACGATATGAATC TTGATGACATTATAAGCTTTAAACGTATTAACCTTTTTATGATCGTCGTC TGGAAAGTGATTTCATTTTAGTTTGTATGAATTTTTGCATTTTGTCATTT CTGATGATGCTTTTTATCATGATGCCCTTCAAAAAGCTTTTATAATACAG CTCTCTGTGTAATTTAACTTTGCAGTTATTAGCATATTTAGAAATTTTCT TCATCGAGTTTTCTCTTCCAGTTAGAATTCAGTCAGTTGACCAAGAAACA CAAAACGTAGAAAAAGCTCGAATGTCTTTAAAGGTTCTCCCGGTGATTGT GTAACTGAACCATTTTCAATTTCTGGTATTTGAGATGTTCAATAGCTAAA GGTAGATAGTGATAGAGAATGTTGTAGTAAGCACTGGGAAAGTGAAAGTA TAGGGAAATTGTTATGTCGTAGTTTGTTTTCAACTCAAAAAATTATTGTT GGTGGTTTTTACACTTTATACCTGGTGGTTGTTGGACATAAGTTTTTGCA AAGAGAAAGATATCAAATTTTACTGTAAAATAACCATTTCTCAACAATTA TTCCATTCTATTTCAAATGGTTTTAATATTAGTATTGCGGTCATGGGGTC TTATAGATATAAAGTGTAGTTTTAGTACAAAAAGCTTATTTTGTCTTGGT GAAGGGCTTAATATGCAAGGTGCCCCAGTTTTGCTTGGATATAAATAATG AGTGATTCTGATAGATGCTTTAGAATATCTTTTAATGATTTTAGTTTTAG ACTGGAAAGTGCGAGGTTGAGGTAACACCATTTTAAAAGAAATGTTTACT AGTCATATGCAAAAAAATGTTTCAACCTTTGGTAAACATTTTTATATTTG AAAGTTCAGAAGATATTTTAAAATAATATTAAAAAAAGAAATATATAGAA TTAAGATAAAGTTTGCGGAGAATCTAAACAATGGGTGAGATGTTATTGGA TTATTCAATGGACCAATCACAGAGCGGTGATACCTCAATGCATGACGGGA AGACTCCGTCTCCGTTAATGCCCGGTACACACTTTGTCATGTTTCTATTC GATAAGTAAGTATCTTCGCCATTTTCTTTCAAGCATTGACAGGATTTTTC TCATTATTTTTGGACAAAAATTTCGATTTCATTTTTCAGTATTCTCGAAA TCGTTCGTTCTTTCCTTCGTTCGTTTCTAAATCAAAAAGCGAATCGATTT TTTATGGAAACCTTAGACATTCCTGTGTCTAATTATTTTGTAACATTTCA ACCAGCAGCTATGGTTGATACTCTAAAAGAAAACTTTGTGGTTTGATTTG ATTTATAATTCAATTGAATAATTTGTCACTTTAAGATTCCCTCACACCAC ACTGTCTTATTTATTTTTTAATTTTATAATTTATTAGTACTATTTTGACT GATTGCTTTTCCCCTAGAATATTTCAACCAGCCCTCATGTCATACATCGG GAAAGTTACCCACATTCTTTAAAATCCTAATATTTTTTTAAATTAGACTA CTGACCTTTAAAAAAGGACAAAGCTATATCCGTCATTTCTGATCGGAGTT TTTTTTGTATTAAACGGTGCTAGATCATCAAAAGTATCCAAGGGGGGGGG GGTACATCTAGCGCACTCGATGCATTTACACCGTTAGTGAAAATTGCACC TAAAAAAACTACAATCAAAGATTTTGGTTGGCCGGTATTGAGAAAGATCA GTGAATTAGAACCTTAATTTCTTCAATGAGGAACTAGAGTGGTAAAAGCG GTGTTGTTTTTTCGCAAACGGGTATCCTGCACAGGAACACATCTTAACCT GTTCCTTAAGGTTTACAACAAAAAGAGATTAATCATAGTAAATAACATCC TTATTACATATCCTTCAGCGTTTAAAACCATAGATTCCCTTTTTCTGGTT GTCAGTCCTCATCCTTGATGCACTTCCCGAAAAAAATTGAGACTCTTCTC TTATTCGACTTATGTTTCTTGTAAGCATGCAGATTTCTCACTAACTGAAG TTAAGGTGAATATGTTTGATATAGATGTACGGCCAATCTTAGCTCTGATT GGTAAAAGAGTGACTTTCAGTATACGATTTTTAAGATTCAGGATATGGCT TTTCTTGTTAATATGGCATGTTTCTTATAAAAGAGATGACAAGTATTCCT GTCTTGAAGTCCATTGTTATTTTAAGTAAACTCTCTGAATAGATCATCGG AAAAGTGTCTCGGTTATTTTTTTACCGTTTCATTACAAACTTAAACATAG ATGAGGTATCTTTATCGGGAAATTATTAACAATAGAACGTCAAAATTTGT TTTTCGCGTATTCTTTCTTATAAGAACATACTCACAAGAACTAAGTTTAA GACTACCGAGTGTTGAGTGCCATACTTTTTCGAGTGGCGTTTTTTAAGAA CTAAATTTAGTAGTATTACAATTCACGCTGCATGCCTTTAACATTGCACT AACACTAACTGTGTCCCGTGAGCCCGTTTATGGATTGAATTCTCTGTCCG CAGGAAATGTCAATGTTCTTCAAATGTTCTTATAAAGTTCTTAAATTGTC AAGACTCGACGTTGTTGCTTTTCCATAATGAAAACAAACTTATGAATACC CCGGTCGTCGTCAACTTGTTACACCTTCATGTTGTTGTTGTGTCGTTTTA ATAAAAAGAAGGGTCATTTATTTTCGTTTGTTGAGACTTGACTCTAAGAG TAGTCTCTCCTTAAAAGTGAAATCAAACCGTTATTTAAAAGGGCATTTTA AGCAAGGCATTTTTTGATAGTTCGATTTTAATGTTGGTTTTGATTTTATT GATTGTATGAGTCTTAGTTTTCACTAATTCGTTTCTCTTCGTGATATCAC CATTGCTGACCTTTTTGTTATGAACTGATTGCGTAATTATTATTATAACA CACATACAAAATGAAGGATTATGACGTTTTTCGAAGAATTTAATGTGGTA ACACAGTGGCATCGATAATATGAGATGAACATACTCATCCGAAATCTAGA AAACTCTTTAAAATTTTATAAACCGTTTTCAATCAAGTTTGTTTTGAAAA GTAACTTTTTGTTCTCCTTTTGCAAAATATGCGTGTCTGCTGCCTTGCTG AGGCTTCTTGCTGTGAAGAAAAGAAAAACTTCAACCTTTTTTGCCACAAC GACAGTGAATAGAAATAATCTTAAGATTTTTACTGACATCTTTTGTCTTT TACGAGGTGTCATACTTGTTAAATTGCCTTACGATACTCTTTCTCATATT TGCAAGAATTATCGTTTAAGCCAAGTTTTTTAAAGTTTAAAATTTCAATG AAATAGTGGTAAAAATCGCCGTAAATTCAATATATTCATCTGTCGTAAAT ATGCAACTACTTGTCGATACCTTCGTACAGAAAGTCGTAAATCGAGTGAC CAAAACTCGATATGGATTCAAATTCTCGTAAGTATTGAAAATCTTCGTTT GAAATCTGTTCATCATTGATCTAAACAAATTTTGCTGACAATCACTGTTT GATTTTGTCTCTGACTTAAGGGCTCTGACCATAGTCCAAAAATTGATTTT GGTATTTGAACATAAAAGTTATATTTCAGGTTCCTTAACACTTTTAACAA AGAATTGCCTTTATAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNCAAAAGTCTTCATTTTCTTCTTCATCAAACTTTT TCAATGCAAATTTTGAATTTTCAGATTCAGGAATAGTTTGTCTAACAGAA AATGTGTAACATGCCATAGTTTTGTTGGTTACATCAGTCAGAAAACACAT TTTAAACACGGCAATTATGAAAAATTCACTATGGTCAGAGCCCTTAATGT ACTCGCGTATATCTTCTGTCTGCTCTTTCTATCTATATTATGTTTGTGTC CTTTTCATTGATTTTGTATTGGTATTATTGATTATGGACTTTTACCATTG ACTTCCAAACCCGAAGAGCTAGACTTGAGACTCCTGGATAGGAAATGAAG CCACTTATTTCCCATCCAGAACGCCCGTGCGTGGTTTTTACTCAAACGCC GGATCGAAAGTAAAATATATCACTAGATTTCAAAAAATGCAGTCCTCAAA AACAAAGGAACCGCTAGTTACAATCCTCCGTCATGATAGCGGCGCGTTCT AGACGCGTTCTGGATGGGAAATAAGTGGCTTCACTTTTTCTTGCCACTCT AGCCCTTCGGGCTTCAAACTCAATGACTTTTACAATGCTGTTTTTTCGAA GTTTTTGTCATGCTAATGAAAATTAGTGAATCTTACTCTTTTCGACGTGA GTCAACGCAAAAAGAATCTAAATGTAGTGTGTCTTGAATGATATGAATCT CGAATAAGGGAAAGTCTAATTGTTATGTTATTTTGCTTGATCGCAGTTTT TTAAGATAACATATTTTTCGTGTTCTTAAAACAGTCGACATAAATATCCT AAAAAAATCGTCAGTTTTCTTATTTCCTTGTTCTAGTTTTTGTAATGATG TGGTTGTGGTGGTTAGAAATGTCAAATTTTTTTTTTATATAGATACGCCT TTTAGGAAAACTTAGTTTTCGGGTAATTTCAAGGGGATGAAATTTGGTGA TCAATCAAATGTTAAATCTCTTTTAGGGTTTTTAGGATCCTTAGACTTTC AGTATTGTTATTTAAATAACGCTATTAATACACTGCTAATTTTTTTAACG TATTTTTTGAAGTTATTTTTAGCGAACGGAATGGTTCAATTGCCTGCGAA CTAAATCGTTTTGAATTTTATTTTGCTGGTGCTTTTGATTGATTTGATGA AATGTTAAATGAAGTATTTTTGCTTGTTGTTCTTAGTTGGTTTGTTACGA ATGACAGTTTCAACAATACGAACGTTCACACTTCATAATTTGATTGTCAT ATTTTCGGCATCGGTGTTGATGAAGCGTGACAGCCCTTGATAAATCAAAA TGAAACGTCTTTTTAACCTAAATCTTGCTCAATCTTTTTATTAGTCGGTC TATAACCAACTAATGTCTAGCTGTTATTTATAGAATCTGTCTTTTAGGCC AAGTAGCTCATGAGGAGCGACTTATATTCTATATTATTCGTACTACAATC TACCTCAGGGTAAGAATATTAGAAAGTGCGTTTTTCTCAGATTTTTTTGA CGTTTCAAATACATCTTGCGCGCTTTTTGATGAAAGTAACTAATACCCTT ATCTTTAAAATTCGACGAAAATAAATCATATGGTATGTTACCAAATTGGA CCGATCAAAAAGAAAATACCTAATAAATCATATTACTTTTCAATCATCCC ATGAAAAGCAGAATTGGTATATAATTGGTCAATTTTATGTAGAAGGAAAC TAAAACATGCATTGCACGTTGAACTTTGAGACAGATTGATTTACATTACA GACATTTTGTACGTTCTCTCGCTTATTGGTGGAGATTAAACGGATAGACT TTTTGATGTTAGTTTATTGACTGCAATATTCTATACTTGTCGGGCTTTTA AATGTTGTTTTTACGTCACAGTCTATTTTTATTGTAAATCTGGCTGACTC AAAGTTTTGATCATTTATTTTTAAGATATTTTTTTTGCTTTGGATCCTCT CTCTTCGCGCACTATCCGGGTTTTGGTAGTTGAAGTCTAGAAAGCATTTT ATGGTGCTTAGAAGGCGCAAAAAGTGAAACATTTTCTTCGTGGCTAAATC GTGTGAACGACAATTTTTTCCATCCCTTCAAACGGCTAACCGGGACCCAT GATTTTGAGTAAGATCTTTATACAACTCTATATTTCGGAGAAACTTTAGC ATATCGGTAAACGTTTAGGAATCAAAAACTTGTGTGTATTCAATAAATAC CATCGTGACTGACTGACTGACTGGCTCTACACGGGTAAAAATCACTACCC GCGTCATAAAATGTGATTCTCAATGTATGACCTTTAGCCCGCCTCTAGCT CGATCAAAATAAAGATCTGCTGAACTCATTTTATAAAGTGATAAATACAA TTTTAAAAAGGAAAAAAAATATTGAGCTTTTTCGTATCTTGTTAACGTAC AAGCCACGTTTTTAATAGAAAATTTTCGTGCGCATGTGTCGAAATTTCAC TCACGACTTATGTCCATTCGTTTTTTGACTGATAGTGGCGAATTTGAAGT TACCTTGTTGAGTTAGTCAAAAACCTGGAAAAACCGTGCTCTAAATAAGG TTTAGAATTCTAATATTGTGAAATCTCTTAGTGTTTGTATGATGGAGGAT TTTGGGTAAGGTTTTTCTATTGTATTCACGTCTTTTTTGTCCACATTTTT ATTGGTATGTTTTCGTTCATAAAGAGCACTTGATAATATTTTTGACGGTT AAGAAGGGGTTGTCTTTCTTTGGTTTGTTTTGGTCTAAAGTTATCTGTCA TGAAACTATCTAGCTCTTGAATTTGTTCACGCCAAGGGTTTAGACTGAAT TTTAACCGAAAAAAGTCTTTCGGAAGGTGGTTACGCTGTGTACTGTTCAG ATGACTAGCTTTCGTTTTGATCAAAAAGTTGCGAATTGCTCGGGGGGAGG GGGTTCTTTTTGTGTCTGTCATCCATGTTATTTTTGTTTTGTTTAACAAA AAAGAATGAGTCAACGTTTGCGCTTTAAGAAATGACCTATTTTTGAAGTC ATTTATCATCGATATTCTTATGTATAACAATGTCTTTTTGTGCTTTAAAT GACCGAGTCGAATGTTTCGAGAATTTTGGATTTGAGTTCATTTATAGTAG TTACTTTTTGTAAAAGGGGTTAAGCGGGTTTTACTTAGGTAGATAAGTTC TGTCACAAATCGTTGCTGATATCGGGCGATGAAGAGAAAGTGCTTATATG CTAGACTGCACATATTGTCGCATAAGATTATGCCTTGATGGTCGGTGTTG TGTCTGTTTTTGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCCAA AAATGGTGCACCTACCATGGTGATCCCACTCTTCGCATCCGGTCGAAAAC GTTGTATGGCTTTGTGACATGTTTGAACAAAATTGTAATATTACCTACCT ATAATAAACCTTCTCTCTCCACAGCTCGAACGCGCACCAAGATTCATTAC AAGAAGCATTGGATCGCCTCTTACAATTTCACAAGAACATGATTTCAGCA TTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTT GGTGGAGTCATCGCAAGCTGAGGATACTTCAAACGTGGATGAACTACAAG GTGAAATGCAGGTATGCCACTATCCTTTTTGTTTCCAGACTACTGGGACT GGGTTTCAGATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGTCG TTACATTGATTTTTTCATTCTTGATATGCACAATTGCAATGTCTTCCACC GACCCAACAGCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAAC GGAATGTTCACGATTGACGATTTGTTACAATTGCNATCAGGTAGATAAGT TCTGTCACAAATCGTTGCTGACATCGGGTGATGAAGAGAAAGTGCTTATA TGCTAGACTGCACATATTGTCGCATAAAATTATGCCTTGATGGTCGGTGT TGTGCCTGTTTTCGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCC AAAAATGGTACACCTACCATGGTGATCCCACTCTTCGCATCCGGTCCAAA ACGTTATATGGCTTTGTGACATGTTTGAACAAAATTGTAATATTACCTAC CTATAATAATCCTTCTCTCTGCACAGCTCGAACGCGCACCAAGATTCATT ACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAG CATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCG TTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACA AGGTGAAATGCAGGTATGCCACTATCCTTTTTGTTTCTAGACGACTGGGA CTGGGTTTCAGATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGT CGTTACATTGATTTTTTCATTCATGATACACGTTTTTTTTTTTATAAGGA ACACGTTTATAAGGAACTCGAGGCTGAAAATGGTTCAAAAAATAAGGAAT TGTTAAGGAACTGCTCAGGCTGAGANNNNNNNNNTGTGGATTTGAAAATA ATGTACCTTATTGGGACTTATTTGACCAAATTTNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNAAAAAAAAAAACGTGTATGCATCATTGCATAATGTCTTCCAC GGACCCAACAGCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAA CGGAATGTTCACGATTGACGATTTGTTACAATTGCTTCGAAATTTACACT CACTTTTTCATTCGAAATACTTAAAAAATTGGTTGTCTTTTTTAGGGGGT TCTTCATCACTCATTGTCAAACTAGCAGTTTTTGCTGTAACTTTACCCCT TTTTTTATTTAAAGTAAAACTTTACGTCCAAAACACAACAGTGATTCCAT TGTGAATTCTGGAGTCTCTAACCTACAACCCCTACGCGATCCTCATAAGT CACCAAAGCCAATATTTGATCATTTCATTTCCTTGTTTGTTTAAGAATCT GATTAAAATCCTAATTTCTTAAAAGAACGAAACAATTATCAAAATGTCAA TTGGAAACATTCCAAATCCTTAATCTCTATAAAAAAACACGATTTTTATA AATTCACAAAATGGTGTTTATTTACTTTGTCAACTTTTTTTGTATTTGTT TTTTAATATTTCGACGAGCTGCTTTTAATTTTCCATGTACTTTGAGTTAA AAAAATTGGGTAATCCCTCACCCATAAGTTTTGGTCATCTGCCCTCGACT GTTTCCAAAATACGGTTAAGTTTCTTTAACTCGGACCTTTATAAGTCGGA CCTTTATAACTCGAATGTCTCCTTAACTCGAACAAGGATTATGGCCCCTT CAGTTAACAATGACTTATAAACCTTACTCCATAAATCGGAAATTTCCTTA ACTCTAACAATTTTGTGTTCCCCGCGCGTATTCGAGAGTTATTGTGACTC CACAGTAGTAAATTTGATAACCTTCTATTTTATCAATCACTTGGTATAAT TCGAACCAACTGGGTCACATAATCACCCTTGTCTGTCACAATAAGATAAA CTGTTTGCGCTTAGTTACAACTTCTTTCAAACATTCGCTTCATCATCATT GTTCAATGTCCTACGCCAACGCAAAAAGTCTTCAAATTTCACGCTGATAT TATTGGATTCGTTTATTCTTAATGAGACTTAACGAACGGAATTGGCTAAT TAGTTAATTAATTCCGGAAAAGGCTAAACCAAAAGTTTTTTCTGCACCCA CATTTTCGTCACATTCAGCTTGTGTGCCCCATAAAATCAACTAAAAAGTC TGAGGTTACGGGCTAACAAATTGACTTTTACACGTTGTTATAAGAACAAA TTATATCGTTTGCCAAAATATCAAGAATAGGTTAAGAACAATTCAAGGCT TCGTGTCCTTCATGGACTCTAAAACACCAAATTTCTTAGGAAATCGCAAA ACGGTCAAAATAAGAACATTATAAAACATATTTTTAAGGTTTAAAACTTA AAATGTTAAGAACATCCCGAGGCTTCAAAAAATTTGGATGCTCTTCTAAA AAACGTGTATTTGTGACTCTTTATTATTTCTATAAATCCCCGTTACAGGA ACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACG AAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACA GCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGG TGTTCGAGTCGTCGATATCAGGGATAGGTAAGACTTCAAAAATGGCAATT TCAGTAAAAACCTGGTGGTTTTTTTTATCAATTCATCGATTCTAGGAGTT AAGTATTGTGCTTTGGAGTATAAAAAGGCGATCTTTTTAGGCATACATGT GAAGCTTCATTTTGAACGCGTGCGAATTCAAGTCTCGTGCAGAATAATGT TCTGCTAATAGCCATCACTCCTGTGTGAAAGATGATACAGCATTTAAATC ATTATTGAACCAAGCACCTTCCTGTTGGATGTTACAATGTCTTCTTCTTA TCTGATCAAACCACATATATTAATAGTAGGTTAGAGGTTGCGGATACCTC AAACAACATAAGTACAGTCTATGTTTCCTGTTTCATGTTCTGATATAAGA TTACCCATCTTTCCCTTCTCTCCATCCAACAACAGAATGTCATATGGTAC TGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGT TATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGAT GTCGAGAAAGTACAACAACAGAATAAACACCATCAGGTACCATTTTGAAT TTACCTCATCACTGAAGGTCATATCTTATTCTGTATTTTTGGATACTCTT GACTTGATTTGATTTGATGTTTCAAATTCGCATAAAATAACGAGAAAATG TTTTTTTTTTTGCTAATATAGGTATCAACGACATGTTTTTTTTCGAATTT TCTTGTAGAGTTCTATTTAGATACGATTACAATAAGGTTATCCAAATACA TTTATTAGTCGCTGAAACTTACCAAATCTTTTTGCACTTGCAGGAATTCA AAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAA GGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCAT TCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGC AACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGAT AAGTGGGAGAAAACTATCAGCCTTGTATTAGAGGTAAAATCCATTTTTAT TTTGCTATTTTGCCAAAGGTTGACTGATTATCTATATGTTAGGTGGTATT TCAAATGCTTAATCTCTTTTGACAGCGGGTTTTGTACACCTTTAAACAAT TTTATAAGGTATTTTCTTTCTTACGTTGTAAAGACGAGATTAGAAAAACT AGAAAACGTTCCTTAATAGTTCTCATATACTCATCAACCTTATTTTTTTG GCTTCATTGCCAAAATATTATTGGACTCGATCCGATCAATCAGTCCATCA TATTTAAAGATTATTCATGATCATTGTAATGACAATGTAATTCTGCATCC TTCCAGCAATCCCAGGCTAAATAAACGAATCGTAGTTCCTTTCCCATCAG TTGAAACAGCATGTTAAAATTGAACCAGACACTTCTATAATAGATTTTTT CGAAATGACCGTGTACACACATCACAATCAGATTAAGAACTAGTTTACAC TGTGCAGAGAACAATTAGATGACAGCGAAAATGTTTTATCGCGATATAAA TAGGAGATTAAGGAAAAATAGATGATATACTCTTTAAGCTCTCCCTTATG AATCAGTAAGCTAAACAACTAATTTATTGATGGGTTGTTGAAGAAAAACT AATGAGCTAGTATTTGTTGTCCTGAAGGGTTTGAAGTGTAAAGTTGTAGA CAGATCTAATTGTTTTGAAAAAAAGAAATGGGTACTACTGTTAATTTGAA TAACGAGGTATATCACTTTGGAACTTCTTTGATAATTACCGATATTTGGG GTTACTTTCATAAGAGAGGGGTTGCTTTTGTGACCCCCAAACAGCTGACA CTTTTGGTCTACAAGCTAAAAAAATTTCTAGCTGGTTGGAATGGACTGAA ACTATTTTCGACTTGAAGGCTCTGAAAGTTACCTACCTTAAGGGAAGAAA TTTTCGCGAGAAGAAATTTTCGCGGAATTTAATTTCGCGAATCAGAGTTT CAAAATGGCAACTTTCGCAGAATTTAATTTCGCGAATGAGCCGATTTTAA AAGTTTCACGGAATTTAATTTCGCGATTGAGAAGAATTTATCAACTTAGA TTAATTTTTAAGCATCACAGAGTTGTTTATATTTGATAAAAAATACACGT TATAATGCTTCAAAATCAATTGTTCATGATTGTGTCCATCTTTTTTGGTA ATACCTGGTCAAAAACAACAAAATAAAAGAAAGAGAAAAAAAATCGAATT TCGCAGAATTTAATTTCGCGATTTAACAATTTTGGTGTGTTTCGCGGAAT TTAATTTCGCGAATTACGCCCAAATTCGCGAAATTAAATTCCGCGAAAAT TTCTTCCGCGGAAATTTCTTCTCGCGAAAATTTCTTCCCTTAAGGTAGCA CTTATGAAAGTAACCCCAATCGTGACATATATTGGAGAAAGGTGTACATA GTAGCTCAAAATCTTTTCACTTCATTTTGATATATGAGGGTGATATTGTT TGAACTTTTTTCAAAGCTTTCGTGGCCTGGTGTTACTATAACTTCAAACT ACAAAATATACAATACACCTTTTCGACCGTAGCCGCCAATTGCCGTGGGG GCATATTTTTTCACACCTAAAGACAATAGAAAAAAGTTTGAAAAAGGATT GGCTCGAGTTTAGGGTGGTAAAACGGACAAAAAAATGCCCGCGTGGCAAT TGGCGGCTACGGTCGAAAAGGTGTATTGAATTAAATTAAAAAGTGACGGC TACATCCTCGGCTTATCATCTATCTGAAGGAACTTTTCTAATCAATTGCA TACTGTGAAAAATTAATCTTAGATTCTGATCTATTATCTATTTTTGTTTA AAAACTTTCTTCACTGGTTTAATTAACAAGCTCTAATGGTTACCTTACCT ATTAAGTTCGACAAGCGTAAGTTCAACTAAATTATTGGAATGGAAGATAA AAGTGAGAGTAAAGGCCAGTCTCCACTTGCGCGTGCTGCGATCGCACTTT ATGTAGCAAAGCTTCCACGCCAAATATTGCCATCGAAGCGTGCGTAAGTG GAGACCGGCCTTAAAGTTACTTTTAGTCTCTTTAAAAATCGAAAGAATAC CAAAATATGCTTAAATTACGTGGAGAGTCCCATTAAATATAAAAAATCTT CTCCTTTTTAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAAC AAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCA AGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGTAT GTTTTCGATTTGATTCTGAATTGCTTTATACTATCTGTGAACACATCAAA CCTTAACAAATTCTACATTTTGAGACAACGATATTTCGTCCCCTCTCCGC AGAAATAAAGTAGACGGTTTTCCATTATGTGAGAGCTAGGTTGACCAAAT ATGTCTTAAAATATTTTAAATTATTTTTCTTTGTAAATTATATCAGAGAA TGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGA ACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGAC TGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATG ATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGAT GCAGGATCAGTTATGTTACAAGGTTTGAGAAAAAAGTTTTCTTAGGATTA CTTTACACTTTTCAAAACTTCAGAATAATCTTATTTGGAATACATTGACT TCGTAGGCTTCTGCTCACCCTCCAACAAAAAAGTTTCTTATGTGAAGGAA GAGTGTACATAGAGTATAGAGTTCTGTTTTTGGGTTGGAAAGGCATGACA TATCTCTAACTATTCTAACCCTACCAAAATTCTTGTTAAATGCGAGAGAG AATAGCCACAAAAGTTATATTTTAATGAATTGAAATTTCATAATTCGTTA CAGAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTG CCATATTTCATCAAGTAAGTGTGTAGCTCCCAGTCCCCTTTAGTGATGGC CGTCCGTAATTTTCTTTTTTTATTCTTTTATAATTACAGTGGAGTTTCCA TAGCGGAAAACTCTGTTCGAGTTATGGAGTAAGGTTTATAAGGCATTGTT AACTGAAGGGACCAGAAAACATATCCGTCTCAAGGAGACATTCTTCGAGT AATGAAAACTCTACTGTACACGTCAATAGCAATTTTCTAACTTTAAAGAT TGAACAACACTGCCAATTGTGTCTGGCTCTTTTGAGTTTGAATTTTGTAA GCTGGACACTAGATTTTGATGTTTGAGCCGTCTCAAAATCTTTTACAATC GAAAAATCCAAGTCTTATCGATGCGACGTCACCTTGTATCATATTTATCA TCTCCTTAATTGTTTTATTTCAGTCATACCACAAAAACGACACAATGGGA TCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACG TCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAG GCTTGTTGTCGTAAGTTTTTGTTATAATTTTGAGAGAGAAAAAACCAAAA GGAAATTGGAATGAATTTTTTTTTTTAAATCGCCAAAATTTGTTTTTGCC AAAATTGAATAAATCCTAATTTTTATCTCAAACGCTCATTAGTGGCTGAA AATAAAAAAAAATTGCTACTCGTGAAAATAAGTTTCTTGCCAAATTTGAT TTTTCCGATCTTTACTGTTCATCAAGATTCTTGTTCTTTTAAGGTCACCT GCATCTTACCTTCCCTTATAGTTGACTTGTGTGAATTGAACTTAAACATC AAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGT CGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCG ATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACG TTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACG AGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAG AAGATAAATGGAAATGTAAGTAGGGTTNTATCACTTTGATGTCACGTGCT AAACTGGAAGATAAATGGAAATGTAAGTAGGGTTAAAATTCATCCACTTT AGACTTTAACTAATCTTTTAAAATTAACGTGTCAACTTTCTATAATATAG CAATTAACACATATAACAGTTTCTTCACTCTTCTTTCGCTACCAAGACGT ATACATTCCTAATTCAGAATCTTTACTTGATTTTGATGCAAGTGTACAGT TCAGCTCATTTTATGACTTTCGTTTGCTATTTTTTCCTAGATTTATTCCG TCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGC TATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCC TTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGGT AAGTTCTTTGTTTGTTATAAATCCTGTAAGTGTATTCAGAGTTGAGGTTT TTTATTTACTTTTTTTAAGAGGCAAAATTTACAAGTGAACGAGAACCGGA CCTTGAAAACTGCAGAAAAATAAGCTTCAAAAAATTACTGTTTTTGTATA TTGTTAGGGTTAGATTTTATAAATTTTCTAATTTTGTCATTCGTCTTCAT TTTCTAGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCT GGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGG CTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAA AGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACT TTGATCTTTGTCAGGTAAGGAAAAGTTTGAATGCTGTGGCGAAAACTTCA TTCAATAACATTTTCAAAATGATACAAATGATATTTTTGTTCACAAAATA TCTTTTGCCCAGATATAGTAAAACCCTTTAATTTAAATCAATTTAATTTG ATTAGAGAATCCCACCTAATTTCAACAAATATTTGAAAATCATTAGCTCG TTTGAAGTAGCAAAGCAAGCTTGACATTCTCAAATGCTACTTTCACCATG TCTTTATAATAGCCGTTAGCTTACGCTTGAAGTACTAACCTTTTTTACTT TTGTTCATGTGGTTTGATTACTATCTACCAATCAATTAATTATTTAGACT TGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTAT GCATCAATATAGCTTAGCGGTAAGTCTCATTTGTGTTCCACGGAAGCTCC ATAACCCCAATTCTTCTTAGCTCTCTATGTTCCTCGTGCGTGTTCGAGTT GAAGGACTCTATTATAGGTTCTATTAAGGTTTTTCGTGAAGTGACCTTAT CACGCCCTTTCCCGAAAACGAACATCGTCTCTAGCGGATATTCTTTTATG AAGGTCACTGTGTTTCACACCGTATTTTCCATCGTATTTTCGATATGATT TATAAAGCAGGAGCCTTCTTAAGGTTATTTTGCACCAATCATATCCATGG TTTCCTTGGTTTATCGTTAATAATTTGTGCTGTGCGTAAAGATTGGACTT ATTTTTTCTGATGCACGTACAATATGTTTTATTCTCCTCTTTTTTCTACA GACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACA AATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTAT CTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACGTATGTTTA CTCCTTTGATTTCACTCTCCACTATCATCTACAGCATGGCTTTTAACAAA GCTTGTTTCGAAAGTGCTTCATTTTCATGGCTATTGGTAGGACTTATCCT TACCAAGATGGTAGTGGGTGGACCAAATCCATGATTCCGAAAAAAGGTTA TTATCCTTCTGACGTGAAGCACATTACGCAAAATATGTTGTTTTTATGAA GTAACGGTTTCTGATGAACGACTTGCTTTGATGGACGATGACCAAATGGT CTAAGGCTTCACCAGTGCAAACCAGGCGGCCGTAGTTCGAATTCTTGTTT CTTCCAATGTTGTGTTCAGCTCATAGATTGAGCTTGCCGACAGTGGACCC TGTGAAAACAATCAAAAGGGTGTCTAAAAGTCCTAGATTACTCGGTTATC CACGTAAAATATCTATGGGATTATCTCCGTGCAACTTTTTATTACTTTTT ATTTTTCTTAACAGGCCAACGGAACCAACGACACCTGATCTATCCAACTT CACTTTCGACTCGGCGTAAGATCACAGTTGTTTTCCTATTCAATCGTGTT GTTTTTCTATTCAATAGTTTCAATCACCATGTTTTAGTATTTTACCTTTT AACACTTCCTACATTTTCAAGATGCAATTCTATCTAGCCTCAGAATAGAC TGGAGTCGTTTATAATGTGTGTAATACAGTAGCATAGGTATTATATGATA ATACGATTATTGTTACAGGATTTAGCTATATTTAGTATAAACTAAAAACA TTTCCCTCCATCATTTTTTGCTTTATTTTTACCATGTCTAAATTAGTCGT CTAGCTTGCTAGACCAGCCTCAGAATAAAATAGCCTATTTTACACCAGGC TGAATAAGTCAGAGATCTTACAAATCAGCATGCTGAGATTCTTGTTTTGA AAATCCAATTCTACATTTATATTATCCTCCAGAATGAACGGTCACCACGA TTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTA ACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAA ATCACAAACAATAACACAACGGTGTGTAATTTTTCATGCCTTTTTTGTTC ATCATTTTCACTTTCGATTTTCGCTCAGACAAGTCTCCTTCATAGGTTAT CTCCCGGTGGATAGGAGTCATGGGGACAAGCTGGAGTTTTTACAAGCTCT TACGTGATTTGGTTGGTCGTTAAGTTAATTTCATTACTTTTTCTAAAGAA CGCGTCATCTCTATTACTTCAAATGACCAATTAGTGAAGTATCTTATAAA AACTCCAGCTCATCCCGAATCATGGGAAACATGGGGAAAATGCTCCCTTT CTATTGGTCAAACCTTTTGAAGATGACTAAAGGGACATCATTATTAGAGG GCAGTCCTGATTACCCATGATTCATTTCGAATCATGGGTAAAGAGAGATT TGCGAAATAAAAAGTATCAACTAATCGTGGTTTGCAATCAATAATTACAT TTTGCTTAAACCCTGAGCACGCCGTTTTTATCCTGTATTTCTCATTTCTT TCTTCAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCAC AACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAG TAAGTAATGTTGAATTTTTTACCTATCAGTATTGAGTTTGAGACATTTAA GGAATCAATATTTGATGAGCTCATCCCGAATTTAAGCACTGGATTTGTAT TATTTTTGAATAAAATCTGTCTAAAGGATTGCCAACGTTTTTTCCGATAG TATGTCTATAATCACTTTGGAATTTTACTTATGCGAGATTTTATATTCAA ATGAGATTTTAGAAATATATATGTTAAATCTAAGATCTGTTGAAATTAAG CCCGTCAAGTTGGTGATCTTGATCTTGATATGATTAGTATGTTTCTCTTA TATATTCTCTTTGCTTTCTTCTCTAGATCTCTAATGGAAGAATACACCCG ACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTC CGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGC GAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAA TCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGG TTAGTGAAGTTCCATTCTACTTGTTACCGTAAGTTGGTCTAATACCGACA TCCCTCTTCTAATTCCGATGACACCCTTCTTTACAGATAGGAATTATAGG AAGGCCGGAATTGCTGATGGAAACTATTTCCCCTTATTGCTTAGCTATCA GATTGGAAAAAGTCCTTTGTCTATCAGTGATCTAGACCTTTTGACCATTC CTATCTTTAAAGAAAGGTGTCGAAATTAGAAGAGGGATGTCTACAGAACA ACTTACGGTATGATTCTCTAGCTACTCTGTATCAGAGTGTATCAAATTTA TAACGTAGCGTAGTACAGTAAAGTGCGTCAAATGGGCGAAGTTTTGTTTG CAGACAAAACTGAACCGTCCTGAGTTGCATTATGGGCTTCACATTTAGAA TCAGGAAAGCTGTATGTTTGTATATGGGAGTTTCTAATTAAAATCTATTT TCTTTCGTTAAATTATAGCCGCCCTCCGAACGTGAACGACATAATTCAAG CGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGC CCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGA TATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGA ACACGCCTTCCCAACATCAAGTTATGAGGATTAACGGAGGAATGGAAATT TTGTTCTATTAGTGTATTGTTCTGCTTTTTCTCTTGTGTTAGTAGTGTTT ATATGAAAGATTGAATCTTTTAGAATTAGCGCTTTATTGTTAATACACAA AGAAATAATGTCATTTTTCTATCTACCCATTTTCAGAATCAGAAATAAAG TTCTAGGAACACCGGACGGTTTTTAGATCCCTGGAGGACCTAAAGAAAAT ATCCGAAACCTTTTCTGCTACTGAAGGTTTGGTTTTTGTAAAATAGAATA CCAGTCTGGACAATTAGGTTGATAGATACATGAAATTATTTATTTTGAAA TTTAAAAGAAATATTTATAGCTTATATATATTTTTATATTGTACCTTGTC CATATAATAATTTTTTTTGTCTTTTCTGTTGTCTTTCCTTGTCCTCCCTG AATTCTATGTTGTGTTTTTGTTTGCCTCCAGAAAAAACGAGGTCGCTTTA TTTTCGCGTATTATTTTGCTTTTTGTAAATAAGTTTTTTTTGTTTTGTCT TATATTTTTTGACAGAAAATCTTTTTTATGGATAGAAATAATTTTATACA ATTGAAAATACCTTTGCGTTCATTATCAT

Coding sequence (CDS) from alignment at sc0000010:243650..358078-

>TCONS_00001425 ID=TCONS_00001425|Name=TCONS_00001425|organism=Clytia hemisphaerica|type=CDS|length=765816bp|location=Sequence derived from alignment at sc0000010:243650..358078- (Clytia hemisphaerica)
CCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACC
CTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACG
GCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCG
ATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATC
AAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGA
ATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATAC
ACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAG
GTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTA
GAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCC
GTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAG
AAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGAT
TCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAA
CGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAA
TCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATC
CAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTT
CGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCC
CACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGT
TCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGT
GTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGC
GATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCAT
TAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAA
CATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAG
ATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCG
TCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGC
TATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCC
TTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTT
GACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAA
CCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACG
TTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATA
AATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTA
CGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCA
TTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCA
CAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACG
TTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAA
ATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGG
AACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAG
AACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTC
AAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGG
AGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCC
AGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGA
TCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGA
TCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTC
ACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAG
GGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTT
TGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAA
TCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCT
TCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATA
ATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATA
TGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTG
ATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCT
TCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGA
AGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTG
GCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTC
CAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCG
AGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAG
AAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTG
ACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGT
GGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTG
AAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAAT
ACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGA
TTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATA
GCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACT
TGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGA
TTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCC
ATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTC
CATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAG
AACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATT
AACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGA
AGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAA
TCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCC
GTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAA
CGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGC
TGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTA
AATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACG
ACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAG
ACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACG
ACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGA
GAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTT
CCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAAC
AAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGA
TAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTG
AACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCG
ACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTA
ATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAA
AACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATC
CAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTC
TATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATAC
TGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAG
ATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTG
AATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATG
GCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAG
CTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATG
GAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGT
GCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTG
ATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAG
TTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAG
TACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATG
AGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAAT
TGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGT
TCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAA
TCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTC
AACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACG
TCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGT
TTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTC
TGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTA
TATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCAT
GGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCT
ATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACG
CAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATA
TGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAA
ATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAA
AAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTT
AATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGA
AGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGT
CTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAA
AATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGA
AAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCG
AACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATG
TTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGA
AAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACG
CAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCC
GAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCAT
TAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGA
CGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAA
AGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCG
ATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGAT
CAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGT
TGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGA
AGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGAC
GATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGG
TGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGA
GTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTC
AACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGC
CATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGA
CGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTA
GATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATC
AGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCG
AACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAA
TCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAA
AGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAG
ACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAA
AAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTAT
CTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAA
TCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCA
ACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACC
AAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTT
TGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCT
TCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCA
ACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACG
TCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGAT
CGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACC
TGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAA
TGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGAT
ATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAA
AAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAA
TTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAA
TGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATAT
TAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAA
CTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTC
CACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAA
TCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGA
AAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTG
GTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAA
GACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATAT
ATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGA
TCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTG
GATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACA
GAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAAT
CGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAG
AAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCAC
GGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAAC
TGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGT
TTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCAT
CGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAAC
AAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAA
CCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTT
TCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGC
ACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCC
TCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATA
ATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGC
ATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAA
ACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGA
CGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTA
AACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAA
GCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAG
TTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTC
ATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGA
GTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATG
ACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCG
CCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCA
ACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAA
TGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAA
GATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAAT
GAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATAC
CGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGG
CTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAA
AACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTC
AATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAA
CGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGT
CTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAA
CTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGA
AAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTA
AAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTA
ACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCT
CATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAAC
AAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATG
CAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTC
TCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTT
GACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCT
CTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGA
ACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTT
TTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGA
GCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCG
GCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAA
TATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAA
TTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATC
ATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCA
CCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCAC
AGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATC
AAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACA
AGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCAT
TGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGAC
TTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATC
AACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTT
CACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCT
CCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAG
TACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCAT
CGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCA
GATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGC
CTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACC
CGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGT
TCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTAC
GCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCAT
AATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACA
GCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAG
AAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAAC
GGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGA
GGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCAT
TAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGAC
ACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGA
TCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGAT
ACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATC
ATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCG
AAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAA
AAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCG
AACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCC
GAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGAT
TGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTC
AGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAA
AACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGT
GAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTG
CTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATT
CGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAG
AAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGT
AAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTT
GTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCAT
TCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGG
AAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAG
TTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCG
TACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTAC
CGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATC
AAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATG
GATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAA
ACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGT
TGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGT
TCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGG
ACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAAC
CATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCT
TGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCA
TCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCT
GCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGT
TGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCG
ATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTA
GAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGC
AAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAA
CAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCA
TCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGAC
TCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTA
AGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAG
TTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAG
ATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATG
ATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACT
AGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATG
AACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCC
AACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTA
CGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATA
CTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTT
GCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACG
AAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGAT
AAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGA
CGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTA
ACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAG
AAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAG
TATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGG
TCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAA
ATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAAC
ACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAG
CTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAG
ATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGC
GCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTC
AAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTA
TCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATT
TGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAAC
TCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGC
CACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAA
TGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCG
ATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATT
AAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGG
ACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATC
GGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATA
CTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGAC
CTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAA
CCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATG
CTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATC
ATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAA
CGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTAT
TTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTT
GAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTC
ACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAA
TGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCG
CTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACA
AGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATAT
GAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGT
GATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCT
CAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAA
CCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACG
CGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCA
GCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGAC
AGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCC
AAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCT
AGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTG
TCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATC
CCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACA
TTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAA
TTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATT
ATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAG
CACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGA
CTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGAC
ATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGT
GCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTC
CAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGG
AAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATG
AAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCC
ATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAA
AACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGG
TGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGC
TTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTAC
CGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAA
CAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGA
TGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAAC
GACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGAC
GCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGG
GCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGG
ATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAA
TTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCT
TGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACAC
AAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTG
CAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACC
GGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATC
AATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGG
ATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACC
ACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGT
CTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCA
ACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGA
TGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGC
TGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAA
ACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCT
AGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACT
CGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTC
GGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATT
GAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCG
AAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAA
GTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAA
TTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGC
TAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAA
TGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACAT
CGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAAC
AATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAA
GTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAG
AGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACA
GATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGA
CCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTG
ATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAA
GAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGAT
CACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCG
TCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGA
CGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTA
TGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGT
CTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATT
GCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAA
CATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTA
CGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAG
TACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTAC
TCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCA
GAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTG
TAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTAC
AGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGAT
GATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGA
TGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGA
ACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGC
AGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCA
CACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCC
GCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGAT
AAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGG
ATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGAT
CAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCA
AGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCG
AAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTC
GAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCAC
GGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTAT
TTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACT
TATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCT
AACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCA
AAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTT
AAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGA
GTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGG
GTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAA
GTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCT
GAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGT
TGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGA
GAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAG
AAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAG
CAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATC
CGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTG
GTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAA
CAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCT
GACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATC
TGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTC
ATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTT
TGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTG
AAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGA
GTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACT
CCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCT
AACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAAC
AGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAA
CATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTAT
GTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATC
GGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTA
GTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCA
ATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGT
AGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATG
CTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATG
CCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCG
CACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTG
GATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACA
GTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATG
TTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATT
GTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGC
ACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCA
AAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGG
ATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAA
TTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTT
TAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAG
AATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGA
AATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATG
GAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAA
CGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAG
CGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATT
CTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACT
TCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATT
CATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAA
CACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCA
TGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCA
TGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAAC
GGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGAC
GACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCA
AATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCA
GTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCT
GGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAG
CTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCT
GGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGG
CTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAA
AGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACT
TTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACG
CAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCT
CGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAG
CGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACAT
CAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGG
TCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATC
GATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGAC
GTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTAC
GAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTA
GAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCA
AAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTT
TGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTT
GTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTG
CCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAA
TTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGT
CCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGAT
GGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAAT
TTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACA
ATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAA
GAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGT
CGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGC
GACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTG
AAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATT
GGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGT
CGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATC
AGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTAT
TATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAA
CTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACA
GAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCA
TGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAA
GTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGA
TCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGA
ACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTC
CACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAA
AGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTT
CAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTA
TCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCAT
TTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCA
ACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCG
TTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATA
TGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAA
GCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACG
TAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACG
ACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAA
GTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAAC
GAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATT
GGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGT
GATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAA
ATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGA
AAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCC
GTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACG
TCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCG
CAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTA
CAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGA
AAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCT
TCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGAT
TTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGA
GAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAA
CAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAA
CTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGA
TCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTT
TGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAAC
TGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAA
TACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATT
CAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCA
CAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGT
TGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATC
GGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATT
CACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAA
AATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCC
TTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCA
CGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCT
CGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGG
CCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAA
TTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGA
TATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATG
ACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAA
CTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAG
AGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGG
GAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAAT
TCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTT
GGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCC
TCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCT
TGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTT
CTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCA
TTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATC
CGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACG
ACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGG
AACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTC
GTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCA
AACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGT
CGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAG
GAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTAC
AAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGAT
CCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACA
GAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGA
AAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAAT
CTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAA
TTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTC
TTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTG
TTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAG
AAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAG
AAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTA
AATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATT
AGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCT
ACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATG
CTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCG
AATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTG
AAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAA
GCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAAT
GTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTC
ACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACA
CTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGC
GGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGA
ACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAAT
CCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGC
AAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAA
TTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTC
CAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCG
AGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGT
CTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAA
CTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAA
CCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAAT
TTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGG
AAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATG
TGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGA
AACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGC
AAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGA
GGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAG
GCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAAT
GTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGT
GGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACG
TCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAA
TAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGC
AAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATT
ACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCAT
CAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCG
AACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACC
ACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCG
TCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAA
GAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGA
TTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATT
CTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTAT
GCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGG
CATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTC
CACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCA
CCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCA
GCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTG
AGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTT
CACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAAT
TTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGG
GGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATC
ACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCA
AAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCT
GTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAAC
GAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGA
CTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAA
TTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAA
GTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGA
CGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCG
GTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCA
GCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAA
AGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACA
GAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCC
AACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGA
CAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACA
GAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGA
TTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACA
ACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATC
CAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCAT
TGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAG
GTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGA
TTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATA
TGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGAT
TTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGT
GGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAAT
TAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAAC
AGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCT
TGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAA
TCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACG
TTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAG
CGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTC
GGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGG
GAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCA
GATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTA
TAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACAC
AACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAA
CAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCC
ATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGA
AGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGAT
TTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTT
TGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAG
ATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTT
TAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAAC
AAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTA
CAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGC
GAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAG
CATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACA
AAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAAC
GGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGC
TGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACG
ATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGA
AAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACG
TGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTC
TAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTA
GGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCA
TGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATT
AAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAA
CTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGT
TGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCT
CGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACA
ACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGG
CGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGT
CTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCA
CCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATC
TGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAAC
ACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCG
ACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGA
GAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTT
GGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACT
TGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTAT
GCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACA
ACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCA
GTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATG
CGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGA
AATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATA
ACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGC
GTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAA
TATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATT
GAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTA
ACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATA
TTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATG
TATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTA
TCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCA
CGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAA
TGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAA
TGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGC
AAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCA
TTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCC
ATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCA
TATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAAT
TACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAG
AATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACA
AGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTG
AACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACC
TGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCA
AGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCAC
AACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAG
AGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGA
CCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGG
GAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAAT
GGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGA
GCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAA
AGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCAT
CACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTC
ATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGA
TGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCA
GGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGC
CTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTC
AGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAG
CGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTC
CAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACT
AGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCA
AAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGT
TGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGT
ACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTC
ACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGAT
GTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGT
CACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGA
GTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGT
GTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTC
AACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAAC
GTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAA
CATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCA
ATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAAT
TTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCA
AATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAG
AAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACG
TTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAA
ATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCAC
GTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGC
AAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAA
TGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGA
TAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTG
TCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGC
TCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAA
GATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACG
CCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGG
TCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAA
TCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCA
TAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCG
GTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTT
GGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGG
ATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTA
CGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGA
CAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACA
TTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACT
ACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTC
CAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTC
GACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGA
ACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATG
CCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCT
CAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACA
GGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATT
CGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAA
AACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCA
CAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGA
GGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAAC
TGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGAC
GCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAA
AGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAA
GGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCT
CATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTT
CTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGA
CCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTA
AAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTG
GACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAA
GAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACT
TAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCA
GGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGAT
GAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAA
AGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCA
TTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATT
GACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGA
TATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAA
CAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATAT
GAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCA
TGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTG
AAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTAT
CGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACG
AAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGT
ATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTG
GATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACA
AATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGAC
GTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTC
ACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTG
TTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAG
AAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAA
AAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACT
TGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAA
GTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGT
CAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATA
GATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTG
GACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATT
CTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGG
ATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAAT
AACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGA
AATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAAT
TAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGAT
AATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAA
TGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGG
GAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGAT
GAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATC
TGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAAC
AAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTG
TCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATA
CAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTA
TCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCT
CGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATT
TAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTA
TCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCA
CACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACAC
CACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGA
AAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAA
TCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGC
GCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAG
CAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGA
AGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCT
GAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAA
ACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTC
GAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATG
GAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGA
ACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGA
AACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATG
AAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAAT
CACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTAC
AAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACA
AAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAA
GCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTG
AATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAA
ACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTT
TGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGT
GTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGC
AGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAA
TTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAAC
GCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGA
GCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGG
AAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTG
CTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTT
GAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCG
AGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGG
ATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGA
ACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTG
GTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAG
TCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAG
ATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAA
ACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCA
ACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCT
CGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAA
TTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCA
TATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATT
TGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAA
TGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCA
ACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAA
CTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGAC
GCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGC
CAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATA
TCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTG
TCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGA
GCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGA
ATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGC
AAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGAC
AAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCA
GACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGG
TAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCC
AACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTT
GGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTAC
TGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCAT
GGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAA
CGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAA
AAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTT
AATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGG
CTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAA
TGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAA
GGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTT
GCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAA
AAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCA
ATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCC
GCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCT
CACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGC
TCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGAT
GGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAA
GTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAAT
CAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACAC
AAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGT
CGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGA
ATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGT
CACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAA
ATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTC
GACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACG
AGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATC
ACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCA
ACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCG
TGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCA
CCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTC
CATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGT
CACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGA
TCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTA
GTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACA
TGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGAT
ATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTC
AAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTA
TTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTT
CGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGA
CTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACC
TTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTT
TTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAA
TGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACG
ATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATT
ACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACA
AAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTT
ATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAAT
TGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAA
CGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAA
CAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAA
AGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAG
TGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAG
ATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATC
AGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATC
AACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCAC
TCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGG
AATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTG
GAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATC
GTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTC
GTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAAT
TCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATG
GTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGAT
TGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTC
TGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAG
ATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGC
AAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCA
ATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAG
TCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAA
GCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGAC
ATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGG
AGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAA
ATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATAC
TTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATT
TGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGC
TTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTG
ATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATT
GGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCAT
CCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCA
TGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAA
CATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAA
CCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAG
GAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATC
AAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGT
ACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACG
TTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTG
GCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAA
TGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGAC
CAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGAC
GCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGAC
TGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGA
ACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCC
AGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAA
ACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATA
GAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAA
CGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGAC
TTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAAT
GGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAA
CGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCA
GTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTA
TGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTG
GCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGAT
AAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAA
TAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGC
AACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCT
GAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGA
AACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGC
AACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGAT
GTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTT
TCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTA
CAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAG
AACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTG
AAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTC
GACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATC
AGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAA
CATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTC
AATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTT
ACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTG
GCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATA
TACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGG
TTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTAT
GGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCA
GCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATG
TGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAAT
TCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAA
GAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAA
TGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAG
GGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCT
GGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAA
TGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAA
GCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAA
CGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTT
GAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAA
ATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCA
GGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGA
AACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTA
GCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACG
ACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAG
AACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGAT
GAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCA
ATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTG
TGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAG
AAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGA
TTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTG
GAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGT
GTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAA
CAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCA
TGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACG
GACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGA
TGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAG
TATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAA
CAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATC
CGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAG
CGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGAC
GATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAA
ACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCT
CACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATC
CAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAAC
ACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAA
GTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTG
ACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTC
TCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAAC
TGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTC
ATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCG
AATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTG
CTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATG
TCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATAT
GATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAA
AGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATT
GAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATG
AGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTA
AAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACT
TCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCA
CGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATC
GAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAA
AGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGT
CAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGA
CACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATAT
CGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATC
ACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGA
TGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGA
AAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCG
AAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAA
AGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGG
AGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTG
GAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTT
CTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCG
AATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAA
GAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACC
TCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTC
CAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCAC
GATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTC
CACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAAT
ATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCAT
GCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAAC
GTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACG
GAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAA
CAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGC
GTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTT
CAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCAT
TGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGT
TCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGAC
AATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCC
ACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAAC
AGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATG
CTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGA
TTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGA
AGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCG
TAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCT
TGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAA
CAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAA
TTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACG
CTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCT
GCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACT
TCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAA
ACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAA
ATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAAC
TTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCA
TCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAA
ATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCA
AAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTC
CACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGA
CATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCT
GAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAAC
ACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTT
TGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGC
TGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGC
TAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATA
TACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATT
TCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCAT
TTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACC
ATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAG
ACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAA
ATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAG
AAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTG
CAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTT
GACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAA
CAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCA
CCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCC
CAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTA
CGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCG
TCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGA
TGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCT
TCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCG
ACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTC
CGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGC
GAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAA
TCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGC
CGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAA
GATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGG
TCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGG
AGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTA
AACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACAC
CTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATC
TTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATAC
AGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCAT
GGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAA
GAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAA
ACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAA
CCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGA
AACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTG
TTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAG
ATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAA
CTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGA
AATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCT
TCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCG
AACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAA
ATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAA
AGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGT
TAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTC
AAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAA
ATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTT
ATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTA
CCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCG
ACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAA
AGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGA
TGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAAC
CGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTG
AATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTC
GGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGAC
ATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCA
TTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTG
GTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATC
GAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGC
ACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTG
CAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGAT
TTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGA
GAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAA
GAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACA
ACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATC
AGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTC
AACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAG
GACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTT
TAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGAT
TCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGAT
TTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAG
ATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAA
CTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAA
CACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACG
TCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACT
CGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGC
GTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAA
AACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAA
ACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACG
ACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAAC
AAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAA
GTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTA
TCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTC
GAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAAT
GGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACAC
GTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCT
GAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGAT
CGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGC
TTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAA
GAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATC
TTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTG
ATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTC
GATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCA
CAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATG
ATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGAT
CGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAA
ATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGAC
ATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGG
ATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACT
AAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCT
CAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACC
TCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCT
GAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCAT
GAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACG
TCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTT
TTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGA
AAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCAC
TAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATG
CATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCT
GGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAG
TTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGA
GAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGA
TCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCA
AAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACC
ACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCG
GGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGC
TCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAG
GTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAA
ATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAG
CCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTC
TTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCC
TGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATT
GAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATT
GTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTAT
TGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCA
CCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACT
TTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACAT
ATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGC
TCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCA
GATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAA
GAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAA
GTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCAT
TGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAA
CTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTG
GAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTT
ACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCG
ATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACA
ACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATG
ACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGA
CTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGC
TGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGC
GTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGAT
GATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATT
GAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTG
AGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAA
AAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCA
ACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGG
CTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAA
TCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGAT
ACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCAC
TTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCT
TCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAAC
GCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATG
AAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTG
AGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAAC
TGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAG
AAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCG
ATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGG
CAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGA
AATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAA
GGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGT
GAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATT
TGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTA
GGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATG
CGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCG
AGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAA
TTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGT
CATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAG
AAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGA
TTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACC
AACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGAT
GAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGA
GCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCA
CCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTC
TGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACG
AATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATG
GAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCT
ACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGC
AACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACA
TGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACG
TCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTA
CTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTC
AATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGA
GAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTA
AAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAG
ACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGA
TGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATG
CAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAAC
CTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAG
CCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACA
CAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGC
AACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAA
ACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGAT
ATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCA
AATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAG
CAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAA
ACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGA
ACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGG
TGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTT
GTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTA
TATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAA
CCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAA
GAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAA
ACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGT
TGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGT
GTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGT
AACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGA
ATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTG
GGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGA
AGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAA
GAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCA
GATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCG
AATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGT
GAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACA
ACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGA
CAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTG
GAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCAT
GATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTG
GAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAA
ATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGT
GTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCC
GTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAA
CGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAG
GAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACA
TGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGT
GACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGG
ATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGT
TGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAAT
CAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAG
AGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCT
ATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCC
ACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCA
CTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGA
TGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGT
TCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTT
AACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGT
GGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCAC
TATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAA
AGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGAT
GAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATT
CAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTA
ACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAA
TGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAA
TCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGA
AGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACG
GACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCG
AAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCT
AGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTC
TCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCA
TCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACA
CCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATG
GTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATG
TGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGG
AACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGA
CGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAA
TCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGT
GCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGG
ACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCT
TAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGG
ACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCT
AGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAG
AGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTT
GATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCA
GACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCG
ACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCG
TCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCA
AGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTC
GATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGA
TACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGT
TAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGA
GTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGA
AGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAA
GATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTG
CCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGT
CAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCC
ATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATT
TGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCC
TATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGG
AAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTT
GATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAAT
CTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGA
AATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCG
CCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGA
CGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAA
ACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGG
TCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCG
CAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAG
CCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTA
TTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACT
CATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGA
ATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATG
TTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGT
CGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATC
GTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAAC
GCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCA
CAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAG
TTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCA
AACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATC
AACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTT
TGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAAC
GAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTT
ACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATG
CAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGC
ACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTA
AAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGAC
GAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGT
CTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGA
ACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGG
TTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGA
TGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAAT
CATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAA
GACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGT
TGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTC
TTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCA
GAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACA
AACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAA
GCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTC
CTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTT
ATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGA
AATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACA
GATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACT
TGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATC
TGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTG
TTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTG
GTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATA
CAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCA
AACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACA
GACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTG
GAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGG
TGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCA
CTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAA
TGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTT
CGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACG
CCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCG
ATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCC
CGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATT
GACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATA
TTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGAC
GAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACT
TTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAG
CGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGA
ACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTC
CAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGG
AAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTC
AATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTG
TTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCT
ACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATT
GAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCG
TGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGAC
AAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAA
CAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGT
TGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAA
CAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCG
CATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGA
ACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAA
GTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCC
TAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGA
AATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAA
ACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCT
AGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATT
AGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTT
CAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTT
TCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAA
AGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAA
GAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAA
TGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAG
TTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTAC
CAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCT
TAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAA
TGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAA
ATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGC
GGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGT
CGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCAC
GAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACT
GAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGG
ATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAAC
GAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCC
ATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAA
AACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATT
GCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCA
AGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAG
AAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCT
ACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACT
CGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACC
TCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTT
GCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAA
AGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTG
CTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAA
CATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAA
AACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGG
ATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGC
GTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGT
TTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGG
AAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTC
ATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATA
AACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAA
GCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTAC
ACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCA
ACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAA
CAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCAC
TTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTC
AAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGA
AGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATT
ATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCT
TTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGC
TGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCA
TCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCA
CTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACC
AGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGC
GTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAG
GCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCA
CTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTT
CAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGG
ATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCAC
AACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAA
GACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGT
CAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGA
ACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACT
AGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATT
CAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGT
CTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACG
GAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGT
CGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGC
TTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAG
AAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGA
GATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAA
CAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACA
GCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGA
ACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATT
TAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAAC
GCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCA
AAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTG
CTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGT
TTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATT
GGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATG
GGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTT
GGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGG
TTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTA
GCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAG
ATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTG
CAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATC
GGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTT
TCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCG
TATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGG
GAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGA
AAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGA
TAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATA
ATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAA
CTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACA
ATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCAT
TATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAG
GGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTT
TCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTG
CAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGAT
ACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTA
GCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAA
ACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACA
ATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGA
GGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCA
TCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAA
ATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGG
TAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTG
TTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGAT
CAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAA
AAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTG
AACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTA
ACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGG
GCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATG
TGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAA
ATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACT
CATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTG
ATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCG
TATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAAC
GCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCG
ACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCT
TGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACC
CCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTG
ATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACAC
AACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGAC
TCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGA
AACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGG
TTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTG
CTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGC
ATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAAC
TTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGT
ATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCG
GTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAA
TGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAAC
ACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGT
CCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATA
TCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGA
ACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAAC
GATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATT
CGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTA
TCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATC
GGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACG
TGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATG
GGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATG
ACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAA
AAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATT
GAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCAT
GGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATA
TCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTA
CATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAA
TTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAG
CTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAA
CGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTG
TTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAG
CTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAA
CTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAG
GAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACC
CACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGA
GAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGG
CGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGC
TGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAG
TACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCA
CATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCAT
GGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATG
ATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGG
GATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCT
CTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAG
CAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCG
GAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCA
AGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAG
CTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAA
ACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTG
ATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTAC
AAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCAC
CGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGT
CAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCA
CCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGT
ATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGT
ATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAA
CTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGT
TACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACA
TCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAAT
GACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTT
CCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAA
TCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAA
GTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTT
TGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAAT
ACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGT
GCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAA
GACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATG
TCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATA
GGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTC
CGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTC
AAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGA
TCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCC
ATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTC
ACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATC
GCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATA
GCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGT
AAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGG
GATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGAT
GATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACG
AGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACA
GTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATT
AACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTAC
CATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCA
GATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGA
CACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAAC
TTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCC
GTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCA
ACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGG
AGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCG
GCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAA
CGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACA
ACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGG
GTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTG
TCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGC
AGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAG
AAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGG
TGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCA
TCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCT
TACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACC
AACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAA
GAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGA
CCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGA
AAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTA
ACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGG
AGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGA
GATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAG
CTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATT
CTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGA
CTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATA
TTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACA
AATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGA
ACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATG
AGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAA
ATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCG
GCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAA
AGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTAT
TGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGA
TCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAA
TGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGT
CACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCAC
TCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTT
CGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAA
ATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAA
AGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTG
GACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGT
ATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCA
AGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGA
TTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGA
CAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCT
TGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGAT
CTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAA
CCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAA
TCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTA
GAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAA
TCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATG
ATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGA
GAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGA
ATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTG
TCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAA
ATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTC
CAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACA
AGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATC
GAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCG
AGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTA
ACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATC
GACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACA
CCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCA
CCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAA
AACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATC
GACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGC
TATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCA
AAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAG
AAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGA
AGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAAC
GTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGA
AATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGA
GACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAAC
TTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAA
CGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAA
GGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCA
CTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAA
GAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAA
GCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGC
AATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAA
TGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAAC
ACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTG
GATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGT
CAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAG
ACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATT
ATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGC
CGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGC
GTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAA
GACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCT
GGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGA
AAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAG
AACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGAT
CACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAAC
TAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGT
GATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTC
ACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGAT
GGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAAC
TCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAAC
GATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCG
CTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATT
AAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATA
TGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTG
GAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATG
GACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAAC
TCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACT
ACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGC
TCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCA
GTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATC
GTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTC
CGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGC
TAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAAT
GGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAA
GCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAA
AGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGA
CAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTA
AAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAA
CTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGG
CACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTG
GAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGG
AGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACG
GTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAA
GACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAA
TATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCT
TAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATG
CGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGG
GTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGC
AGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAA
ATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAAT
CATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGC
CCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCA
CCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTC
GCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGG
ATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGT
TATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCA
AACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAA
GACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCG
TTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAAT
CTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCA
CAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAAT
GATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGA
CAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAG
GAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCAC
AAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAAC
TTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTG
AAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACC
AAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCA
TTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCA
CTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATC
GATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGT
CTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATG
ACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATAT
CGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAA
ATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATT
ACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCG
GTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACT
TGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTT
CGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTT
ATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATG
TCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGAT
AGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTAC
TTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAA
AACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTAT
CGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTG
AGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACG
TGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACA
AACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAG
AATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTG
ATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGAT
TCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAG
TTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAA
CAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTC
AAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAA
TTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGA
ACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGT
TCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGT
GAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTC
GGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGT
ACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTG
GTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTG
ATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGAT
GACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAA
ACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAAT
CAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTC
GTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGC
ATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACAT
GGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAG
TCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAAT
GCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTT
TACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTG
AACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTT
GGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGAT
AATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGG
CACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCC
AATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATG
GCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACA
TTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACC
AAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGA
GAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAA
AAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTAC
AAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTT
CTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGC
GTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATG
TCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCA
GTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGC
TCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTG
AAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAAC
AACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAG
TTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAAC
CGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGA
AGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACG
TCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTT
CCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGG
ATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACG
CAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGT
GGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATG
ATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGC
ACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAA
ATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATA
GCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAA
CAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGA
AAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAA
CCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAA
CAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGT
TCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTC
GTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACA
ATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAA
CAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAA
GAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGA
CCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAG
CGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACA
TCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAA
TCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTAC
GTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGC
ATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATA
CTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTT
GAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGG
CCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGC
CGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTG
CCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTC
AAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGA
AACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATG
ACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGG
ACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGG
CGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATG
AAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGC
GTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACG
TGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGA
AAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAAT
GCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGG
CGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAA
CTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGC
AAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGAC
TAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAA
CAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGA
AGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAAT
TGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTG
GAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAA
ACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATT
TGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGA
GTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGT
CATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACA
ATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATG
GAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGA
CGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATG
AATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTA
TATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACA
ATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCG
TCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCG
AATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGA
TCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAAC
TACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCA
CTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCA
AAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACAC
AGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGT
CGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGAC
TGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTC
CTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTG
ATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCAT
TCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAA
TCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCT
ATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTC
AACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGA
TTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAG
AACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGA
AAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAG
ATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAA
AGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTC
TAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACG
CCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGA
AAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAG
TTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCA
AATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACA
CGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCG
ACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCAC
CAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATG
GGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAA
GAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAA
ACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAG
ATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAG
GCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGA
AACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCT
TGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAA
TCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGA
AGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTC
TTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCA
ATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGA
TCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCA
CAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATAT
TTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGC
AGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGT
CGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGA
AAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACA
ATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGT
GACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCA
AAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTG
TCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTC
CGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAA
TATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCAC
CAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAG
AATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCT
TGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATT
TCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAG
CATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTA
ACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTG
AAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACA
AATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATT
CATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCT
ACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGC
TGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTC
AACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAAC
ATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAAT
TCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTT
CACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATC
AACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAAT
GTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAA
GACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCA
CTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACA
TGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGA
AAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACAC
GGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTG
AGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTG
GATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTA
GTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATA
CCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTC
ACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTT
CAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCAT
GGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGAC
AAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAAT
TGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAA
AATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCA
AGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGA
CATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACA
ACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACC
AGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCA
AGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACG
AATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTC
TTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATG
AGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTC
CCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGAC
TGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCG
GAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGA
ACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATC
GACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCG
AAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGA
TATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTC
ACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAG
ATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAA
CGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCT
GATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTT
TCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAG
GAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGG
AAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGA
GTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAAC
AACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACC
ACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAA
CTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTT
GGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGAT
TTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACT
TGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAA
TCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTC
GAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAA
CAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAAT
CATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAG
AATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTA
AACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAA
AGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAAT
TCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTAT
ATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACC
TCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGAC
ACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAG
AATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATG
GAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCG
ACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAA
TGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGG
ATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACAT
CGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATT
GGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGT
GATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGA
ACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCAC
AAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCA
AGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTT
ACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGA
ATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGA
GATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAAC
CAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAG
GAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAA
CGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGA
CAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTA
GGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTC
ATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTT
CAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGAT
TCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACT
ACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACA
CTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTC
AACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCG
GTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGT
TTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAA
CCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAAC
ACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGAC
GCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAA
GTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGT
CACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATC
GGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGA
ACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGG
CGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGT
AAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGA
AGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCG
GACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTT
AAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGA
ACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTT
TCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGAT
GTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGA
TGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACA
AGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGAT
TTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCG
ATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAAT
CACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACAT
AATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGAT
CAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAA
ACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCA
AGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTC
AATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGA
GCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGA
GTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTC
GGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTT
AACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAA
AGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTA
ATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCA
TAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGG
ATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTT
CACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGA
ACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATC
AGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAA
GAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCAC
CTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGG
CTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTC
CAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGT
GGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAAT
TACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCC
AGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTT
CGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTG
TTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGA
AAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGT
CAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTG
AACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACC
AGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTT
GAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATAT
CGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTC
ACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGA
TATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGA
GACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGT
GAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTG
AAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACT
ACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGA
AGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTAC
CCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGAT
GTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAAC
GACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGAC
AAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACT
GGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTG
ACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGT
TCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGA
TCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGA
AGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAG
AGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAA
ATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAAC
AGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCT
TTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATC
GCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATAC
AACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTT
TCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTC
AACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGC
CTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAA
GAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAG
TGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTG
AATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAA
GAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGAT
ACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCA
ATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAA
TCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGG
GTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGA
AACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTG
GAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGG
CGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCG
TACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAG
AGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATT
CGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCA
TTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAA
GGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATT
TAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAA
CTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGA
AGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGC
ATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACC
ACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTG
TATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAA
TCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGA
ATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTAC
TTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAA
CAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATG
TACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTC
AGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACT
GAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAA
TAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGA
AATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAA
AAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGAC
TGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATG
TTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCA
GAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCT
ACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCC
CTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACA
AGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAA
CAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAAC
AGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATAT
TGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAA
TCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCA
ATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAAC
ACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAAC
AACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTG
GCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGT
AGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATA
TTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACC
ATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGA
AATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAAC
CTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTG
ACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGT
TGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAA
CAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAAT
GCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGG
AACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAG
GAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGA
AGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGA
TCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAA
TCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGA
ACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAAC
TGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACA
ACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGA
AAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGA
TGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGA
AGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAAT
TAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGT
CCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGT
CGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACG
CAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGA
ACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATG
AGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGA
CCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGAT
GGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTG
GCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCA
GAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAG
ATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTAT
TCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCAC
AGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACT
CTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATG
GTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTC
CAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAA
CAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGG
TTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTA
TTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAG
AAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGA
AAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCA
AGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAAC
GCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATG
GATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATC
GAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAG
AATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGA
CAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAA
GAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAG
AAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTC
TTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATC
ACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACC
AAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGT
AACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTG
TCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAA
CCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACG
GGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATC
TCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGC
AGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGAC
GTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTA
GCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGAC
GAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAG
CGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAG
TACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGA
TCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGA
CAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGAC
AACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTC
AGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAG
AAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGA
TGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATA
CGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTA
AACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGT
TTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAG
ATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGA
TGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCC
GCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCA
AAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCAT
ATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTG
ATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTA
TTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAA
ACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGA
TGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCT
GTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAA
TAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCC
TCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACG
TGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAAC
ATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTC
GTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCA
ATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCC
TTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATT
GGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCA
TGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAAT
AAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTT
TAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCG
GCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGT
TGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGC
GCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACA
AGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTT
GCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAA
CGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAA
CTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTG
TCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGA
GACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTAC
AACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCA
ATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCAC
AACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAA
GAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGA
AAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCT
TGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAAC
GAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTT
GAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATG
AAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCA
TTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGA
CTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTG
GCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTT
GCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGA
GACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAA
CCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGC
AAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCT
TGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTAT
TGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAA
TGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGA
TGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTG
ATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTG
ACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTT
AATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGT
CTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACA
GGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAA
CTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGA
CTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGA
AAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTG
GAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACT
CATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATG
ATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCG
GTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCC
TGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGAT
GGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCG
TAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGA
CCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATT
CAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGA
GTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTT
TAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCG
CTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAAC
AGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCA
ACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAA
AACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAA
TGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTT
TTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTAC
GTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGA
AGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTG
CTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAA
ATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACA
AGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTG
CAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACA
GTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCA
TGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAAC
GCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGT
TTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTA
ATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAA
TCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAAC
GAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAG
TCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAG
ATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCA
ACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTC
TGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAG
GAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGA
AAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATG
CAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTT
CAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCA
ACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTA
AATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATG
AGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAAT
GGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGG
AAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCG
GATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGA
AGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGA
AACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGAT
GCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGA
ATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCAT
TGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAA
CAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGC
AAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAG
AAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAA
AAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTAC
ACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCG
ACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTC
GAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGC
GGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAG
CAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCT
GTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACA
TCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAA
CATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGAT
GACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGT
TTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTT
GTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAA
GGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCAT
TCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAA
CTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGC
CGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACAC
GACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAAC
GCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACA
ACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTT
TGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAA
AAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAG
ACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTAT
CAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTT
AATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTG
AACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATC
ATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACT
ATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAG
AAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGT
GCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGC
TATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACT
GGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCA
GAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGAT
GGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAA
CACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGA
CCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCA
AACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAAC
GATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAG
TATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCA
AATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCT
CTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGA
GCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCG
TCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTT
TCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAA
GAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGA
TTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACA
GAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGC
ACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAAC
TCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTA
GAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGC
TGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAA
ACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCT
AGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTT
TAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGG
TTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGG
CGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGG
AGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTT
GACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGC
TTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGAT
TACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCA
AACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGG
ATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTC
AGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTA
TTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGA
GGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAA
ATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATA
GCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAAT
GAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACT
CAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAAT
TTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTA
TAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGG
GCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTC
AAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCA
AAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATAC
AAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGC
TTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAAC
ACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAAT
GGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGG
AGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATC
ATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAAT
TAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTA
AAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTT
TTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCA
GACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAA
AATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAA
CGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAAC
ACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGC
GCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTG
ACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAAT
CTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCA
TTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGAT
CGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTA
TGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGC
TTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGAC
GTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTG
AAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCC
AATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGAT
CAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAA
CGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTC
GGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAA
CAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTT
ATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCT
TCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCAT
CAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTT
TGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTAT
TACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGT
ATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATG
TTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACAC
CGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCC
AGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATC
GAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAAC
TTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGA
TAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCG
AAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATC
GATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGG
TAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTG
CTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGG
ATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGAC
GTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAA
GGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGA
ACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGG
AAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATC
CACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACA
TGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATT
TGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCT
GGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACG
AATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTT
GATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCT
GAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACT
TCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGA
GATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCA
CATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGA
AAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCG
CCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTG
GACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTA
CAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACA
TCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGG
ATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGAT
ATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGA
TAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCT
TACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCA
GAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGA
GGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAG
GCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCT
GAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAAC
GACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGAT
TGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAA
AGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCG
AACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCA
AACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACC
ACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTAT
GGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTAT
TCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACT
ACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTA
CCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATC
ATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGA
CCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCC
CACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATC
ATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGT
CGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTG
ATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATAC
AAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGC
AACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGA
CAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTC
GACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGG
ACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCG
CCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAA
GTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATC
AAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCAT
CTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCAC
TACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGC
AATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGC
CTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAA
ACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGA
TACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGA
TTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAG
AGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGT
GTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAA
CCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCA
TGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGA
TATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACA
CTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTT
GTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGT
TTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAAC
AACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAG
ACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGC
GAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACG
TAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAAC
CATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGT
TCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTC
AGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAG
GTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAA
ACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTG
TTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATC
CCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTA
CCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAA
CTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGA
GCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACC
TGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAA
AGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAAC
AAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAG
ACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGA
TGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCT
AACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCT
AACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACT
TCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATT
TCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAA
TGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAAC
GAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAG
ATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAAT
CCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGC
GACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAG
ACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTG
ACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATC
GATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATG
GGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCA
CGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTC
GGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCG
TGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAAT
TGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAG
GTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGA
CACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTAT
CCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAG
GAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATT
TGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACA
AGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTG
AAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCT
CATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACC
AATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATC
AAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGA
AAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATC
TGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGAT
ATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGA
AATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAAT
GGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTC
GACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAAT
CGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCA
AATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAG
TCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGA
AATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAG
AATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAAC
ATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGA
CATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACC
AACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACC
GCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAA
CTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGA
CGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTA
TATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAA
AAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAA
AGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAG
AATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGT
TGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAA
TGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGA
CATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTT
GAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACG
TGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGG
AGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACT
GGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGA
AGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGC
GAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAA
TGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATG
CAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACAC
AGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGA
TAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCA
GTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGAC
GACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTAT
CGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCG
GACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGT
TGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGA
CAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGG
TCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAA
AATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAA
CAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCA
CAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTA
GTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGA
TTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCAC
CAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGG
AATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTC
TGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGA
TTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCT
CTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAA
AGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATG
GTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGA
AGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGA
CTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTC
CAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTAC
GGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTC
ACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGT
GTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGT
CGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCG
AAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTA
ATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGG
GACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGC
TGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAG
TCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACA
AGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAA
ACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACT
CTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCA
CATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGA
GCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAG
AGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGT
GATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGA
CCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATA
TAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTA
GTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCG
TGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGT
ATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAG
GATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAAT
CATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCA
TATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCC
TCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACC
TAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGC
CCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGAT
ATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTA
TGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAA
CCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGA
CACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTT
TAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCT
CAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACA
AATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGA
TTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACA
GACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGA
ACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAA
ACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTT
CACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAA
GTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAA
AGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATT
GAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACT
CATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGA
TTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCT
GGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGAC
GCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCG
CTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAAT
TTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTAC
ACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGT
GGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTG
TGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCG
ATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTAT
CGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTC
TCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAG
TGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTT
TGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAA
CGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCG
GAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAG
ATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTG
GACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAA
CGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAA
TTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGAT
CGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTC
GACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTT
ATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACA
AAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAA
GATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATT
CAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAAC
AAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTC
ATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGA
GCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGG
ATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTAC
TGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGT
TATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGAT
GTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGA
CATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAAC
AAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCA
AAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGT
CGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCAT
TGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGG
TTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTC
ATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGC
AGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTA
CGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAA
CGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGG
AAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAA
TTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCA
CTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAA
TTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGC
AACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATT
GGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAA
GCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGA
GACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAA
GTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAA
AAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCT
TTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGT
CTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTC
GACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGT
GTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTC
CCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAA
ACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAA
CCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTT
GGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCG
GGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAG
GGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTC
CCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCC
ATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGAT
GACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCA
ACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGG
ATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGAT
GAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCAC
GACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAAT
TGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGC
AGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACA
GTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAA
ACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACC
CGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACA
AGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTC
ATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGT
CACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAAT
GGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACA
GTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGA
AATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACC
AGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCG
TCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATC
AAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATC
CGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGT
TCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCAT
GATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACT
GGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGA
GCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCC
CTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCG
AAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCC
GATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAA
ATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAA
CTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGAC
AGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGAC
CCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCG
ATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAA
GAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGT
TGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTG
ACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAA
GATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGC
ACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCG
TTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACT
AAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAA
GCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTA
AACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACA
AGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAG
AGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTG
AAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGA
ACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAAC
TGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTG
AACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGT
CACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCA
TTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAAT
GCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGA
GCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACG
GCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAA
TACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATA
TGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAAT
TAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTC
GAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAA
TGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATC
GTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTA
CAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACT
AAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAA
GTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAG
ATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCG
GAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTG
ATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCT
GAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGAT
GTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTC
GAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATC
GATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTAT
TAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAA
CGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATT
GATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAA
CCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAA
GCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGAT
TGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAG
AATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTA
ACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCC
AACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAA
AAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTT
CCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAA
TTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACG
CTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGAC
GGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCA
ACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGG
CTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGA
AAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAAC
TTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGAT
GTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGC
ACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAA
CGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTG
GAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATC
ACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAG
GCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTT
ATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAAT
CCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATC
GGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACA
GGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTT
TCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAG
ACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCG
CGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAA
GCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAAT
TTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGA
CCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAA
AAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTC
ATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCG
AAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATA
TAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCA
GATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAA
TTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTG
ACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTC
AATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCA
TATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAAC
CAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAA
AGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAA
TACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCA
TTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTAC
AGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTG
TATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAA
CAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACAT
CATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTC
AAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCA
CATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAA
CGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGT
CAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGA
CAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACT
ATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATG
GCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAA
ATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGG
ACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAG
ACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGA
TCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGT
GAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACC
ACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCAC
TAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCA
AGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGG
AGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAA
AGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTG
ATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAA
TGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAG
TATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACA
TTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAAC
AGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAG
ATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAG
ATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAA
TCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTT
ATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAG
CGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCC
AACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTG
AAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGA
AAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAAC
ACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGA
CAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAA
AAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATA
TCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCAC
CACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGAT
TGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACG
GTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGA
TCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTC
CGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGA
GTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAA
GGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGT
CATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAA
CTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCAC
AATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACT
GCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGG
TTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTT
ATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTG
GTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATC
GCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGA
AATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACA
ACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCA
TCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAA
TCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAA
CGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAG
CGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTC
ATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATAT
CACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTC
CATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACAC
CATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAA
TGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGA
ACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGAC
TGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATG
ATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGAT
GCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCG
AAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGG
GTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGA
TACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAAC
AAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAA
GACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAG
TAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTAC
AGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAAT
GTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGA
TTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCA
ATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGA
ACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACG
AAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACA
GCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGG
TGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCAT
TACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCA
GCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTC
GTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTAC
AAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACT
TACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAA
CGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGT
GGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTT
ACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACC
AACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACAC
AAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGC
TATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGT
TGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCA
CTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGG
TGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAAC
AGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCG
GCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAA
ATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAG
GGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGA
CAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAA
AGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAAC
GTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTC
ACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGT
TGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATG
GCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAG
GAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTT
GACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGAT
TACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCA
CGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAA
TCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCA
AATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAAC
CACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAG
GACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAA
TAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGC
TGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGT
GGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGG
TGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAA
CCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAG
GAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAAT
GATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATA
ATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGAT
AAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCA
CAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAAC
AAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAG
AGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGA
AACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCT
ACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCT
AGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCA
GTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGG
ATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTA
CGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAG
TATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCG
ATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTT
GGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAA
GATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCA
GACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAA
CAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAG
AAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGA
AAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCG
AAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCAC
GCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATA
TTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGA
CCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGA
GCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAA
ACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTAC
AGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAG
TCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCC
CAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGT
CATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGA
CAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAA
AGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGG
TTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGAC
TTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTC
AAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATC
TGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAG
GTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAG
CATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAAT
TCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAG
TTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTT
CCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGC
TTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAA
CAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTC
TGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAA
CGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCT
GAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGA
AATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTG
GGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAA
TATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGA
GAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATAC
AAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAAT
CTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATC
TCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGT
CCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAA
CTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGA
GGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCG
ATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTA
CTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAG
TATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCG
ATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATT
TTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGG
CTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTA
GAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACT
AAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAG
AAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCAT
GATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCAC
CACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTA
TTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATC
GAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAAT
CTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTT
AAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACA
GGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTA
CCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAG
AGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGA
AAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATA
AACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAA
TGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAA
GATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTG
AGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTT
GATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGA
AACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTAC
AAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCT
AGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAG
CAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACA
GAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAG
TACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTG
TCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATC
AAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAAT
CAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACAC
TGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAA
CAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGC
CGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAG
AGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATT
GAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCAT
ACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAA
TCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCT
TCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGAC
ACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTG
CACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACA
ATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGC
CAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAA
CAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGA
GAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAG
TGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATC
CACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATC
TGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAAC
GATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTG
ATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAAC
AGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAA
GCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATG
ATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAG
TCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTA
GGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCC
GCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCG
TCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCA
AGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAAC
CTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAG
ATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACC
ACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGG
ATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGC
AAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGA
ATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGAT
CAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTC
TTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAG
ATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCT
GTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGT
AACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCA
GAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACA
GAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTT
AGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATT
GGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAA
GACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAA
ATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAG
CGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGC
CCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGA
TATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGA
ACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAA
TACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACA
AATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGA
GTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAA
GACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTT
AGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCAC
AACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAA
ATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAA
CGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTC
AATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACC
AACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGG
TGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTC
GAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAG
ACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGT
GTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGC
GGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGA
ACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCG
TCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTA
CCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATC
TTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACA
GCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAA
CTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAG
GAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAA
AGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATG
TCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACG
AATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAA
CTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTT
TATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGAT
AAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATG
ACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGC
ATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAA
GCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATAT
TTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGAT
TCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATT
GGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAAC
ATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATG
TCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGT
TGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATA
GTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTC
TTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTG
TAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACAT
CAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGT
TCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAAT
GGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTT
GTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGG
ACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATG
TCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAA
ACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTA
ACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGC
GAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTG
GAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGC
ACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAG
AACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGC
AGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACG
TGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACT
TGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTC
GACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGA
CCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAA
CGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAAT
TGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAA
CTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGA
ATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAA
AGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTG
AACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGA
GAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGA
GATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAA
GATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATT
AGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACT
TCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGC
GAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGC
GCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGA
CTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACC
AGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAA
ACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTG
ATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTG
GAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATG
TGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATG
ATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGAT
GAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGAC
CACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAA
TAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCT
TCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGG
GATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACT
GAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACT
CAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAA
GAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGA
GAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCA
TGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGAT
GATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGT
GACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTG
AAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGG
AATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTA
AACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACC
TCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCA
AGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGT
GCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTA
AAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCT
GACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAG
TGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAAC
GCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAA
CTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATG
GTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTT
GCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGT
GAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAG
AAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCT
GAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAAT
CTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAG
TACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCA
ACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGT
TAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATG
AGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGC
AGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTT
GGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAAT
AAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATC
GAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGA
ATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTC
GTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGAT
TCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAAC
TCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTG
TGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGA
GTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAA
AGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCA
AAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCA
AAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAAC
GTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAA
TTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAG
CATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGG
AAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAA
GACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGA
TGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAG
TCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAA
CAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGC
GCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAAT
GGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTG
CCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACA
GTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAA
AAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAA
GTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAA
GGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACAC
GTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGAC
CAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGA
GAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGG
CCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCA
AAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGT
TGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATC
AACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACA
TCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGA
CTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTT
TCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGT
AATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGG
CATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTC
AACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACT
TGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCG
GAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGA
CTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGC
CCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAAC
CACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTG
AGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAA
AGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGAC
TTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCA
GGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAA
TCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAA
CAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCAT
CGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTAT
CACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAA
AATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGC
AGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTA
TTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGG
ATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGA
AGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGG
TCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACA
CAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACC
CAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAA
CTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGA
TCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTA
TTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAA
TACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCT
TGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGC
AAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTC
GGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTC
CCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGA
AGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATT
ACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGA
ATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCAC
TACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTC
TTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGA
GAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTG
CCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAAC
ATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAG
CATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTA
AAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTT
GTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCG
ACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAG
AACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGA
CGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTT
TACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTA
CATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAA
CTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGAT
CAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAG
GAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATT
GGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGG
AGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAAT
CTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGC
CCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGA
GACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCA
AACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTT
AGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATA
ATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGC
TGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAA
AAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAA
AGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAA
AGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTT
TCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACAC
TCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGG
TGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAG
ATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCAT
CCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTA
GCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAA
AACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTT
ATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGA
CACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAA
TGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACG
ACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACAC
CCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGC
CGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGAC
CGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCT
CTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATT
CGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCG
CTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATG
CAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTT
ACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGT
TAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAA
GAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAA
TCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCA
AGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACG
GCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGG
CACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACA
AATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTAT
CTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTC
TGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCA
ATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTG
TAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTA
CACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTAT
TTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTT
TTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCG
GCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAG
ATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGA
ACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTT
AAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATA
ACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAA
AGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGA
TATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTA
AATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCT
AAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGAT
CACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGT
CAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGG
CTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAAC
AAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAA
ACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCA
CGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATG
ACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTG
CAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGG
TGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAA
TCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGA
TAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGA
ACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTC
CTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGA
TAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACA
TACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAA
ACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCC
AATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGA
CAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACA
ACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATC
AAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGAT
CTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATAT
GAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATA
GCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTA
CAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGA
ATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGG
ATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGC
GAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGA
AACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGA
CTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTG
GCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAG
CTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAA
CTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAA
CCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCAC
AAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGG
GGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTC
TTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTAC
ACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACC
CTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCAT
GAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACC
TTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCA
CAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCAT
TATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCG
TCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGAT
TCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAA
ATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAA
CACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACA
AGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGA
CCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGAC
GTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCC
AACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGT
ACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAA
AGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCT
TTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTA
CAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAA
TGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCT
TGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAAC
AGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATA
CGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATT
GTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAG
AATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGT
CAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACC
AAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATG
TGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATA
TCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACT
TTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGT
ACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTT
TCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAA
CAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGAC
GTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGA
ATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTA
AAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCA
TGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTC
AAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAG
GACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGT
GCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAAC
TGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTT
AACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCC
CAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACC
AGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACT
CAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGC
TTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTG
TCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAG
CTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAA
ACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGAC
CACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATG
ATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAA
CGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAA
CACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTC
GACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTC
GATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATG
TTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGA
GAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGAT
TGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCC
ATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGA
CGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGAC
AGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGAC
GTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGA
TGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGG
AAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACG
AAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGG
ACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTG
ACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTG
GACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGT
TTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACA
CACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCC
ACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGA
GCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTG
AAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAG
CAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAA
AGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCA
TCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAA
TCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAA
AACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAA
GACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTG
AAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATAT
TCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAA
TGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGG
GTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGA
CCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCG
AGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAA
TCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTC
ACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAA
TTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAA
TGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACAT
CCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACA
TACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAA
CACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGC
CTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACT
ATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACG
ATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATA
TCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAA
GCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAG
TGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAA
TCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTG
GTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATG
CGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACA
TTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGA
ACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTG
TCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAG
ACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGG
CACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAG
TCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGA
AGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATG
AAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCA
GTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAG
ACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATA
AAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGT
AAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGA
CTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCG
TCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGA
CAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTG
GAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACA
ACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTC
ATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAA
TAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACA
ACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACA
GATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGT
CGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATT
TCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCA
GCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAA
TACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTG
CAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATT
GAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCT
TTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAG
GATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGT
AGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAG
AGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACT
GGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCA
AGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGG
GACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCAC
AAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGT
GGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCG
TTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAA
AGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAAT
CGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGA
CGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTG
AAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTC
AAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAG
AAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAAC
CAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCT
TTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACA
TGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGC
CTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAG
ATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGA
TCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACC
TTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATA
AGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGT
TTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTG
TACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTAT
GATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGA
TGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCA
TGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATA
TTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTC
CGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTA
AAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCC
GAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATAT
ACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATG
AGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACC
AAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACA
CGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTA
GAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCA
ATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAA
TTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATT
CGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGA
CTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAAC
ATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAAC
AATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCA
CTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGT
TAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAG
AAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGA
AACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCA
TCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATT
CCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGG
ATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGC
AAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCT
GTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTT
CGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACAC
GATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGG
TAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTG
TGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGAT
TGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCG
ACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTC
ACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTG
GTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTG
ATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACG
ACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGA
ATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGAT
GTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGA
CAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACG
CAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATT
ACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCG
ACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGA
CAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTAT
GTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAA
ACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGA
TATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCA
AAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAA
GGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCAT
TCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGC
AACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGAT
AAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTG
GTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTA
TCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGT
CGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACA
TTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAA
ATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAA
GTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCG
ATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTG
GATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTT
ATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCAT
CGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAG
AAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACG
ACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACG
ACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAA
ACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATT
ATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACT
ACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATT
GGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAA
CCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGG
GAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGC
TCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGA
CGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGT
CTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAA
ACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTT
CCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCT
GGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGA
CTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGT
CGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCC
GTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAAC
TTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACC
TAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGG
ATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGG
ATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGG
ATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCC
GATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCAT
GCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGA
CCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAAC
TGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGAT
GCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGA
GATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGA
CGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTG
GAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAG
GAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGT
TTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAAC
CAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCG
TATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAG
CATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCAT
CTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCA
CAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGG
TTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGT
TGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAA
TTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAG
TTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTC
GAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAA
ATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCG
AAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTC
CGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGA
TAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGG
ATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGC
AAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCT
TTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAA
ATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGA
TTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAAT
TGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACT
GGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAG
ATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCC
ATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGAT
CCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGA
ATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTG
AGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGAC
TTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGA
TTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCAC
AGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTT
GATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAA
AACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGC
AATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAA
CGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAG
AAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAG
AGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAA
AGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAAC
CATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTG
ACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAA
CACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCA
CCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATT
GAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGC
TTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGC
AACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGC
GACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATA
CGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATG
CTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTA
GAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGA
AAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATG
CTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGT
GGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACA
ACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAA
ACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGT
GCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGAT
TGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGA
AAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGAT
ATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGA
AGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGT
TTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGA
ATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGA
TGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTA
GCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACG
AGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGA
TGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACC
AATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGC
CCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTG
TCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAA
TGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAAC
ATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAA
CAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAA
ACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCC
AACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATT
GACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCT
TTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGG
TGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAAC
AGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCT
GAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAA
ATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTT
CTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGT
ATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCAC
GATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACG
GCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGA
AGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCAC
AAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGC
AAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTAT
CAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCC
GAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGG
TGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGG
AGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTC
CCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGAC
ATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCG
ATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGC
AAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTT
TCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACC
TTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAA
ATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCAT
TGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAA
GTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATA
GAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGA
TCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATT
CTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGAC
GAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAA
TAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATA
TGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCA
AGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAG
ATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATA
CAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATT
AAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAG
CTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTA
TGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACA
ACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCA
TCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAA
GTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACA
TCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACG
AAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCA
GTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACA
ATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTAT
GTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGC
TCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAAT
GTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGAC
CATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGAC
GCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATC
AGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGA
AAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCAC
CATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTA
GCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAG
TGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAG
GTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAG
CTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGAT
TCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATG
GAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTA
TTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATT
CGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAG
GAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGAT
GGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGAT
CTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATC
CACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTAT
CACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCG
TGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAA
CATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAA
GGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAA
ATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACAC
AAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACA
ATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAA
GTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATC
GGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCA
CGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTG
GTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGT
GAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATC
TATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCG
ATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGT
CGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGG
AAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCA
TCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACT
CAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAA
TCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGC
GAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTT
TCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTAT
TCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGT
TTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGC
TGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAA
TGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAAC
ACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATC
AACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATC
GATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACG
TTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCG
GCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCAT
ACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCA
CACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCA
TGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCA
TGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATG
CAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAAC
AGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTG
AAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGAT
TGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGC
AGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAA
AAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGT
ACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATA
CAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAA
GCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGA
CGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTA
GTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAG
AATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGT
CATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATT
GTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAAT
CGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAAC
TCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAA
ACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGC
TCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTG
TTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTA
CAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGC
ATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGT
TGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAA
GGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTA
CAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACG
AGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGG
AATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTAC
AACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAA
CAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAA
GTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTA
TTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTG
AAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACT
TATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTG
GCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAG
AAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGC
TGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAAT
GCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGG
GAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACA
ACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAG
AACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGT
CAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCAC
AACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTG
TTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGC
CTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGA
AAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGA
CCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTA
CTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACG
TTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATC
CCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAA
TCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCA
CATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGA
CCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATA
ATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTG
AAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGG
ATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTG
AATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACC
AAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGA
AATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGA
TGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAAT
ATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAA
AGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACA
GAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAA
GATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAG
AAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAA
CCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTAC
AAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAG
TGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGT
TACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGAT
TTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACG
CGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTA
TTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGAT
TCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGG
TGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGA
TACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGA
CATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACA
AAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAA
GAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAA
GTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAA
AAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGC
CAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATT
TCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACC
GAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGC
GTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAAC
GATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAG
AAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTC
CACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCA
ACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCA
TCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACA
ACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAG
AAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTT
GCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTT
AGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAA
GTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTG
GAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGT
TGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCA
TCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTC
GAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTT
AGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCC
GTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTT
TTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACA
GTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTG
AATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACG
GTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGA
AGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAA
TTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGG
CGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATA
TGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGA
GTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAA
GAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCT
CTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTC
AACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCC
GTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACT
ATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGG
TTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGAT
GACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACT
TGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTA
TACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGAT
GAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTT
GGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCT
GTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGA
AGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAA
AAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAA
ATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGA
TCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCA
CCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATT
GAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGA
GTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCT
CTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAA
ACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGG
ATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACC
TTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAG
CTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAA
AACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAA
CAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATG
CCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGA
TCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAG
GAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGA
TCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAA
CCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAA
GAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAG
CTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCA
GCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGA
GAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTA
CTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTC
AATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAA
AAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCA
AGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTG
ATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACA
ATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCG
AAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAG
CAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGA
AGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATAC
TCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATC
GATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTC
ATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACAC
AGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCA
CAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAAT
GGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCA
AAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACA
ATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGA
AAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTG
CAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCA
CGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTG
AAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGA
TGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGAT
GAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAG
CTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGC
GTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGAT
TTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTC
AGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGG
GAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGC
TATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTC
CGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAG
TCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCT
GTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGAT
GTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCAC
GCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGAT
CTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAA
GCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAAT
TCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCA
AGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTT
CATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGAT
TCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGT
TCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAA
CATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGA
AACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGA
GCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAG
GGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGG
AATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGA
CCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAAT
AGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCG
GAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCC
TCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATA
TTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAAC
ACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATA
CACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAA
TCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGT
TTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGA
CCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAG
AACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAA
CAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAAT
GAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACG
ATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAA
TCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAA
CGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTG
AAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGA
AGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGAC
CATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGT
CTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGG
CTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAAC
GCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTC
CGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACC
CGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTT
TGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGC
AAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACT
TGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGA
GCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAG
CATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTC
GGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAA
TCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACT
GGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTA
TCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAA
ATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGAC
GGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCAT
ATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGC
GTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTT
CATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTC
GATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGG
CTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACAT
TTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTC
TGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTG
GAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGT
GAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTT
ATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTA
GTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCA
ATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTC
GCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGG
CTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGT
ATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGAC
ATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTC
TCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAAC
ACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAAC
GGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGA
AGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGA
ATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCAC
CAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAA
CATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAG
AACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTG
GATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTG
GGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGA
CGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACC
AATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACG
AGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTG
AACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACT
TGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAAT
ATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAG
ATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAA
CAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGA
ACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGA
TTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGA
TGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAG
AAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTC
AAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGA
GAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGC
TAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACT
GTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAG
TTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAAC
GATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGAT
GAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGA
AGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTG
AAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGAT
GCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGA
GATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCA
CAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATA
AATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTC
CATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGA
TGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGA
ATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCA
AATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGA
AATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGA
AGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATG
CTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGA
TGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGA
CGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAA
GAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAA
TGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAA
CACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTC
ATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAG
ATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGC
TTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAA
AAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGA
CACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTG
ATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGC
GGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACT
TTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGT
TTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGC
TTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGA
AATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAA
AACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGA
ACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCT
CATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTA
CAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAAC
CCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTA
GGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAG
TGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAG
ATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGG
TTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAA
AATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGA
ATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAAT
TCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGT
GTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTC
TGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTC
CTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTG
GTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGT
TTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAG
AAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAA
GGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAA
AGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGT
TGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATT
GAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCA
TGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAA
ACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGA
CGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATG
AACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTC
TATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACA
ATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGC
TACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGG
TTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCC
TTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGT
GTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAA
GAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGT
TAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGG
GTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGT
CACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCA
ACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGA
AATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCC
CTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAA
GAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTG
AGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAA
CAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATC
GAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACT
ACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTC
AAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAA
TCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCA
TCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAA
CACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTG
CCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGA
GCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACT
TGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCC
TGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCA
CCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAG
AGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAG
ATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTT
TAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGG
CATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATC
GAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACA
ATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCG
ATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCA
CTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAA
TGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAG
ACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATT
TTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGAT
GGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAG
GTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTC
AAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACA
AGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCA
GCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACT
CTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATC
GGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATT
AAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATA
CGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTG
ACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAA
GGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGG
CCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCC
GCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAG
GTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTAC
CACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAAT
TGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTA
CTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTT
ACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGA
ACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCC
CAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACAT
ACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCA
TGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAA
AAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGT
ATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGAC
AAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAA
CCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACG
AATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTA
CTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACA
TCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACT
GGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCA
GATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGA
ATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGG
AGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAG
CGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCT
TCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCC
GACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGA
CGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAA
CAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAG
AGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAAT
GTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTG
AATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAA
GTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAG
CTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAG
ATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTC
AATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTC
CATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTG
TGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGAT
TGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCC
TACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGC
AATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAA
CATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTAT
TGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACA
CCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATG
ATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGAC
ATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCC
GCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCG
TCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCG
CAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCT
AATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCG
AAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCT
GAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCA
AATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTAC
GACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTA
GATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGA
GGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATC
ACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAG
CTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGC
CAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCA
CGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAA
TTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCT
TCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTG
GTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAAT
ATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTA
GCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACA
CAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTT
GTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTT
AACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGC
CACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGAT
TCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAAC
CTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAA
ACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAAC
TTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAG
TATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATA
TGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAA
TTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAA
ACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCA
CCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCA
AGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCT
TGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAA
AGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAAC
ACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACG
GCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGAC
AGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCA
AAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTG
AACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATC
TGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATA
GTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAAC
GCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCT
TTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATA
AATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATA
CAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAAC
TATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAA
TTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACA
AGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAAC
AACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAA
GCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCT
TGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGA
ATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGC
TCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACA
ATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAAT
CGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGAT
ACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGA
ATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAA
CCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACT
GTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGC
GTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCT
GATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACT
AGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACC
GACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAA
GACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGG
CAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTT
CAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACAC
GATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCT
TGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGA
AGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTT
TTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACA
AGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTA
TACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTC
GTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTC
GTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAAT
ATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACA
CGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAG
AGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACC
CTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGT
TTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAA
CCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTAC
AAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAG
AGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTT
AAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACA
AAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATG
AATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTG
TCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAG
ACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACG
TATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGT
AATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAA
TCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCA
GTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAA
ACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTG
CGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATC
TTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTT
GAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTAC
AGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTC
AATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACA
AGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGT
CGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAAT
ACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAA
AAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATG
GCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAA
ACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGA
CGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGC
CGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTG
TTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAA
CATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCA
AACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAG
TTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCA
ACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTT
ATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTC
ACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCT
TAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAAC
GTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCA
CGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGAT
CACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACG
ATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACA
CAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGA
CCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGA
TTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTT
TCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGA
AGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTG
CAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCAT
GGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACG
AATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAG
ATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGT
CATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATG
GCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAA
ATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAA
GAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGAC
AAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGAC
GTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGA
CACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTT
TTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACA
CTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCAC
CAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGC
TTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAA
GAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCA
AGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAG
GTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATC
ACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATC
GAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAA
CTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGA
CAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAA
GAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTC
AATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATG
AAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGT
TCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACC
TCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAG
ACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATC
GAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCAC
GAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATT
GACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATG
TTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCC
AAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATA
CATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACA
CCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCT
ACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTAT
AACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGAT
GGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATC
GAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGC
AAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTG
GATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATC
GTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGT
CTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCG
GGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATT
GTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAAC
GTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTC
AGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGAC
TGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCA
CAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTC
GAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAG
TATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAA
ATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGT
TTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGAC
AAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAA
ATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAA
GGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACT
TGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTC
TTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACA
GTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGA
GCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAAC
GAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCAT
AACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATA
ACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAAC
TTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGA
TACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCG
AGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTC
AACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGC
CATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATA
CCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCA
AGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGA
ACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTT
GATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGA
TGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAG
TGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAG
CAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGG
TAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAG
AGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGA
CCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAA
GACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGG
GAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTT
GGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAG
ATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCG
ATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACG
ATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAA
ACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAA
AGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAA
ATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCA
AAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTT
CGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATG
CTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCT
GAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGAT
GGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATC
CAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTT
ATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAG
AAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTT
GGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTA
CACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGA
TAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATG
GTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATG
AACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATT
TTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCG
AACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAA
GGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGA
ATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATAC
ATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAG
GATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAA
GTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACG
GTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGA
AGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAAT
TACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATT
TTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCG
AGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACT
TCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACAT
CATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAA
TAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACT
TTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTA
ATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAA
GCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAA
CACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATC
CTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCC
AACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGAT
GCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAA
AATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGT
TTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCG
GATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGA
TTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTA
GCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTG
AATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTG
AGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGAC
CATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCAC
AATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGT
CGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGAT
GTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGAC
ACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAAT
TAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGT
CTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACA
AGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCA
ATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTAC
GTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGAC
CAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACA
GGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGT
TACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAAC
TTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATA
TACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAA
GGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGG
TCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTC
AAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAA
CTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAA
GTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGT
GAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATC
AAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCG
AGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATT
GCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAAT
TCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGT
TGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGAT
ATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGA
TCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTAT
CTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCG
CAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAA
ATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGAC
AACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGAC
TTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAAC
TCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTAT
GTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTAC
CGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGG
AGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACC
ACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGA
AGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTC
TGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACG
GCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCT
GAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAAC
AAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCC
ATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGG
GAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACT
GGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCG
GAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGT
CACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTT
CAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTA
GCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGAT
GAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGAT
ATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGAT
GAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGA
TTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGC
AAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACC
CAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTG
GACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGC
TGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGA
TCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACG
CTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGA
ATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGA
AGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTT
ACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCA
ACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTA
TGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCA
TACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCT
CACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACA
GCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTT
ATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTG
AAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATT
CATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTT
GGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGA
GACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAAT
TATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAA
ACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCG
TTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATA
ACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGAT
GAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAA
AGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTT
ATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAAT
GGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATT
CTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTG
GTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGG
AAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGAT
GCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCAT
TTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCC
GCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAAT
GACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAG
ATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTT
GGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATT
TAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAG
GTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGA
TATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAA
CCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAA
TCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACG
ATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAA
ATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAG
CTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAG
CTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCA
TACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGAC
CAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACA
CGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACC
AACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGA
AGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTT
CGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAA
CGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGA
CGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACG
AGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCT
CACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGA
ACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAA
AAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCT
GATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGG
ACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAAC
AATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAAC
GAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGC
CAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTG
AAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAA
GAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATAT
TGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAG
TCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTT
GAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAAT
TGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATG
GATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGC
GAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAG
AGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATG
AATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAA
TCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCC
TGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTC
AATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATG
TTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACAT
CTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACA
ACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAAC
ACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAA
CAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGA
CAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTT
TAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTG
GAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAG
AGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGA
AGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAAT
CTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCT
TATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTAT
CAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGA
TTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGC
AATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAG
AAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAA
GTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAA
AACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCA
AAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGA
AGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTG
ATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAG
TTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCC
TTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACAT
TGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGAT
TCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAA
AAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTC
AAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTT
GTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAAT
CTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTG
ATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGT
ATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGA
ATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATC
GCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCT
TTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGA
AGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATA
AGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATG
GGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAG
AGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGAT
ATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACA
AAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAA
GTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCT
GATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATG
TAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAAC
TCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATC
GAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGT
GGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATC
AAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAA
AATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGT
TTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAAT
CAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGT
CAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTC
ATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGT
GGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCA
TCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGC
TGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAG
ACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAA
ATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCA
TTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGC
TCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTG
AAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGT
GGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCT
GGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTC
TTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGA
AGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATT
CCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCG
ATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGA
AAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGG
ATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCT
TTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCA
CCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCA
CGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTG
CGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACA
TCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGG
GAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAAT
ACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAA
AGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAAT
TAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGT
CCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGG
AGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACG
ATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGT
AACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGA
AATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTA
TCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGAT
TTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCG
CCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAA
GTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATC
GTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCA
GCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATC
ATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGA
AACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTC
AGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTC
CGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTT
GCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTG
CCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATG
TTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACAC
AACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAA
CGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGA
TAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTT
TACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGC
CATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATAC
CACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACA
CGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATG
AAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATG
GGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCA
AGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAG
TCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAA
GGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTG
CCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAG
GATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAA
GATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTAC
TCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACA
AGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGC
TTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACG
AATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGT
CTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAA
TAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCA
TATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGT
TGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCG
CTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTC
GAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAAC
TGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTC
TCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTT
CGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACA
AGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCAT
TGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTG
GTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGG
TGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACA
ATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAG
GATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAA
TAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAA
CTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACA
GATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGT
CCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATT
TCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAA
AGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTA
TTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGC
GAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAA
AATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTG
CCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGC
AACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGA
GCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAAC
TAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAA
CGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCA
AGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAA
CGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTT
GAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCT
TTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAA
ACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACC
GATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACT
TGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTT
CGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCC
TAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATC
AAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACA
TCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACC
TCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAAT
ACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAA
AGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGAT
TGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAA
TGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAA
AGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAA
TGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATG
GTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATAT
TGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAG
AGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGA
AGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGA
TGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAA
ATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACC
GTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAA
AATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTG
TCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTA
CGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTT
GTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCG
TCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATT
TATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTC
ATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTG
CTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATA
CGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACA
TATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAA
AAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGA
AAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGT
TTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAA
GAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCA
GTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTC
AAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGA
GAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGT
CGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGA
TGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAA
GAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCA
CGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAAC
CCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATC
ATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAAC
GACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAA
AAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGC
CGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAG
ATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGT
GTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGA
GAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTG
ACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATC
GGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGA
GAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAG
TCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGT
GCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTT
GACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGT
TAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAA
TCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGT
CGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAG
AATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATT
AAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCG
AGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATG
AAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGT
ATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGA
AATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCT
CAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAA
CCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGT
TTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTAT
CTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTT
CAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGA
CGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTG
ATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATA
CCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGA
AATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGG
ATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGT
AAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAG
AATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAA
AATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAAT
ATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATC
AACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACC
TCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGA
AATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGT
GAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCT
TGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAAC
AAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGAT
ATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTT
GATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCT
TGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAA
CAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACA
ATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCC
AGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATC
ACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGA
ACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATC
GTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACC
ATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGA
ACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCT
AACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGC
TTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGA
GCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACT
CCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAA
TAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAA
GCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAG
AAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGAT
GACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAAT
TAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAA
AAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCA
AGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAG
TCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTC
GAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGA
TGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCAT
CGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAG
CAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACA
AATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGG
AAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAA
ATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAAT
ACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAA
GGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCA
AAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACG
TCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAA
AACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATG
GTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGA
AACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCT
GAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGT
TAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTT
TAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAG
CTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGA
ACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTA
TGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCG
TCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTC
TTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGT
CTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGT
GAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGC
TTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCT
GAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGC
CGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTC
AATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAG
AATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCA
TCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTC
CACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTC
ACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACA
TCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAA
CAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGC
ATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGG
ACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAA
TCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACC
TTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAG
CTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGA
AGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTC
ATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATT
CAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACAC
GCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACA
CCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATC
GTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTT
ACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACC
ATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAA
CAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACA
AGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGA
ACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGAT
GAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATC
ATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACG
ACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAA
GATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAG
ATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCA
TCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCT
CGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCT
AAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGC
CGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCG
CCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCG
ATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTG
TCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAA
AAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTG
GTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGC
TGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCA
TTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGG
AGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATC
GTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGG
TTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATC
ATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAAT
GGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGG
AGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATAT
CGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGT
ACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCA
TCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGA
TGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCT
AAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTT
GTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTG
GTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGA
GGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGA
ACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTAT
CTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGT
CATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAAT
CTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGC
GTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCT
CGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTAT
TAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACAT
GCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTC
AACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACAC
CATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGG
ACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAG
TAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAAT
AGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCA
AGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACA
TGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAA
CTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGA
TGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGG
CCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACG
TACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAA
TACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAG
TTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAA
CGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTG
ATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATAT
GACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGAT
TAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACA
AGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAAC
AGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATT
GGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATG
AAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAA
ACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAA
AGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGA
AGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTA
GCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGT
TCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTT
TATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGA
TTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGA
ACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAG
GCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAA
AATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGC
CGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGA
TTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACA
GGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAA
TCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCA
TACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATG
ACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAAT
AACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAA
TGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAA
TCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAG
AACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCT
ATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATG
TTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACG
TCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGA
AATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATG
CGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACA
CAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCAT
ATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGAT
GTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTT
CTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAA
AACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACA
CGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGAT
CAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGG
ACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTT
CCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTT
CTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTT
TGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAA
TCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAA
CATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAAC
AATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCA
TTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACA
AGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCC
GACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGG
ACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTG
GTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGAT
TCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTT
GGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAA
TGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAAT
CCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTC
AAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGT
GGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTG
GCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCT
ACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGT
AACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTT
GATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAA
ACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGG
ACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAG
GGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTG
GGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGA
AATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATG
CTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAAC
ACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACG
TGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAA
CCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTA
TCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAAT
GGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTA
CCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTT
GTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTT
CAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGT
GATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGA
GCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTA
AAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGT
CTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCA
CTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAAC
TCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAA
TTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCT
CGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGA
AAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAG
AATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACA
GCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGA
AATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTAC
ATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAA
ACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATC
AAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATC
AGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACA
CAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCC
GACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGC
TGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTG
AAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTG
ATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACC
CGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAG
GACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGAT
TATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTA
GTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCA
TTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGA
AACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAAT
TACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGAT
AGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACT
ACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATG
CAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGAC
TGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTT
ACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGG
ATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGT
GATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAA
GAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAG
GCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGC
CACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCT
CCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGG
ATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAA
GGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACG
ATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGAC
CAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGG
CGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCC
TCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGC
ACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGT
ATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCA
CTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTG
CTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACT
CAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTAC
TTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAAC
GAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCA
GGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATAC
AAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATG
CTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAA
GTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTAT
GAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAA
AGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACC
AGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAA
TCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACT
TGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATC
AACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGG
CTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGA
TCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAAT
TCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAG
TTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCG
TGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTC
GAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGA
CTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACG
CTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACA
ACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAG
AACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGT
ATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAA
TCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGT
TAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCT
CAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGAT
GTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAA
TGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCA
TGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTG
CGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTG
TGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTA
CAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAA
TGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACA
TTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTG
GCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACC
CAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGAT
GGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACAT
AATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGC
TTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTC
AGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCA
GAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAA
TGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAA
AACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGA
AGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAA
TTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGA
CTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGA
TTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGG
AACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCAC
CATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCT
CATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCA
ACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACG
ACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATT
CAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTC
CAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGT
CTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATAT
AGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGC
CTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACA
GGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGT
AAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAA
CTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCA
CGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTC
CTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCT
AGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAAC
ATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTT
GGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTA
TCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATG
ACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATT
ACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAAC
TAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACC
CAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAG
TTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTG
TTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAG
TGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACAC
AATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGC
GTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAG
ATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAA
ATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAA
CAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTG
AAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGT
GTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGC
GCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTT
TGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAA
TTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACA
GTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTA
TCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATT
ATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAG
AACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAA
CAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGC
CATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTG
AAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAAT
GATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTC
GAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAAT
TCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCG
AAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATAC
TTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAAT
TATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACC
ATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGT
CAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGT
CGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGA
TATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAG
AAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGA
CGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGA
CGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCA
AAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCA
ACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGA
TTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTG
GTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAG
AAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTT
GAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAG
CCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATA
CGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGT
CGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGT
TACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATAT
GAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACG
CTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAG
ATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCT
GAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTT
AACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACC
AACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAA
GATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAG
TTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAA
ACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAA
AATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAA
TTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTC
CACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGAC
GTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTA
TCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAA
TTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATC
AAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGT
CCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAAC
CACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCG
CTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTT
GGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGA
AATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAG
GATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAA
TGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAG
AACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCG
AGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATAC
GGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAA
ATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGC
TTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAAC
CCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACG
CTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCG
TTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTT
CATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACA
TCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAA
CGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTT
GGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAAC
TCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTAT
CAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCAC
GTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTA
AGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGT
ACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACG
ATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCA
CAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGAT
GAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACA
ATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACC
AATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATT
TCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTC
TGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAG
AGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCA
AGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGG
TAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAA
TTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGAT
CTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCA
TGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGC
CGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAAT
TGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGA
AAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAA
ATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGT
TCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACA
CACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTT
GCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACT
GAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCA
ATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTT
GCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGA
AATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAG
TCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGT
CGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCAC
GTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGA
AACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACT
AACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACA
ATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGA
GGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAA
TGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAA
GAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTC
GCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTC
GAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGAC
AGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGA
ATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGA
GTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGA
CGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTT
AATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAA
GCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACA
TTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACC
ATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTAC
CGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAA
CCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGG
CGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGA
AAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAA
GATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGA
TTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGT
ATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCT
GGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGG
TCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGT
CACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGT
CAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAG
TGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTG
TTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACA
ATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGA
GGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTA
TCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAAT
CAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTT
CTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAA
ACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAAT
GACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGG
AATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTG
AAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTT
GACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGT
CGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGC
CAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGA
AAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAA
CAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAAC
CCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTT
GACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATA
CAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAG
GATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAA
CAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCA
TCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACC
ATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAG
AGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAAC
GATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGA
TATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATG
ATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTG
GTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCA
ATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTA
ACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAG
CTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACC
AATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGA
CGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGA
AGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGG
TCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGAT
GGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGAT
CAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGAT
TATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAAC
ACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAG
AACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAAT
CCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAA
GAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCG
ATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCT
TTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGA
AGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGG
TTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCA
ACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTAT
TACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAA
GCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGG
AGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACA
CAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATA
ACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGT
GCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAA
CGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTT
GAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAA
CGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGG
TCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAAT
TAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACAT
CATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGA
TTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGT
AACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGT
GTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAG
CTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTA
CAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTT
GGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAG
GTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTC
CACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCA
TCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATA
ACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTT
CGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAAT
GAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGC
TTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACA
CTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCT
ATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAA
CAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGC
CAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAA
TGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTT
GAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGA
TAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATT
GCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGC
AATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAA
TTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAG
TAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCA
TATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAA
TGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCG
TATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGT
CACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACAC
AATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTA
AATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCT
GCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAG
CATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAAT
CCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGT
CATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCA
ATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGG
AGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTA
CAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTT
TGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATA
CCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGG
CAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTC
ACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAA
AGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACT
GACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGT
GGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGA
ATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAA
GAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAG
AAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGC
ATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTC
TCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTG
GATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATAT
CAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATC
GCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCT
TCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCA
AGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAAT
TCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAA
CTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTT
CAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTC
GTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGT
GTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCG
TCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAG
ATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCAC
GTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAG
GAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTG
GTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGC
TCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGA
ACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAA
AACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCAT
CAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGA
ATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGG
CAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGA
AGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCA
CGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCA
AAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGC
ACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGA
GCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATAT
AATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGA
GATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATT
TGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAA
GCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCA
AAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGA
CGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTG
GGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATC
AATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCT
CATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAAT
CGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAG
TTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTAC
GGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAAC
TACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATG
GACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATA
CATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCA
CTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGC
TCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTAT
TCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAA
GAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCA
TGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGG
CTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGA
CAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTA
TTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAAC
AAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTT
CACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAAC
GAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGA
ACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAG
ACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTAT
AAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGG
AAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCT
CTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGT
TTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAA
GACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGC
TAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTT
TGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGC
AAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGA
CTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGAT
CAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGG
ATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTA
AAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGT
CATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATA
TTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACC
GATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATC
AACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGAT
ATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAAT
CATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCT
TGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCT
ATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATA
CGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCA
GTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACG
TGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAA
CAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAG
ACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCG
TCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACG
TGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACG
AGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAG
AAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCA
CTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAAC
AAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAA
GTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGA
TAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGAC
TGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAA
TTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGA
GGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCA
ATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAA
GAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGA
ATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTG
ATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTC
AATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGA
GGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTG
ATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGA
TCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGA
ACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAG
TGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAA
TACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATC
TATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTG
CTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAA
TTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTT
TATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCT
CACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAAC
ACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACAC
GAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACA
AATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACA
GCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTA
AGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGA
GAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAG
CTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAG
AAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCT
TCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTA
TGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCA
GAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATT
GAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAA
TGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAA
ATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGT
ACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAA
CAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAA
AAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAG
TGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGAT
AAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTT
TTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTT
GTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTG
GCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTC
AATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAA
ACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAA
GAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGT
GGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCT
TGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGAT
TTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTAT
CGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAAT
GGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGC
GAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTT
TGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAG
AGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAG
AGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGG
AAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAG
CAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATAT
CTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAA
AATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGT
CATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGA
TTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTA
AATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTC
CAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGA
AACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGG
ACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAA
GCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAA
TATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTT
TGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCA
GAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCA
GAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCAT
GCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGG
ACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATC
CAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTG
GGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGAC
CCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAAT
TTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATT
ACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTC
ATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAA
AACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGG
AAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGG
TTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTT
GGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAG
AATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCC
AAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGAT
TTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAA
AAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGAT
CAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTT
CCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACC
CTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACG
GCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCG
ATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATC
AAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGA
ATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATAC
ACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAG
GTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTA
GAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCC
GTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAG
AAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGAT
TCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAA
CGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAA
TCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATC
CAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTT
CGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCC
CACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGT
TCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGT
GTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGC
GATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCAT
TAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAA
CATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAG
ATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCG
TCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGC
TATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCC
TTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTT
GACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAA
CCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACG
TTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATA
AATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTA
CGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCA
TTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCA
CAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACG
TTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAA
ATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGG
AACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAG
AACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTC
AAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGG
AGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCC
AGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGA
TCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGA
TCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTC
ACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAG
GGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTT
TGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAA
TCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCT
TCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATA
ATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATA
TGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTG
ATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCT
TCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGA
AGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTG
GCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTC
CAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCG
AGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAG
AAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTG
ACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGT
GGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTG
AAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAAT
ACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGA
TTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATA
GCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACT
TGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGA
TTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCC
ATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTC
CATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAG
AACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATT
AACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGA
AGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAA
TCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCC
GTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAA
CGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGC
TGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTA
AATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACG
ACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAG
ACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACG
ACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGA
GAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTT
CCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAAC
AAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGA
TAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTG
AACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCG
ACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTA
ATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAA
AACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATC
CAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTC
TATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATAC
TGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAG
ATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTG
AATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATG
GCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAG
CTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATG
GAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGT
GCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTG
ATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAG
TTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAG
TACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATG
AGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAAT
TGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGT
TCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAA
TCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTC
AACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACG
TCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGT
TTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTC
TGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTA
TATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCAT
GGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCT
ATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACG
CAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATA
TGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAA
ATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAA
AAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTT
AATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGA
AGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGT
CTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAA
AATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGA
AAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCG
AACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATG
TTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGA
AAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACG
CAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCC
GAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCAT
TAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGA
CGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAA
AGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCG
ATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGAT
CAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGT
TGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGA
AGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGAC
GATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGG
TGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGA
GTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTC
AACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGC
CATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGA
CGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTA
GATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATC
AGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCG
AACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAA
TCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAA
AGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAG
ACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAA
AAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTAT
CTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAA
TCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCA
ACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACC
AAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTT
TGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCT
TCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCA
ACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACG
TCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGAT
CGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACC
TGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAA
TGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGAT
ATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAA
AAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAA
TTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAA
TGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATAT
TAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAA
CTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTC
CACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAA
TCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGA
AAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTG
GTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAA
GACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATAT
ATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGA
TCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTG
GATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACA
GAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAAT
CGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAG
AAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCAC
GGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAAC
TGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGT
TTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCAT
CGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAAC
AAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAA
CCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTT
TCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGC
ACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCC
TCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATA
ATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGC
ATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAA
ACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGA
CGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTA
AACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAA
GCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAG
TTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTC
ATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGA
GTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATG
ACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCG
CCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCA
ACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAA
TGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAA
GATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAAT
GAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATAC
CGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGG
CTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAA
AACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTC
AATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAA
CGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGT
CTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAA
CTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGA
AAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTA
AAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTA
ACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCT
CATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAAC
AAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATG
CAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTC
TCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTT
GACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCT
CTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGA
ACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTT
TTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGA
GCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCG
GCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAA
TATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAA
TTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATC
ATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCA
CCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCAC
AGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATC
AAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACA
AGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCAT
TGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGAC
TTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATC
AACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTT
CACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCT
CCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAG
TACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCAT
CGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCA
GATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGC
CTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACC
CGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGT
TCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTAC
GCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCAT
AATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACA
GCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAG
AAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAAC
GGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGA
GGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCAT
TAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGAC
ACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGA
TCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGAT
ACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATC
ATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCG
AAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAA
AAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCG
AACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCC
GAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGAT
TGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTC
AGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAA
AACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGT
GAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTG
CTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATT
CGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAG
AAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGT
AAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTT
GTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCAT
TCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGG
AAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAG
TTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCG
TACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTAC
CGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATC
AAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATG
GATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAA
ACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGT
TGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGT
TCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGG
ACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAAC
CATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCT
TGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCA
TCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCT
GCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGT
TGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCG
ATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTA
GAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGC
AAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAA
CAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCA
TCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGAC
TCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTA
AGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAG
TTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAG
ATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATG
ATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACT
AGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATG
AACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCC
AACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTA
CGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATA
CTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTT
GCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACG
AAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGAT
AAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGA
CGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTA
ACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAG
AAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAG
TATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGG
TCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAA
ATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAAC
ACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAG
CTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAG
ATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGC
GCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTC
AAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTA
TCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATT
TGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAAC
TCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGC
CACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAA
TGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCG
ATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATT
AAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGG
ACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATC
GGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATA
CTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGAC
CTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAA
CCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATG
CTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATC
ATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAA
CGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTAT
TTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTT
GAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTC
ACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAA
TGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCG
CTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACA
AGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATAT
GAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGT
GATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCT
CAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAA
CCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACG
CGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCA
GCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGAC
AGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCC
AAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCT
AGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTG
TCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATC
CCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACA
TTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAA
TTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATT
ATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAG
CACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGA
CTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGAC
ATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGT
GCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTC
CAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGG
AAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATG
AAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCC
ATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAA
AACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGG
TGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGC
TTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTAC
CGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAA
CAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGA
TGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAAC
GACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGAC
GCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGG
GCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGG
ATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAA
TTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCT
TGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACAC
AAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTG
CAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACC
GGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATC
AATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGG
ATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACC
ACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGT
CTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCA
ACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGA
TGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGC
TGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAA
ACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCT
AGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACT
CGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTC
GGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATT
GAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCG
AAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAA
GTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAA
TTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGC
TAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAA
TGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACAT
CGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAAC
AATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAA
GTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAG
AGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACA
GATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGA
CCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTG
ATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAA
GAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGAT
CACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCG
TCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGA
CGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTA
TGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGT
CTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATT
GCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAA
CATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTA
CGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAG
TACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTAC
TCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCA
GAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTG
TAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTAC
AGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGAT
GATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGA
TGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGA
ACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGC
AGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCA
CACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCC
GCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGAT
AAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGG
ATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGAT
CAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCA
AGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCG
AAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTC
GAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCAC
GGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTAT
TTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACT
TATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCT
AACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCA
AAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTT
AAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGA
GTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGG
GTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAA
GTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCT
GAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGT
TGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGA
GAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAG
AAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAG
CAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATC
CGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTG
GTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAA
CAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCT
GACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATC
TGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTC
ATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTT
TGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTG
AAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGA
GTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACT
CCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCT
AACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAAC
AGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAA
CATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTAT
GTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATC
GGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTA
GTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCA
ATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGT
AGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATG
CTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATG
CCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCG
CACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTG
GATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACA
GTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATG
TTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATT
GTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGC
ACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCA
AAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGG
ATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAA
TTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTT
TAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAG
AATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGA
AATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATG
GAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAA
CGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAG
CGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATT
CTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACT
TCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATT
CATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAA
CACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCA
TGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCA
TGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAAC
GGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGAC
GACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCA
AATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCA
GTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCT
GGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAG
CTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCT
GGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGG
CTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAA
AGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACT
TTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACG
CAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCT
CGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAG
CGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACAT
CAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGG
TCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATC
GATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGAC
GTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTAC
GAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTA
GAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCA
AAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTT
TGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTT
GTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTG
CCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAA
TTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGT
CCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGAT
GGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAAT
TTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACA
ATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAA
GAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGT
CGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGC
GACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTG
AAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATT
GGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGT
CGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATC
AGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTAT
TATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAA
CTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACA
GAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCA
TGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAA
GTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGA
TCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGA
ACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTC
CACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAA
AGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTT
CAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTA
TCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCAT
TTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCA
ACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCG
TTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATA
TGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAA
GCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACG
TAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACG
ACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAA
GTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAAC
GAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATT
GGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGT
GATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAA
ATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGA
AAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCC
GTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACG
TCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCG
CAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTA
CAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGA
AAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCT
TCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGAT
TTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGA
GAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAA
CAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAA
CTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGA
TCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTT
TGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAAC
TGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAA
TACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATT
CAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCA
CAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGT
TGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATC
GGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATT
CACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAA
AATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCC
TTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCA
CGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCT
CGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGG
CCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAA
TTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGA
TATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATG
ACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAA
CTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAG
AGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGG
GAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAAT
TCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTT
GGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCC
TCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCT
TGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTT
CTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCA
TTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATC
CGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACG
ACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGG
AACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTC
GTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCA
AACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGT
CGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAG
GAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTAC
AAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGAT
CCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACA
GAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGA
AAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAAT
CTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAA
TTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTC
TTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTG
TTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAG
AAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAG
AAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTA
AATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATT
AGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCT
ACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATG
CTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCG
AATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTG
AAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAA
GCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAAT
GTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTC
ACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACA
CTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGC
GGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGA
ACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAAT
CCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGC
AAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAA
TTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTC
CAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCG
AGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGT
CTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAA
CTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAA
CCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAAT
TTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGG
AAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATG
TGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGA
AACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGC
AAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGA
GGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAG
GCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAAT
GTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGT
GGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACG
TCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAA
TAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGC
AAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATT
ACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCAT
CAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCG
AACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACC
ACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCG
TCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAA
GAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGA
TTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATT
CTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTAT
GCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGG
CATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTC
CACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCA
CCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCA
GCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTG
AGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTT
CACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAAT
TTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGG
GGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATC
ACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCA
AAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCT
GTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAAC
GAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGA
CTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAA
TTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAA
GTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGA
CGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCG
GTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCA
GCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAA
AGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACA
GAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCC
AACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGA
CAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACA
GAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGA
TTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACA
ACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATC
CAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCAT
TGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAG
GTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGA
TTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATA
TGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGAT
TTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGT
GGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAAT
TAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAAC
AGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCT
TGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAA
TCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACG
TTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAG
CGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTC
GGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGG
GAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCA
GATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTA
TAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACAC
AACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAA
CAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCC
ATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGA
AGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGAT
TTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTT
TGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAG
ATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTT
TAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAAC
AAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTA
CAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGC
GAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAG
CATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACA
AAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAAC
GGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGC
TGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACG
ATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGA
AAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACG
TGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTC
TAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTA
GGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCA
TGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATT
AAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAA
CTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGT
TGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCT
CGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACA
ACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGG
CGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGT
CTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCA
CCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATC
TGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAAC
ACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCG
ACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGA
GAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTT
GGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACT
TGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTAT
GCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACA
ACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCA
GTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATG
CGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGA
AATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATA
ACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGC
GTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAA
TATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATT
GAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTA
ACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATA
TTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATG
TATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTA
TCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCA
CGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAA
TGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAA
TGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGC
AAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCA
TTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCC
ATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCA
TATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAAT
TACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAG
AATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACA
AGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTG
AACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACC
TGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCA
AGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCAC
AACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAG
AGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGA
CCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGG
GAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAAT
GGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGA
GCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAA
AGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCAT
CACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTC
ATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGA
TGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCA
GGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGC
CTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTC
AGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAG
CGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTC
CAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACT
AGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCA
AAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGT
TGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGT
ACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTC
ACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGAT
GTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGT
CACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGA
GTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGT
GTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTC
AACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAAC
GTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAA
CATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCA
ATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAAT
TTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCA
AATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAG
AAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACG
TTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAA
ATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCAC
GTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGC
AAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAA
TGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGA
TAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTG
TCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGC
TCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAA
GATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACG
CCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGG
TCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAA
TCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCA
TAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCG
GTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTT
GGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGG
ATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTA
CGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGA
CAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACA
TTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACT
ACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTC
CAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTC
GACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGA
ACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATG
CCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCT
CAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACA
GGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATT
CGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAA
AACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCA
CAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGA
GGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAAC
TGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGAC
GCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAA
AGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAA
GGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCT
CATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTT
CTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGA
CCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTA
AAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTG
GACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAA
GAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACT
TAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCA
GGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGAT
GAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAA
AGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCA
TTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATT
GACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGA
TATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAA
CAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATAT
GAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCA
TGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTG
AAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTAT
CGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACG
AAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGT
ATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTG
GATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACA
AATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGAC
GTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTC
ACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTG
TTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAG
AAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAA
AAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACT
TGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAA
GTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGT
CAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATA
GATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTG
GACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATT
CTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGG
ATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAAT
AACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGA
AATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAAT
TAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGAT
AATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAA
TGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGG
GAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGAT
GAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATC
TGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAAC
AAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTG
TCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATA
CAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTA
TCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCT
CGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATT
TAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTA
TCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCA
CACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACAC
CACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGA
AAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAA
TCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGC
GCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAG
CAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGA
AGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCT
GAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAA
ACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTC
GAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATG
GAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGA
ACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGA
AACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATG
AAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAAT
CACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTAC
AAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACA
AAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAA
GCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTG
AATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAA
ACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTT
TGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGT
GTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGC
AGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAA
TTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAAC
GCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGA
GCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGG
AAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTG
CTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTT
GAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCG
AGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGG
ATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGA
ACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTG
GTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAG
TCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAG
ATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAA
ACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCA
ACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCT
CGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAA
TTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCA
TATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATT
TGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAA
TGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCA
ACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAA
CTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGAC
GCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGC
CAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATA
TCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTG
TCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGA
GCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGA
ATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGC
AAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGAC
AAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCA
GACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGG
TAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCC
AACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTT
GGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTAC
TGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCAT
GGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAA
CGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAA
AAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTT
AATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGG
CTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAA
TGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAA
GGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTT
GCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAA
AAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCA
ATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCC
GCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCT
CACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGC
TCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGAT
GGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAA
GTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAAT
CAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACAC
AAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGT
CGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGA
ATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGT
CACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAA
ATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTC
GACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACG
AGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATC
ACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCA
ACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCG
TGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCA
CCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTC
CATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGT
CACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGA
TCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTA
GTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACA
TGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGAT
ATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTC
AAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTA
TTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTT
CGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGA
CTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACC
TTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTT
TTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAA
TGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACG
ATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATT
ACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACA
AAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTT
ATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAAT
TGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAA
CGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAA
CAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAA
AGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAG
TGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAG
ATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATC
AGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATC
AACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCAC
TCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGG
AATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTG
GAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATC
GTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTC
GTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAAT
TCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATG
GTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGAT
TGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTC
TGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAG
ATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGC
AAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCA
ATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAG
TCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAA
GCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGAC
ATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGG
AGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAA
ATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATAC
TTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATT
TGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGC
TTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTG
ATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATT
GGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCAT
CCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCA
TGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAA
CATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAA
CCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAG
GAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATC
AAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGT
ACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACG
TTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTG
GCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAA
TGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGAC
CAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGAC
GCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGAC
TGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGA
ACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCC
AGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAA
ACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATA
GAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAA
CGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGAC
TTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAAT
GGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAA
CGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCA
GTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTA
TGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTG
GCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGAT
AAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAA
TAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGC
AACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCT
GAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGA
AACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGC
AACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGAT
GTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTT
TCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTA
CAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAG
AACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTG
AAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTC
GACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATC
AGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAA
CATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTC
AATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTT
ACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTG
GCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATA
TACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGG
TTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTAT
GGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCA
GCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATG
TGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAAT
TCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAA
GAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAA
TGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAG
GGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCT
GGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAA
TGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAA
GCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAA
CGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTT
GAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAA
ATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCA
GGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGA
AACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTA
GCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACG
ACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAG
AACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGAT
GAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCA
ATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTG
TGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAG
AAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGA
TTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTG
GAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGT
GTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAA
CAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCA
TGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACG
GACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGA
TGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAG
TATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAA
CAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATC
CGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAG
CGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGAC
GATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAA
ACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCT
CACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATC
CAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAAC
ACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAA
GTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTG
ACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTC
TCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAAC
TGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTC
ATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCG
AATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTG
CTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATG
TCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATAT
GATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAA
AGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATT
GAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATG
AGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTA
AAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACT
TCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCA
CGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATC
GAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAA
AGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGT
CAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGA
CACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATAT
CGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATC
ACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGA
TGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGA
AAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCG
AAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAA
AGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGG
AGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTG
GAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTT
CTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCG
AATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAA
GAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACC
TCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTC
CAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCAC
GATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTC
CACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAAT
ATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCAT
GCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAAC
GTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACG
GAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAA
CAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGC
GTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTT
CAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCAT
TGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGT
TCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGAC
AATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCC
ACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAAC
AGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATG
CTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGA
TTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGA
AGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCG
TAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCT
TGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAA
CAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAA
TTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACG
CTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCT
GCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACT
TCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAA
ACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAA
ATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAAC
TTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCA
TCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAA
ATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCA
AAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTC
CACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGA
CATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCT
GAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAAC
ACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTT
TGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGC
TGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGC
TAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATA
TACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATT
TCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCAT
TTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACC
ATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAG
ACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAA
ATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAG
AAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTG
CAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTT
GACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAA
CAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCA
CCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCC
CAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTA
CGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCG
TCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGA
TGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCT
TCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCG
ACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTC
CGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGC
GAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAA
TCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGC
CGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAA
GATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGG
TCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGG
AGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTA
AACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACAC
CTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATC
TTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATAC
AGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCAT
GGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAA
GAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAA
ACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAA
CCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGA
AACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTG
TTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAG
ATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAA
CTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGA
AATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCT
TCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCG
AACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAA
ATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAA
AGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGT
TAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTC
AAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAA
ATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTT
ATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTA
CCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCG
ACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAA
AGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGA
TGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAAC
CGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTG
AATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTC
GGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGAC
ATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCA
TTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTG
GTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATC
GAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGC
ACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTG
CAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGAT
TTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGA
GAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAA
GAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACA
ACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATC
AGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTC
AACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAG
GACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTT
TAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGAT
TCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGAT
TTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAG
ATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAA
CTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAA
CACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACG
TCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACT
CGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGC
GTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAA
AACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAA
ACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACG
ACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAAC
AAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAA
GTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTA
TCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTC
GAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAAT
GGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACAC
GTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCT
GAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGAT
CGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGC
TTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAA
GAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATC
TTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTG
ATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTC
GATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCA
CAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATG
ATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGAT
CGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAA
ATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGAC
ATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGG
ATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACT
AAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCT
CAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACC
TCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCT
GAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCAT
GAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACG
TCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTT
TTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGA
AAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCAC
TAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATG
CATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCT
GGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAG
TTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGA
GAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGA
TCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCA
AAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACC
ACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCG
GGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGC
TCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAG
GTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAA
ATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAG
CCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTC
TTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCC
TGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATT
GAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATT
GTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTAT
TGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCA
CCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACT
TTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACAT
ATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGC
TCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCA
GATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAA
GAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAA
GTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCAT
TGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAA
CTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTG
GAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTT
ACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCG
ATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACA
ACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATG
ACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGA
CTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGC
TGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGC
GTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGAT
GATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATT
GAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTG
AGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAA
AAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCA
ACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGG
CTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAA
TCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGAT
ACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCAC
TTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCT
TCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAAC
GCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATG
AAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTG
AGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAAC
TGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAG
AAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCG
ATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGG
CAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGA
AATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAA
GGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGT
GAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATT
TGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTA
GGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATG
CGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCG
AGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAA
TTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGT
CATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAG
AAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGA
TTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACC
AACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGAT
GAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGA
GCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCA
CCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTC
TGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACG
AATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATG
GAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCT
ACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGC
AACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACA
TGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACG
TCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTA
CTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTC
AATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGA
GAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTA
AAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAG
ACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGA
TGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATG
CAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAAC
CTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAG
CCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACA
CAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGC
AACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAA
ACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGAT
ATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCA
AATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAG
CAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAA
ACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGA
ACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGG
TGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTT
GTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTA
TATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAA
CCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAA
GAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAA
ACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGT
TGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGT
GTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGT
AACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGA
ATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTG
GGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGA
AGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAA
GAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCA
GATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCG
AATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGT
GAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACA
ACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGA
CAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTG
GAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCAT
GATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTG
GAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAA
ATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGT
GTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCC
GTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAA
CGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAG
GAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACA
TGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGT
GACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGG
ATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGT
TGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAAT
CAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAG
AGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCT
ATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCC
ACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCA
CTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGA
TGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGT
TCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTT
AACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGT
GGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCAC
TATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAA
AGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGAT
GAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATT
CAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTA
ACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAA
TGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAA
TCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGA
AGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACG
GACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCG
AAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCT
AGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTC
TCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCA
TCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACA
CCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATG
GTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATG
TGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGG
AACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGA
CGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAA
TCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGT
GCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGG
ACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCT
TAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGG
ACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCT
AGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAG
AGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTT
GATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCA
GACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCG
ACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCG
TCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCA
AGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTC
GATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGA
TACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGT
TAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGA
GTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGA
AGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAA
GATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTG
CCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGT
CAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCC
ATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATT
TGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCC
TATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGG
AAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTT
GATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAAT
CTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGA
AATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCG
CCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGA
CGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAA
ACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGG
TCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCG
CAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAG
CCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTA
TTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACT
CATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGA
ATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATG
TTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGT
CGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATC
GTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAAC
GCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCA
CAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAG
TTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCA
AACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATC
AACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTT
TGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAAC
GAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTT
ACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATG
CAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGC
ACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTA
AAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGAC
GAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGT
CTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGA
ACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGG
TTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGA
TGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAAT
CATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAA
GACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGT
TGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTC
TTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCA
GAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACA
AACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAA
GCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTC
CTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTT
ATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGA
AATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACA
GATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACT
TGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATC
TGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTG
TTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTG
GTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATA
CAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCA
AACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACA
GACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTG
GAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGG
TGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCA
CTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAA
TGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTT
CGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACG
CCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCG
ATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCC
CGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATT
GACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATA
TTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGAC
GAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACT
TTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAG
CGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGA
ACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTC
CAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGG
AAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTC
AATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTG
TTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCT
ACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATT
GAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCG
TGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGAC
AAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAA
CAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGT
TGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAA
CAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCG
CATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGA
ACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAA
GTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCC
TAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGA
AATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAA
ACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCT
AGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATT
AGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTT
CAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTT
TCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAA
AGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAA
GAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAA
TGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAG
TTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTAC
CAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCT
TAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAA
TGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAA
ATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGC
GGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGT
CGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCAC
GAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACT
GAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGG
ATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAAC
GAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCC
ATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAA
AACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATT
GCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCA
AGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAG
AAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCT
ACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACT
CGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACC
TCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTT
GCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAA
AGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTG
CTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAA
CATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAA
AACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGG
ATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGC
GTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGT
TTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGG
AAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTC
ATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATA
AACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAA
GCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTAC
ACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCA
ACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAA
CAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCAC
TTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTC
AAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGA
AGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATT
ATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCT
TTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGC
TGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCA
TCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCA
CTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACC
AGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGC
GTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAG
GCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCA
CTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTT
CAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGG
ATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCAC
AACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAA
GACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGT
CAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGA
ACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACT
AGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATT
CAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGT
CTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACG
GAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGT
CGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGC
TTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAG
AAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGA
GATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAA
CAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACA
GCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGA
ACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATT
TAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAAC
GCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCA
AAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTG
CTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGT
TTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATT
GGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATG
GGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTT
GGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGG
TTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTA
GCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAG
ATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTG
CAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATC
GGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTT
TCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCG
TATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGG
GAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGA
AAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGA
TAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATA
ATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAA
CTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACA
ATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCAT
TATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAG
GGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTT
TCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTG
CAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGAT
ACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTA
GCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAA
ACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACA
ATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGA
GGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCA
TCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAA
ATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGG
TAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTG
TTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGAT
CAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAA
AAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTG
AACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTA
ACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGG
GCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATG
TGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAA
ATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACT
CATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTG
ATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCG
TATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAAC
GCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCG
ACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCT
TGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACC
CCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTG
ATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACAC
AACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGAC
TCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGA
AACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGG
TTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTG
CTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGC
ATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAAC
TTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGT
ATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCG
GTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAA
TGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAAC
ACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGT
CCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATA
TCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGA
ACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAAC
GATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATT
CGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTA
TCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATC
GGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACG
TGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATG
GGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATG
ACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAA
AAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATT
GAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCAT
GGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATA
TCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTA
CATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAA
TTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAG
CTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAA
CGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTG
TTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAG
CTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAA
CTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAG
GAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACC
CACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGA
GAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGG
CGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGC
TGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAG
TACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCA
CATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCAT
GGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATG
ATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGG
GATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCT
CTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAG
CAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCG
GAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCA
AGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAG
CTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAA
ACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTG
ATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTAC
AAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCAC
CGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGT
CAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCA
CCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGT
ATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGT
ATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAA
CTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGT
TACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACA
TCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAAT
GACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTT
CCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAA
TCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAA
GTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTT
TGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAAT
ACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGT
GCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAA
GACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATG
TCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATA
GGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTC
CGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTC
AAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGA
TCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCC
ATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTC
ACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATC
GCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATA
GCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGT
AAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGG
GATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGAT
GATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACG
AGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACA
GTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATT
AACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTAC
CATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCA
GATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGA
CACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAAC
TTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCC
GTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCA
ACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGG
AGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCG
GCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAA
CGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACA
ACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGG
GTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTG
TCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGC
AGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAG
AAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGG
TGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCA
TCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCT
TACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACC
AACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAA
GAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGA
CCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGA
AAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTA
ACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGG
AGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGA
GATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAG
CTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATT
CTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGA
CTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATA
TTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACA
AATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGA
ACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATG
AGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAA
ATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCG
GCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAA
AGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTAT
TGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGA
TCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAA
TGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGT
CACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCAC
TCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTT
CGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAA
ATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAA
AGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTG
GACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGT
ATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCA
AGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGA
TTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGA
CAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCT
TGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGAT
CTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAA
CCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAA
TCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTA
GAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAA
TCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATG
ATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGA
GAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGA
ATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTG
TCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAA
ATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTC
CAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACA
AGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATC
GAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCG
AGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTA
ACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATC
GACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACA
CCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCA
CCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAA
AACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATC
GACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGC
TATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCA
AAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAG
AAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGA
AGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAAC
GTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGA
AATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGA
GACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAAC
TTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAA
CGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAA
GGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCA
CTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAA
GAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAA
GCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGC
AATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAA
TGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAAC
ACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTG
GATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGT
CAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAG
ACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATT
ATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGC
CGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGC
GTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAA
GACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCT
GGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGA
AAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAG
AACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGAT
CACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAAC
TAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGT
GATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTC
ACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGAT
GGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAAC
TCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAAC
GATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCG
CTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATT
AAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATA
TGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTG
GAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATG
GACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAAC
TCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACT
ACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGC
TCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCA
GTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATC
GTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTC
CGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGC
TAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAAT
GGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAA
GCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAA
AGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGA
CAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTA
AAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAA
CTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGG
CACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTG
GAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGG
AGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACG
GTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAA
GACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAA
TATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCT
TAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATG
CGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGG
GTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGC
AGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAA
ATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAAT
CATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGC
CCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCA
CCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTC
GCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGG
ATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGT
TATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCA
AACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAA
GACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCG
TTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAAT
CTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCA
CAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAAT
GATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGA
CAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAG
GAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCAC
AAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAAC
TTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTG
AAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACC
AAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCA
TTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCA
CTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATC
GATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGT
CTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATG
ACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATAT
CGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAA
ATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATT
ACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCG
GTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACT
TGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTT
CGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTT
ATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATG
TCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGAT
AGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTAC
TTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAA
AACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTAT
CGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTG
AGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACG
TGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACA
AACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAG
AATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTG
ATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGAT
TCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAG
TTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAA
CAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTC
AAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAA
TTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGA
ACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGT
TCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGT
GAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTC
GGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGT
ACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTG
GTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTG
ATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGAT
GACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAA
ACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAAT
CAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTC
GTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGC
ATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACAT
GGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAG
TCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAAT
GCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTT
TACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTG
AACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTT
GGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGAT
AATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGG
CACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCC
AATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATG
GCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACA
TTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACC
AAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGA
GAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAA
AAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTAC
AAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTT
CTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGC
GTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATG
TCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCA
GTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGC
TCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTG
AAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAAC
AACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAG
TTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAAC
CGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGA
AGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACG
TCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTT
CCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGG
ATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACG
CAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGT
GGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATG
ATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGC
ACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAA
ATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATA
GCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAA
CAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGA
AAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAA
CCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAA
CAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGT
TCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTC
GTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACA
ATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAA
CAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAA
GAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGA
CCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAG
CGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACA
TCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAA
TCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTAC
GTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGC
ATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATA
CTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTT
GAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGG
CCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGC
CGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTG
CCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTC
AAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGA
AACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATG
ACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGG
ACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGG
CGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATG
AAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGC
GTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACG
TGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGA
AAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAAT
GCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGG
CGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAA
CTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGC
AAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGAC
TAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAA
CAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGA
AGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAAT
TGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTG
GAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAA
ACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATT
TGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGA
GTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGT
CATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACA
ATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATG
GAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGA
CGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATG
AATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTA
TATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACA
ATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCG
TCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCG
AATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGA
TCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAAC
TACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCA
CTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCA
AAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACAC
AGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGT
CGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGAC
TGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTC
CTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTG
ATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCAT
TCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAA
TCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCT
ATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTC
AACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGA
TTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAG
AACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGA
AAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAG
ATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAA
AGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTC
TAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACG
CCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGA
AAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAG
TTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCA
AATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACA
CGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCG
ACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCAC
CAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATG
GGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAA
GAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAA
ACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAG
ATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAG
GCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGA
AACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCT
TGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAA
TCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGA
AGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTC
TTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCA
ATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGA
TCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCA
CAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATAT
TTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGC
AGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGT
CGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGA
AAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACA
ATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGT
GACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCA
AAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTG
TCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTC
CGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAA
TATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCAC
CAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAG
AATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCT
TGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATT
TCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAG
CATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTA
ACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTG
AAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACA
AATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATT
CATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCT
ACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGC
TGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTC
AACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAAC
ATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAAT
TCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTT
CACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATC
AACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAAT
GTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAA
GACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCA
CTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACA
TGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGA
AAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACAC
GGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTG
AGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTG
GATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTA
GTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATA
CCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTC
ACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTT
CAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCAT
GGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGAC
AAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAAT
TGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAA
AATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCA
AGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGA
CATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACA
ACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACC
AGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCA
AGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACG
AATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTC
TTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATG
AGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTC
CCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGAC
TGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCG
GAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGA
ACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATC
GACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCG
AAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGA
TATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTC
ACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAG
ATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAA
CGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCT
GATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTT
TCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAG
GAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGG
AAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGA
GTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAAC
AACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACC
ACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAA
CTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTT
GGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGAT
TTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACT
TGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAA
TCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTC
GAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAA
CAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAAT
CATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAG
AATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTA
AACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAA
AGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAAT
TCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTAT
ATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACC
TCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGAC
ACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAG
AATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATG
GAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCG
ACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAA
TGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGG
ATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACAT
CGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATT
GGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGT
GATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGA
ACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCAC
AAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCA
AGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTT
ACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGA
ATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGA
GATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAAC
CAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAG
GAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAA
CGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGA
CAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTA
GGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTC
ATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTT
CAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGAT
TCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACT
ACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACA
CTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTC
AACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCG
GTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGT
TTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAA
CCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAAC
ACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGAC
GCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAA
GTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGT
CACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATC
GGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGA
ACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGG
CGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGT
AAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGA
AGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCG
GACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTT
AAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGA
ACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTT
TCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGAT
GTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGA
TGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACA
AGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGAT
TTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCG
ATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAAT
CACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACAT
AATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGAT
CAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAA
ACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCA
AGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTC
AATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGA
GCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGA
GTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTC
GGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTT
AACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAA
AGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTA
ATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCA
TAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGG
ATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTT
CACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGA
ACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATC
AGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAA
GAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCAC
CTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGG
CTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTC
CAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGT
GGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAAT
TACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCC
AGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTT
CGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTG
TTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGA
AAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGT
CAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTG
AACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACC
AGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTT
GAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATAT
CGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTC
ACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGA
TATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGA
GACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGT
GAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTG
AAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACT
ACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGA
AGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTAC
CCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGAT
GTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAAC
GACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGAC
AAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACT
GGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTG
ACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGT
TCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGA
TCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGA
AGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAG
AGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAA
ATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAAC
AGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCT
TTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATC
GCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATAC
AACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTT
TCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTC
AACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGC
CTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAA
GAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAG
TGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTG
AATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAA
GAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGAT
ACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCA
ATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAA
TCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGG
GTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGA
AACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTG
GAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGG
CGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCG
TACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAG
AGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATT
CGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCA
TTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAA
GGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATT
TAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAA
CTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGA
AGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGC
ATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACC
ACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTG
TATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAA
TCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGA
ATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTAC
TTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAA
CAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATG
TACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTC
AGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACT
GAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAA
TAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGA
AATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAA
AAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGAC
TGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATG
TTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCA
GAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCT
ACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCC
CTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACA
AGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAA
CAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAAC
AGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATAT
TGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAA
TCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCA
ATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAAC
ACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAAC
AACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTG
GCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGT
AGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATA
TTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACC
ATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGA
AATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAAC
CTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTG
ACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGT
TGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAA
CAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAAT
GCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGG
AACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAG
GAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGA
AGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGA
TCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAA
TCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGA
ACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAAC
TGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACA
ACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGA
AAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGA
TGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGA
AGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAAT
TAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGT
CCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGT
CGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACG
CAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGA
ACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATG
AGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGA
CCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGAT
GGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTG
GCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCA
GAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAG
ATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTAT
TCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCAC
AGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACT
CTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATG
GTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTC
CAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAA
CAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGG
TTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTA
TTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAG
AAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGA
AAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCA
AGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAAC
GCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATG
GATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATC
GAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAG
AATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGA
CAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAA
GAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAG
AAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTC
TTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATC
ACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACC
AAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGT
AACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTG
TCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAA
CCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACG
GGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATC
TCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGC
AGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGAC
GTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTA
GCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGAC
GAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAG
CGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAG
TACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGA
TCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGA
CAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGAC
AACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTC
AGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAG
AAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGA
TGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATA
CGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTA
AACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGT
TTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAG
ATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGA
TGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCC
GCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCA
AAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCAT
ATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTG
ATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTA
TTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAA
ACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGA
TGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCT
GTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAA
TAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCC
TCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACG
TGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAAC
ATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTC
GTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCA
ATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCC
TTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATT
GGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCA
TGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAAT
AAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTT
TAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCG
GCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGT
TGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGC
GCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACA
AGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTT
GCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAA
CGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAA
CTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTG
TCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGA
GACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTAC
AACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCA
ATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCAC
AACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAA
GAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGA
AAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCT
TGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAAC
GAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTT
GAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATG
AAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCA
TTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGA
CTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTG
GCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTT
GCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGA
GACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAA
CCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGC
AAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCT
TGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTAT
TGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAA
TGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGA
TGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTG
ATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTG
ACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTT
AATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGT
CTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACA
GGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAA
CTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGA
CTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGA
AAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTG
GAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACT
CATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATG
ATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCG
GTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCC
TGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGAT
GGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCG
TAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGA
CCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATT
CAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGA
GTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTT
TAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCG
CTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAAC
AGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCA
ACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAA
AACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAA
TGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTT
TTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTAC
GTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGA
AGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTG
CTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAA
ATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACA
AGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTG
CAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACA
GTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCA
TGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAAC
GCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGT
TTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTA
ATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAA
TCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAAC
GAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAG
TCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAG
ATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCA
ACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTC
TGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAG
GAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGA
AAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATG
CAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTT
CAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCA
ACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTA
AATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATG
AGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAAT
GGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGG
AAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCG
GATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGA
AGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGA
AACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGAT
GCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGA
ATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCAT
TGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAA
CAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGC
AAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAG
AAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAA
AAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTAC
ACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCG
ACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTC
GAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGC
GGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAG
CAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCT
GTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACA
TCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAA
CATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGAT
GACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGT
TTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTT
GTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAA
GGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCAT
TCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAA
CTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGC
CGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACAC
GACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAAC
GCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACA
ACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTT
TGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAA
AAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAG
ACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTAT
CAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTT
AATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTG
AACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATC
ATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACT
ATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAG
AAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGT
GCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGC
TATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACT
GGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCA
GAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGAT
GGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAA
CACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGA
CCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCA
AACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAAC
GATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAG
TATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCA
AATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCT
CTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGA
GCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCG
TCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTT
TCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAA
GAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGA
TTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACA
GAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGC
ACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAAC
TCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTA
GAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGC
TGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAA
ACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCT
AGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTT
TAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGG
TTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGG
CGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGG
AGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTT
GACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGC
TTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGAT
TACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCA
AACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGG
ATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTC
AGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTA
TTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGA
GGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAA
ATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATA
GCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAAT
GAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACT
CAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAAT
TTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTA
TAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGG
GCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTC
AAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCA
AAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATAC
AAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGC
TTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAAC
ACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAAT
GGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGG
AGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATC
ATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAAT
TAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTA
AAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTT
TTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCA
GACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAA
AATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAA
CGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAAC
ACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGC
GCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTG
ACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAAT
CTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCA
TTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGAT
CGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTA
TGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGC
TTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGAC
GTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTG
AAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCC
AATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGAT
CAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAA
CGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTC
GGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAA
CAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTT
ATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCT
TCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCAT
CAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTT
TGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTAT
TACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGT
ATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATG
TTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACAC
CGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCC
AGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATC
GAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAAC
TTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGA
TAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCG
AAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATC
GATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGG
TAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTG
CTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGG
ATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGAC
GTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAA
GGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGA
ACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGG
AAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATC
CACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACA
TGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATT
TGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCT
GGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACG
AATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTT
GATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCT
GAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACT
TCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGA
GATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCA
CATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGA
AAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCG
CCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTG
GACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTA
CAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACA
TCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGG
ATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGAT
ATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGA
TAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCT
TACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCA
GAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGA
GGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAG
GCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCT
GAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAAC
GACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGAT
TGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAA
AGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCG
AACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCA
AACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACC
ACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTAT
GGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTAT
TCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACT
ACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTA
CCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATC
ATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGA
CCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCC
CACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATC
ATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGT
CGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTG
ATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATAC
AAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGC
AACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGA
CAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTC
GACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGG
ACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCG
CCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAA
GTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATC
AAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCAT
CTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCAC
TACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGC
AATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGC
CTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAA
ACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGA
TACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGA
TTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAG
AGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGT
GTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAA
CCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCA
TGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGA
TATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACA
CTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTT
GTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGT
TTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAAC
AACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAG
ACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGC
GAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACG
TAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAAC
CATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGT
TCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTC
AGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAG
GTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAA
ACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTG
TTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATC
CCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTA
CCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAA
CTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGA
GCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACC
TGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAA
AGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAAC
AAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAG
ACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGA
TGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCT
AACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCT
AACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACT
TCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATT
TCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAA
TGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAAC
GAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAG
ATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAAT
CCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGC
GACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAG
ACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTG
ACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATC
GATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATG
GGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCA
CGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTC
GGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCG
TGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAAT
TGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAG
GTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGA
CACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTAT
CCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAG
GAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATT
TGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACA
AGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTG
AAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCT
CATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACC
AATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATC
AAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGA
AAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATC
TGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGAT
ATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGA
AATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAAT
GGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTC
GACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAAT
CGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCA
AATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAG
TCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGA
AATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAG
AATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAAC
ATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGA
CATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACC
AACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACC
GCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAA
CTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGA
CGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTA
TATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAA
AAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAA
AGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAG
AATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGT
TGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAA
TGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGA
CATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTT
GAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACG
TGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGG
AGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACT
GGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGA
AGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGC
GAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAA
TGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATG
CAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACAC
AGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGA
TAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCA
GTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGAC
GACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTAT
CGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCG
GACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGT
TGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGA
CAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGG
TCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAA
AATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAA
CAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCA
CAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTA
GTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGA
TTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCAC
CAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGG
AATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTC
TGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGA
TTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCT
CTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAA
AGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATG
GTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGA
AGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGA
CTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTC
CAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTAC
GGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTC
ACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGT
GTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGT
CGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCG
AAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTA
ATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGG
GACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGC
TGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAG
TCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACA
AGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAA
ACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACT
CTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCA
CATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGA
GCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAG
AGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGT
GATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGA
CCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATA
TAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTA
GTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCG
TGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGT
ATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAG
GATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAAT
CATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCA
TATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCC
TCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACC
TAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGC
CCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGAT
ATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTA
TGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAA
CCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGA
CACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTT
TAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCT
CAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACA
AATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGA
TTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACA
GACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGA
ACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAA
ACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTT
CACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAA
GTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAA
AGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATT
GAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACT
CATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGA
TTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCT
GGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGAC
GCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCG
CTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAAT
TTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTAC
ACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGT
GGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTG
TGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCG
ATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTAT
CGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTC
TCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAG
TGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTT
TGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAA
CGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCG
GAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAG
ATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTG
GACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAA
CGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAA
TTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGAT
CGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTC
GACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTT
ATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACA
AAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAA
GATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATT
CAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAAC
AAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTC
ATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGA
GCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGG
ATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTAC
TGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGT
TATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGAT
GTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGA
CATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAAC
AAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCA
AAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGT
CGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCAT
TGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGG
TTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTC
ATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGC
AGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTA
CGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAA
CGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGG
AAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAA
TTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCA
CTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAA
TTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGC
AACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATT
GGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAA
GCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGA
GACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAA
GTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAA
AAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCT
TTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGT
CTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTC
GACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGT
GTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTC
CCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAA
ACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAA
CCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTT
GGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCG
GGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAG
GGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTC
CCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCC
ATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGAT
GACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCA
ACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGG
ATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGAT
GAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCAC
GACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAAT
TGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGC
AGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACA
GTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAA
ACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACC
CGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACA
AGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTC
ATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGT
CACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAAT
GGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACA
GTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGA
AATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACC
AGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCG
TCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATC
AAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATC
CGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGT
TCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCAT
GATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACT
GGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGA
GCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCC
CTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCG
AAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCC
GATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAA
ATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAA
CTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGAC
AGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGAC
CCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCG
ATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAA
GAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGT
TGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTG
ACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAA
GATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGC
ACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCG
TTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACT
AAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAA
GCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTA
AACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACA
AGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAG
AGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTG
AAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGA
ACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAAC
TGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTG
AACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGT
CACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCA
TTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAAT
GCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGA
GCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACG
GCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAA
TACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATA
TGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAAT
TAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTC
GAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAA
TGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATC
GTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTA
CAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACT
AAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAA
GTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAG
ATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCG
GAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTG
ATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCT
GAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGAT
GTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTC
GAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATC
GATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTAT
TAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAA
CGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATT
GATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAA
CCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAA
GCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGAT
TGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAG
AATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTA
ACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCC
AACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAA
AAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTT
CCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAA
TTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACG
CTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGAC
GGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCA
ACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGG
CTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGA
AAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAAC
TTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGAT
GTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGC
ACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAA
CGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTG
GAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATC
ACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAG
GCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTT
ATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAAT
CCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATC
GGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACA
GGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTT
TCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAG
ACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCG
CGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAA
GCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAAT
TTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGA
CCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAA
AAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTC
ATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCG
AAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATA
TAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCA
GATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAA
TTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTG
ACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTC
AATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCA
TATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAAC
CAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAA
AGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAA
TACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCA
TTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTAC
AGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTG
TATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAA
CAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACAT
CATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTC
AAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCA
CATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAA
CGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGT
CAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGA
CAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACT
ATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATG
GCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAA
ATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGG
ACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAG
ACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGA
TCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGT
GAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACC
ACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCAC
TAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCA
AGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGG
AGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAA
AGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTG
ATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAA
TGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAG
TATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACA
TTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAAC
AGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAG
ATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAG
ATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAA
TCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTT
ATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAG
CGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCC
AACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTG
AAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGA
AAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAAC
ACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGA
CAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAA
AAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATA
TCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCAC
CACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGAT
TGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACG
GTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGA
TCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTC
CGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGA
GTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAA
GGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGT
CATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAA
CTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCAC
AATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACT
GCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGG
TTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTT
ATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTG
GTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATC
GCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGA
AATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACA
ACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCA
TCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAA
TCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAA
CGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAG
CGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTC
ATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATAT
CACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTC
CATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACAC
CATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAA
TGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGA
ACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGAC
TGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATG
ATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGAT
GCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCG
AAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGG
GTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGA
TACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAAC
AAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAA
GACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAG
TAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTAC
AGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAAT
GTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGA
TTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCA
ATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGA
ACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACG
AAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACA
GCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGG
TGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCAT
TACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCA
GCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTC
GTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTAC
AAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACT
TACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAA
CGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGT
GGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTT
ACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACC
AACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACAC
AAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGC
TATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGT
TGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCA
CTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGG
TGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAAC
AGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCG
GCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAA
ATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAG
GGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGA
CAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAA
AGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAAC
GTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTC
ACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGT
TGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATG
GCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAG
GAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTT
GACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGAT
TACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCA
CGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAA
TCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCA
AATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAAC
CACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAG
GACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAA
TAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGC
TGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGT
GGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGG
TGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAA
CCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAG
GAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAAT
GATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATA
ATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGAT
AAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCA
CAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAAC
AAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAG
AGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGA
AACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCT
ACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCT
AGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCA
GTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGG
ATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTA
CGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAG
TATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCG
ATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTT
GGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAA
GATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCA
GACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAA
CAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAG
AAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGA
AAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCG
AAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCAC
GCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATA
TTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGA
CCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGA
GCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAA
ACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTAC
AGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAG
TCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCC
CAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGT
CATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGA
CAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAA
AGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGG
TTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGAC
TTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTC
AAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATC
TGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAG
GTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAG
CATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAAT
TCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAG
TTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTT
CCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGC
TTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAA
CAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTC
TGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAA
CGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCT
GAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGA
AATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTG
GGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAA
TATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGA
GAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATAC
AAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAAT
CTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATC
TCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGT
CCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAA
CTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGA
GGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCG
ATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTA
CTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAG
TATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCG
ATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATT
TTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGG
CTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTA
GAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACT
AAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAG
AAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCAT
GATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCAC
CACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTA
TTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATC
GAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAAT
CTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTT
AAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACA
GGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTA
CCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAG
AGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGA
AAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATA
AACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAA
TGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAA
GATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTG
AGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTT
GATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGA
AACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTAC
AAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCT
AGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAG
CAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACA
GAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAG
TACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTG
TCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATC
AAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAAT
CAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACAC
TGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAA
CAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGC
CGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAG
AGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATT
GAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCAT
ACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAA
TCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCT
TCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGAC
ACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTG
CACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACA
ATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGC
CAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAA
CAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGA
GAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAG
TGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATC
CACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATC
TGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAAC
GATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTG
ATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAAC
AGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAA
GCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATG
ATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAG
TCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTA
GGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCC
GCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCG
TCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCA
AGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAAC
CTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAG
ATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACC
ACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGG
ATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGC
AAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGA
ATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGAT
CAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTC
TTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAG
ATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCT
GTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGT
AACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCA
GAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACA
GAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTT
AGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATT
GGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAA
GACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAA
ATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAG
CGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGC
CCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGA
TATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGA
ACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAA
TACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACA
AATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGA
GTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAA
GACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTT
AGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCAC
AACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAA
ATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAA
CGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTC
AATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACC
AACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGG
TGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTC
GAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAG
ACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGT
GTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGC
GGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGA
ACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCG
TCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTA
CCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATC
TTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACA
GCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAA
CTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAG
GAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAA
AGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATG
TCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACG
AATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAA
CTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTT
TATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGAT
AAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATG
ACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGC
ATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAA
GCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATAT
TTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGAT
TCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATT
GGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAAC
ATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATG
TCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGT
TGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATA
GTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTC
TTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTG
TAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACAT
CAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGT
TCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAAT
GGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTT
GTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGG
ACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATG
TCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAA
ACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTA
ACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGC
GAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTG
GAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGC
ACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAG
AACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGC
AGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACG
TGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACT
TGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTC
GACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGA
CCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAA
CGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAAT
TGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAA
CTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGA
ATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAA
AGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTG
AACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGA
GAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGA
GATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAA
GATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATT
AGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACT
TCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGC
GAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGC
GCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGA
CTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACC
AGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAA
ACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTG
ATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTG
GAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATG
TGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATG
ATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGAT
GAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGAC
CACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAA
TAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCT
TCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGG
GATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACT
GAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACT
CAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAA
GAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGA
GAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCA
TGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGAT
GATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGT
GACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTG
AAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGG
AATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTA
AACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACC
TCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCA
AGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGT
GCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTA
AAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCT
GACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAG
TGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAAC
GCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAA
CTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATG
GTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTT
GCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGT
GAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAG
AAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCT
GAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAAT
CTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAG
TACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCA
ACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGT
TAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATG
AGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGC
AGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTT
GGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAAT
AAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATC
GAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGA
ATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTC
GTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGAT
TCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAAC
TCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTG
TGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGA
GTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAA
AGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCA
AAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCA
AAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAAC
GTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAA
TTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAG
CATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGG
AAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAA
GACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGA
TGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAG
TCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAA
CAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGC
GCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAAT
GGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTG
CCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACA
GTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAA
AAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAA
GTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAA
GGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACAC
GTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGAC
CAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGA
GAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGG
CCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCA
AAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGT
TGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATC
AACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACA
TCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGA
CTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTT
TCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGT
AATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGG
CATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTC
AACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACT
TGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCG
GAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGA
CTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGC
CCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAAC
CACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTG
AGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAA
AGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGAC
TTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCA
GGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAA
TCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAA
CAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCAT
CGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTAT
CACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAA
AATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGC
AGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTA
TTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGG
ATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGA
AGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGG
TCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACA
CAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACC
CAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAA
CTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGA
TCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTA
TTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAA
TACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCT
TGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGC
AAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTC
GGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTC
CCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGA
AGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATT
ACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGA
ATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCAC
TACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTC
TTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGA
GAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTG
CCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAAC
ATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAG
CATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTA
AAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTT
GTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCG
ACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAG
AACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGA
CGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTT
TACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTA
CATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAA
CTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGAT
CAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAG
GAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATT
GGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGG
AGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAAT
CTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGC
CCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGA
GACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCA
AACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTT
AGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATA
ATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGC
TGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAA
AAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAA
AGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAA
AGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTT
TCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACAC
TCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGG
TGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAG
ATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCAT
CCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTA
GCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAA
AACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTT
ATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGA
CACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAA
TGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACG
ACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACAC
CCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGC
CGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGAC
CGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCT
CTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATT
CGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCG
CTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATG
CAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTT
ACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGT
TAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAA
GAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAA
TCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCA
AGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACG
GCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGG
CACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACA
AATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTAT
CTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTC
TGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCA
ATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTG
TAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTA
CACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTAT
TTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTT
TTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCG
GCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAG
ATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGA
ACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTT
AAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATA
ACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAA
AGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGA
TATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTA
AATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCT
AAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGAT
CACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGT
CAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGG
CTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAAC
AAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAA
ACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCA
CGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATG
ACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTG
CAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGG
TGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAA
TCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGA
TAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGA
ACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTC
CTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGA
TAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACA
TACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAA
ACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCC
AATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGA
CAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACA
ACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATC
AAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGAT
CTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATAT
GAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATA
GCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTA
CAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGA
ATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGG
ATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGC
GAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGA
AACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGA
CTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTG
GCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAG
CTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAA
CTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAA
CCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCAC
AAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGG
GGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTC
TTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTAC
ACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACC
CTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCAT
GAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACC
TTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCA
CAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCAT
TATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCG
TCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGAT
TCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAA
ATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAA
CACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACA
AGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGA
CCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGAC
GTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCC
AACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGT
ACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAA
AGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCT
TTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTA
CAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAA
TGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCT
TGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAAC
AGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATA
CGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATT
GTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAG
AATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGT
CAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACC
AAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATG
TGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATA
TCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACT
TTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGT
ACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTT
TCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAA
CAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGAC
GTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGA
ATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTA
AAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCA
TGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTC
AAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAG
GACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGT
GCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAAC
TGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTT
AACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCC
CAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACC
AGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACT
CAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGC
TTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTG
TCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAG
CTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAA
ACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGAC
CACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATG
ATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAA
CGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAA
CACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTC
GACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTC
GATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATG
TTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGA
GAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGAT
TGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCC
ATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGA
CGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGAC
AGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGAC
GTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGA
TGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGG
AAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACG
AAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGG
ACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTG
ACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTG
GACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGT
TTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACA
CACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCC
ACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGA
GCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTG
AAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAG
CAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAA
AGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCA
TCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAA
TCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAA
AACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAA
GACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTG
AAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATAT
TCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAA
TGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGG
GTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGA
CCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCG
AGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAA
TCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTC
ACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAA
TTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAA
TGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACAT
CCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACA
TACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAA
CACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGC
CTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACT
ATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACG
ATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATA
TCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAA
GCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAG
TGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAA
TCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTG
GTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATG
CGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACA
TTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGA
ACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTG
TCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAG
ACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGG
CACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAG
TCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGA
AGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATG
AAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCA
GTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAG
ACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATA
AAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGT
AAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGA
CTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCG
TCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGA
CAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTG
GAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACA
ACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTC
ATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAA
TAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACA
ACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACA
GATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGT
CGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATT
TCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCA
GCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAA
TACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTG
CAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATT
GAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCT
TTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAG
GATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGT
AGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAG
AGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACT
GGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCA
AGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGG
GACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCAC
AAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGT
GGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCG
TTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAA
AGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAAT
CGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGA
CGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTG
AAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTC
AAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAG
AAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAAC
CAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCT
TTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACA
TGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGC
CTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAG
ATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGA
TCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACC
TTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATA
AGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGT
TTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTG
TACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTAT
GATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGA
TGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCA
TGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATA
TTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTC
CGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTA
AAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCC
GAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATAT
ACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATG
AGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACC
AAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACA
CGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTA
GAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCA
ATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAA
TTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATT
CGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGA
CTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAAC
ATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAAC
AATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCA
CTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGT
TAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAG
AAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGA
AACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCA
TCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATT
CCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGG
ATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGC
AAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCT
GTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTT
CGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACAC
GATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGG
TAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTG
TGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGAT
TGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCG
ACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTC
ACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTG
GTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTG
ATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACG
ACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGA
ATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGAT
GTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGA
CAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACG
CAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATT
ACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCG
ACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGA
CAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTAT
GTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAA
ACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGA
TATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCA
AAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAA
GGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCAT
TCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGC
AACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGAT
AAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTG
GTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTA
TCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGT
CGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACA
TTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAA
ATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAA
GTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCG
ATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTG
GATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTT
ATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCAT
CGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAG
AAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACG
ACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACG
ACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAA
ACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATT
ATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACT
ACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATT
GGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAA
CCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGG
GAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGC
TCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGA
CGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGT
CTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAA
ACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTT
CCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCT
GGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGA
CTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGT
CGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCC
GTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAAC
TTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACC
TAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGG
ATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGG
ATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGG
ATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCC
GATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCAT
GCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGA
CCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAAC
TGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGAT
GCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGA
GATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGA
CGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTG
GAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAG
GAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGT
TTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAAC
CAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCG
TATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAG
CATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCAT
CTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCA
CAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGG
TTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGT
TGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAA
TTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAG
TTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTC
GAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAA
ATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCG
AAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTC
CGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGA
TAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGG
ATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGC
AAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCT
TTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAA
ATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGA
TTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAAT
TGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACT
GGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAG
ATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCC
ATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGAT
CCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGA
ATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTG
AGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGAC
TTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGA
TTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCAC
AGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTT
GATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAA
AACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGC
AATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAA
CGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAG
AAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAG
AGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAA
AGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAAC
CATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTG
ACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAA
CACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCA
CCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATT
GAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGC
TTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGC
AACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGC
GACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATA
CGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATG
CTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTA
GAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGA
AAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATG
CTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGT
GGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACA
ACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAA
ACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGT
GCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGAT
TGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGA
AAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGAT
ATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGA
AGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGT
TTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGA
ATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGA
TGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTA
GCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACG
AGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGA
TGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACC
AATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGC
CCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTG
TCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAA
TGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAAC
ATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAA
CAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAA
ACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCC
AACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATT
GACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCT
TTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGG
TGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAAC
AGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCT
GAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAA
ATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTT
CTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGT
ATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCAC
GATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACG
GCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGA
AGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCAC
AAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGC
AAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTAT
CAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCC
GAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGG
TGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGG
AGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTC
CCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGAC
ATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCG
ATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGC
AAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTT
TCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACC
TTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAA
ATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCAT
TGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAA
GTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATA
GAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGA
TCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATT
CTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGAC
GAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAA
TAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATA
TGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCA
AGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAG
ATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATA
CAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATT
AAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAG
CTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTA
TGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACA
ACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCA
TCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAA
GTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACA
TCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACG
AAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCA
GTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACA
ATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTAT
GTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGC
TCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAAT
GTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGAC
CATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGAC
GCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATC
AGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGA
AAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCAC
CATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTA
GCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAG
TGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAG
GTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAG
CTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGAT
TCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATG
GAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTA
TTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATT
CGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAG
GAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGAT
GGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGAT
CTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATC
CACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTAT
CACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCG
TGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAA
CATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAA
GGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAA
ATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACAC
AAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACA
ATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAA
GTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATC
GGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCA
CGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTG
GTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGT
GAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATC
TATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCG
ATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGT
CGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGG
AAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCA
TCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACT
CAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAA
TCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGC
GAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTT
TCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTAT
TCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGT
TTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGC
TGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAA
TGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAAC
ACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATC
AACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATC
GATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACG
TTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCG
GCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCAT
ACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCA
CACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCA
TGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCA
TGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATG
CAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAAC
AGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTG
AAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGAT
TGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGC
AGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAA
AAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGT
ACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATA
CAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAA
GCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGA
CGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTA
GTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAG
AATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGT
CATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATT
GTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAAT
CGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAAC
TCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAA
ACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGC
TCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTG
TTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTA
CAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGC
ATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGT
TGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAA
GGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTA
CAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACG
AGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGG
AATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTAC
AACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAA
CAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAA
GTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTA
TTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTG
AAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACT
TATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTG
GCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAG
AAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGC
TGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAAT
GCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGG
GAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACA
ACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAG
AACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGT
CAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCAC
AACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTG
TTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGC
CTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGA
AAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGA
CCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTA
CTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACG
TTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATC
CCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAA
TCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCA
CATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGA
CCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATA
ATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTG
AAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGG
ATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTG
AATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACC
AAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGA
AATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGA
TGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAAT
ATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAA
AGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACA
GAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAA
GATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAG
AAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAA
CCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTAC
AAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAG
TGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGT
TACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGAT
TTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACG
CGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTA
TTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGAT
TCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGG
TGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGA
TACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGA
CATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACA
AAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAA
GAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAA
GTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAA
AAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGC
CAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATT
TCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACC
GAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGC
GTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAAC
GATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAG
AAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTC
CACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCA
ACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCA
TCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACA
ACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAG
AAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTT
GCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTT
AGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAA
GTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTG
GAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGT
TGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCA
TCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTC
GAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTT
AGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCC
GTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTT
TTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACA
GTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTG
AATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACG
GTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGA
AGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAA
TTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGG
CGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATA
TGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGA
GTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAA
GAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCT
CTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTC
AACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCC
GTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACT
ATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGG
TTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGAT
GACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACT
TGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTA
TACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGAT
GAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTT
GGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCT
GTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGA
AGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAA
AAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAA
ATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGA
TCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCA
CCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATT
GAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGA
GTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCT
CTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAA
ACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGG
ATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACC
TTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAG
CTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAA
AACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAA
CAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATG
CCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGA
TCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAG
GAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGA
TCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAA
CCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAA
GAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAG
CTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCA
GCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGA
GAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTA
CTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTC
AATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAA
AAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCA
AGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTG
ATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACA
ATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCG
AAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAG
CAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGA
AGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATAC
TCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATC
GATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTC
ATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACAC
AGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCA
CAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAAT
GGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCA
AAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACA
ATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGA
AAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTG
CAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCA
CGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTG
AAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGA
TGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGAT
GAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAG
CTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGC
GTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGAT
TTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTC
AGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGG
GAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGC
TATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTC
CGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAG
TCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCT
GTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGAT
GTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCAC
GCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGAT
CTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAA
GCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAAT
TCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCA
AGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTT
CATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGAT
TCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGT
TCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAA
CATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGA
AACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGA
GCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAG
GGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGG
AATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGA
CCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAAT
AGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCG
GAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCC
TCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATA
TTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAAC
ACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATA
CACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAA
TCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGT
TTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGA
CCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAG
AACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAA
CAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAAT
GAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACG
ATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAA
TCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAA
CGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTG
AAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGA
AGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGAC
CATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGT
CTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGG
CTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAAC
GCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTC
CGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACC
CGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTT
TGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGC
AAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACT
TGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGA
GCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAG
CATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTC
GGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAA
TCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACT
GGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTA
TCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAA
ATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGAC
GGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCAT
ATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGC
GTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTT
CATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTC
GATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGG
CTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACAT
TTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTC
TGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTG
GAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGT
GAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTT
ATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTA
GTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCA
ATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTC
GCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGG
CTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGT
ATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGAC
ATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTC
TCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAAC
ACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAAC
GGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGA
AGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGA
ATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCAC
CAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAA
CATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAG
AACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTG
GATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTG
GGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGA
CGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACC
AATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACG
AGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTG
AACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACT
TGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAAT
ATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAG
ATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAA
CAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGA
ACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGA
TTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGA
TGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAG
AAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTC
AAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGA
GAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGC
TAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACT
GTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAG
TTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAAC
GATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGAT
GAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGA
AGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTG
AAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGAT
GCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGA
GATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCA
CAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATA
AATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTC
CATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGA
TGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGA
ATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCA
AATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGA
AATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGA
AGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATG
CTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGA
TGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGA
CGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAA
GAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAA
TGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAA
CACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTC
ATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAG
ATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGC
TTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAA
AAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGA
CACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTG
ATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGC
GGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACT
TTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGT
TTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGC
TTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGA
AATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAA
AACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGA
ACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCT
CATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTA
CAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAAC
CCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTA
GGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAG
TGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAG
ATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGG
TTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAA
AATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGA
ATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAAT
TCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGT
GTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTC
TGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTC
CTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTG
GTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGT
TTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAG
AAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAA
GGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAA
AGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGT
TGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATT
GAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCA
TGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAA
ACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGA
CGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATG
AACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTC
TATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACA
ATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGC
TACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGG
TTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCC
TTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGT
GTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAA
GAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGT
TAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGG
GTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGT
CACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCA
ACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGA
AATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCC
CTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAA
GAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTG
AGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAA
CAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATC
GAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACT
ACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTC
AAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAA
TCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCA
TCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAA
CACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTG
CCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGA
GCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACT
TGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCC
TGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCA
CCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAG
AGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAG
ATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTT
TAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGG
CATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATC
GAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACA
ATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCG
ATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCA
CTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAA
TGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAG
ACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATT
TTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGAT
GGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAG
GTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTC
AAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACA
AGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCA
GCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACT
CTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATC
GGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATT
AAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATA
CGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTG
ACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAA
GGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGG
CCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCC
GCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAG
GTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTAC
CACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAAT
TGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTA
CTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTT
ACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGA
ACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCC
CAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACAT
ACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCA
TGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAA
AAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGT
ATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGAC
AAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAA
CCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACG
AATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTA
CTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACA
TCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACT
GGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCA
GATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGA
ATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGG
AGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAG
CGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCT
TCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCC
GACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGA
CGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAA
CAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAG
AGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAAT
GTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTG
AATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAA
GTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAG
CTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAG
ATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTC
AATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTC
CATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTG
TGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGAT
TGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCC
TACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGC
AATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAA
CATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTAT
TGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACA
CCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATG
ATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGAC
ATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCC
GCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCG
TCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCG
CAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCT
AATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCG
AAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCT
GAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCA
AATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTAC
GACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTA
GATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGA
GGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATC
ACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAG
CTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGC
CAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCA
CGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAA
TTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCT
TCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTG
GTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAAT
ATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTA
GCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACA
CAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTT
GTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTT
AACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGC
CACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGAT
TCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAAC
CTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAA
ACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAAC
TTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAG
TATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATA
TGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAA
TTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAA
ACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCA
CCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCA
AGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCT
TGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAA
AGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAAC
ACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACG
GCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGAC
AGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCA
AAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTG
AACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATC
TGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATA
GTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAAC
GCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCT
TTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATA
AATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATA
CAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAAC
TATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAA
TTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACA
AGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAAC
AACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAA
GCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCT
TGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGA
ATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGC
TCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACA
ATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAAT
CGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGAT
ACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGA
ATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAA
CCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACT
GTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGC
GTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCT
GATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACT
AGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACC
GACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAA
GACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGG
CAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTT
CAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACAC
GATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCT
TGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGA
AGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTT
TTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACA
AGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTA
TACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTC
GTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTC
GTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAAT
ATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACA
CGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAG
AGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACC
CTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGT
TTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAA
CCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTAC
AAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAG
AGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTT
AAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACA
AAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATG
AATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTG
TCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAG
ACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACG
TATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGT
AATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAA
TCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCA
GTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAA
ACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTG
CGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATC
TTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTT
GAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTAC
AGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTC
AATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACA
AGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGT
CGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAAT
ACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAA
AAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATG
GCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAA
ACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGA
CGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGC
CGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTG
TTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAA
CATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCA
AACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAG
TTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCA
ACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTT
ATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTC
ACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCT
TAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAAC
GTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCA
CGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGAT
CACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACG
ATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACA
CAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGA
CCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGA
TTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTT
TCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGA
AGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTG
CAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCAT
GGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACG
AATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAG
ATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGT
CATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATG
GCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAA
ATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAA
GAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGAC
AAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGAC
GTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGA
CACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTT
TTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACA
CTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCAC
CAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGC
TTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAA
GAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCA
AGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAG
GTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATC
ACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATC
GAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAA
CTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGA
CAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAA
GAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTC
AATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATG
AAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGT
TCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACC
TCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAG
ACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATC
GAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCAC
GAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATT
GACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATG
TTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCC
AAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATA
CATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACA
CCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCT
ACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTAT
AACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGAT
GGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATC
GAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGC
AAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTG
GATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATC
GTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGT
CTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCG
GGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATT
GTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAAC
GTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTC
AGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGAC
TGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCA
CAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTC
GAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAG
TATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAA
ATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGT
TTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGAC
AAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAA
ATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAA
GGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACT
TGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTC
TTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACA
GTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGA
GCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAAC
GAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCAT
AACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATA
ACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAAC
TTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGA
TACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCG
AGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTC
AACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGC
CATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATA
CCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCA
AGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGA
ACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTT
GATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGA
TGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAG
TGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAG
CAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGG
TAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAG
AGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGA
CCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAA
GACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGG
GAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTT
GGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAG
ATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCG
ATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACG
ATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAA
ACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAA
AGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAA
ATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCA
AAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTT
CGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATG
CTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCT
GAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGAT
GGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATC
CAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTT
ATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAG
AAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTT
GGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTA
CACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGA
TAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATG
GTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATG
AACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATT
TTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCG
AACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAA
GGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGA
ATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATAC
ATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAG
GATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAA
GTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACG
GTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGA
AGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAAT
TACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATT
TTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCG
AGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACT
TCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACAT
CATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAA
TAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACT
TTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTA
ATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAA
GCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAA
CACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATC
CTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCC
AACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGAT
GCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAA
AATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGT
TTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCG
GATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGA
TTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTA
GCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTG
AATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTG
AGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGAC
CATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCAC
AATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGT
CGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGAT
GTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGAC
ACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAAT
TAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGT
CTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACA
AGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCA
ATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTAC
GTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGAC
CAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACA
GGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGT
TACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAAC
TTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATA
TACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAA
GGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGG
TCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTC
AAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAA
CTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAA
GTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGT
GAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATC
AAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCG
AGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATT
GCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAAT
TCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGT
TGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGAT
ATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGA
TCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTAT
CTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCG
CAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAA
ATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGAC
AACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGAC
TTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAAC
TCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTAT
GTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTAC
CGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGG
AGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACC
ACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGA
AGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTC
TGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACG
GCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCT
GAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAAC
AAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCC
ATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGG
GAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACT
GGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCG
GAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGT
CACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTT
CAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTA
GCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGAT
GAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGAT
ATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGAT
GAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGA
TTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGC
AAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACC
CAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTG
GACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGC
TGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGA
TCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACG
CTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGA
ATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGA
AGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTT
ACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCA
ACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTA
TGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCA
TACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCT
CACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACA
GCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTT
ATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTG
AAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATT
CATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTT
GGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGA
GACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAAT
TATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAA
ACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCG
TTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATA
ACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGAT
GAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAA
AGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTT
ATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAAT
GGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATT
CTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTG
GTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGG
AAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGAT
GCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCAT
TTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCC
GCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAAT
GACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAG
ATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTT
GGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATT
TAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAG
GTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGA
TATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAA
CCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAA
TCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACG
ATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAA
ATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAG
CTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAG
CTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCA
TACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGAC
CAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACA
CGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACC
AACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGA
AGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTT
CGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAA
CGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGA
CGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACG
AGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCT
CACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGA
ACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAA
AAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCT
GATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGG
ACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAAC
AATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAAC
GAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGC
CAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTG
AAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAA
GAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATAT
TGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAG
TCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTT
GAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAAT
TGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATG
GATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGC
GAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAG
AGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATG
AATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAA
TCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCC
TGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTC
AATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATG
TTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACAT
CTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACA
ACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAAC
ACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAA
CAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGA
CAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTT
TAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTG
GAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAG
AGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGA
AGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAAT
CTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCT
TATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTAT
CAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGA
TTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGC
AATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAG
AAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAA
GTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAA
AACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCA
AAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGA
AGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTG
ATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAG
TTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCC
TTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACAT
TGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGAT
TCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAA
AAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTC
AAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTT
GTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAAT
CTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTG
ATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGT
ATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGA
ATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATC
GCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCT
TTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGA
AGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATA
AGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATG
GGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAG
AGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGAT
ATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACA
AAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAA
GTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCT
GATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATG
TAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAAC
TCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATC
GAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGT
GGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATC
AAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAA
AATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGT
TTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAAT
CAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGT
CAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTC
ATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGT
GGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCA
TCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGC
TGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAG
ACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAA
ATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCA
TTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGC
TCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTG
AAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGT
GGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCT
GGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTC
TTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGA
AGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATT
CCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCG
ATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGA
AAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGG
ATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCT
TTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCA
CCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCA
CGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTG
CGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACA
TCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGG
GAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAAT
ACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAA
AGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAAT
TAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGT
CCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGG
AGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACG
ATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGT
AACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGA
AATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTA
TCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGAT
TTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCG
CCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAA
GTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATC
GTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCA
GCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATC
ATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGA
AACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTC
AGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTC
CGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTT
GCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTG
CCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATG
TTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACAC
AACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAA
CGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGA
TAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTT
TACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGC
CATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATAC
CACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACA
CGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATG
AAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATG
GGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCA
AGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAG
TCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAA
GGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTG
CCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAG
GATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAA
GATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTAC
TCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACA
AGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGC
TTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACG
AATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGT
CTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAA
TAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCA
TATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGT
TGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCG
CTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTC
GAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAAC
TGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTC
TCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTT
CGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACA
AGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCAT
TGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTG
GTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGG
TGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACA
ATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAG
GATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAA
TAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAA
CTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACA
GATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGT
CCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATT
TCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAA
AGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTA
TTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGC
GAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAA
AATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTG
CCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGC
AACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGA
GCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAAC
TAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAA
CGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCA
AGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAA
CGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTT
GAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCT
TTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAA
ACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACC
GATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACT
TGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTT
CGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCC
TAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATC
AAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACA
TCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACC
TCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAAT
ACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAA
AGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGAT
TGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAA
TGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAA
AGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAA
TGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATG
GTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATAT
TGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAG
AGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGA
AGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGA
TGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAA
ATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACC
GTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAA
AATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTG
TCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTA
CGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTT
GTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCG
TCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATT
TATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTC
ATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTG
CTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATA
CGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACA
TATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAA
AAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGA
AAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGT
TTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAA
GAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCA
GTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTC
AAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGA
GAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGT
CGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGA
TGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAA
GAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCA
CGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAAC
CCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATC
ATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAAC
GACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAA
AAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGC
CGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAG
ATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGT
GTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGA
GAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTG
ACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATC
GGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGA
GAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAG
TCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGT
GCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTT
GACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGT
TAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAA
TCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGT
CGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAG
AATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATT
AAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCG
AGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATG
AAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGT
ATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGA
AATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCT
CAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAA
CCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGT
TTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTAT
CTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTT
CAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGA
CGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTG
ATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATA
CCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGA
AATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGG
ATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGT
AAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAG
AATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAA
AATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAAT
ATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATC
AACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACC
TCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGA
AATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGT
GAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCT
TGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAAC
AAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGAT
ATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTT
GATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCT
TGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAA
CAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACA
ATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCC
AGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATC
ACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGA
ACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATC
GTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACC
ATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGA
ACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCT
AACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGC
TTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGA
GCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACT
CCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAA
TAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAA
GCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAG
AAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGAT
GACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAAT
TAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAA
AAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCA
AGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAG
TCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTC
GAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGA
TGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCAT
CGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAG
CAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACA
AATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGG
AAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAA
ATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAAT
ACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAA
GGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCA
AAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACG
TCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAA
AACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATG
GTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGA
AACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCT
GAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGT
TAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTT
TAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAG
CTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGA
ACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTA
TGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCG
TCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTC
TTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGT
CTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGT
GAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGC
TTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCT
GAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGC
CGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTC
AATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAG
AATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCA
TCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTC
CACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTC
ACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACA
TCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAA
CAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGC
ATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGG
ACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAA
TCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACC
TTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAG
CTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGA
AGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTC
ATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATT
CAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACAC
GCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACA
CCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATC
GTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTT
ACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACC
ATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAA
CAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACA
AGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGA
ACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGAT
GAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATC
ATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACG
ACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAA
GATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAG
ATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCA
TCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCT
CGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCT
AAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGC
CGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCG
CCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCG
ATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTG
TCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAA
AAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTG
GTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGC
TGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCA
TTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGG
AGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATC
GTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGG
TTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATC
ATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAAT
GGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGG
AGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATAT
CGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGT
ACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCA
TCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGA
TGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCT
AAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTT
GTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTG
GTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGA
GGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGA
ACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTAT
CTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGT
CATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAAT
CTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGC
GTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCT
CGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTAT
TAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACAT
GCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTC
AACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACAC
CATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGG
ACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAG
TAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAAT
AGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCA
AGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACA
TGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAA
CTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGA
TGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGG
CCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACG
TACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAA
TACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAG
TTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAA
CGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTG
ATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATAT
GACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGAT
TAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACA
AGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAAC
AGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATT
GGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATG
AAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAA
ACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAA
AGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGA
AGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTA
GCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGT
TCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTT
TATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGA
TTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGA
ACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAG
GCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAA
AATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGC
CGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGA
TTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACA
GGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAA
TCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCA
TACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATG
ACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAAT
AACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAA
TGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAA
TCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAG
AACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCT
ATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATG
TTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACG
TCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGA
AATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATG
CGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACA
CAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCAT
ATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGAT
GTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTT
CTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAA
AACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACA
CGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGAT
CAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGG
ACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTT
CCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTT
CTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTT
TGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAA
TCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAA
CATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAAC
AATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCA
TTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACA
AGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCC
GACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGG
ACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTG
GTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGAT
TCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTT
GGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAA
TGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAAT
CCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTC
AAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGT
GGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTG
GCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCT
ACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGT
AACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTT
GATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAA
ACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGG
ACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAG
GGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTG
GGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGA
AATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATG
CTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAAC
ACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACG
TGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAA
CCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTA
TCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAAT
GGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTA
CCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTT
GTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTT
CAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGT
GATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGA
GCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTA
AAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGT
CTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCA
CTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAAC
TCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAA
TTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCT
CGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGA
AAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAG
AATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACA
GCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGA
AATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTAC
ATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAA
ACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATC
AAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATC
AGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACA
CAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCC
GACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGC
TGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTG
AAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTG
ATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACC
CGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAG
GACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGAT
TATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTA
GTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCA
TTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGA
AACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAAT
TACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGAT
AGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACT
ACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATG
CAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGAC
TGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTT
ACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGG
ATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGT
GATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAA
GAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAG
GCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGC
CACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCT
CCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGG
ATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAA
GGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACG
ATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGAC
CAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGG
CGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCC
TCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGC
ACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGT
ATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCA
CTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTG
CTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACT
CAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTAC
TTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAAC
GAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCA
GGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATAC
AAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATG
CTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAA
GTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTAT
GAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAA
AGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACC
AGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAA
TCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACT
TGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATC
AACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGG
CTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGA
TCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAAT
TCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAG
TTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCG
TGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTC
GAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGA
CTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACG
CTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACA
ACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAG
AACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGT
ATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAA
TCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGT
TAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCT
CAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGAT
GTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAA
TGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCA
TGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTG
CGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTG
TGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTA
CAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAA
TGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACA
TTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTG
GCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACC
CAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGAT
GGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACAT
AATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGC
TTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTC
AGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCA
GAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAA
TGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAA
AACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGA
AGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAA
TTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGA
CTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGA
TTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGG
AACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCAC
CATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCT
CATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCA
ACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACG
ACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATT
CAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTC
CAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGT
CTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATAT
AGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGC
CTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACA
GGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGT
AAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAA
CTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCA
CGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTC
CTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCT
AGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAAC
ATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTT
GGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTA
TCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATG
ACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATT
ACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAAC
TAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACC
CAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAG
TTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTG
TTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAG
TGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACAC
AATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGC
GTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAG
ATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAA
ATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAA
CAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTG
AAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGT
GTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGC
GCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTT
TGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAA
TTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACA
GTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTA
TCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATT
ATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAG
AACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAA
CAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGC
CATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTG
AAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAAT
GATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTC
GAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAAT
TCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCG
AAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATAC
TTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAAT
TATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACC
ATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGT
CAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGT
CGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGA
TATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAG
AAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGA
CGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGA
CGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCA
AAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCA
ACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGA
TTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTG
GTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAG
AAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTT
GAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAG
CCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATA
CGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGT
CGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGT
TACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATAT
GAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACG
CTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAG
ATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCT
GAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTT
AACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACC
AACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAA
GATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAG
TTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAA
ACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAA
AATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAA
TTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTC
CACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGAC
GTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTA
TCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAA
TTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATC
AAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGT
CCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAAC
CACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCG
CTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTT
GGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGA
AATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAG
GATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAA
TGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAG
AACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCG
AGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATAC
GGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAA
ATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGC
TTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAAC
CCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACG
CTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCG
TTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTT
CATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACA
TCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAA
CGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTT
GGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAAC
TCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTAT
CAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCAC
GTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTA
AGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGT
ACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACG
ATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCA
CAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGAT
GAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACA
ATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACC
AATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATT
TCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTC
TGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAG
AGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCA
AGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGG
TAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAA
TTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGAT
CTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCA
TGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGC
CGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAAT
TGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGA
AAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAA
ATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGT
TCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACA
CACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTT
GCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACT
GAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCA
ATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTT
GCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGA
AATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAG
TCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGT
CGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCAC
GTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGA
AACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACT
AACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACA
ATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGA
GGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAA
TGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAA
GAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTC
GCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTC
GAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGAC
AGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGA
ATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGA
GTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGA
CGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTT
AATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAA
GCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACA
TTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACC
ATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTAC
CGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAA
CCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGG
CGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGA
AAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAA
GATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGA
TTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGT
ATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCT
GGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGG
TCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGT
CACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGT
CAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAG
TGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTG
TTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACA
ATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGA
GGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTA
TCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAAT
CAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTT
CTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAA
ACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAAT
GACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGG
AATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTG
AAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTT
GACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGT
CGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGC
CAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGA
AAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAA
CAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAAC
CCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTT
GACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATA
CAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAG
GATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAA
CAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCA
TCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACC
ATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAG
AGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAAC
GATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGA
TATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATG
ATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTG
GTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCA
ATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTA
ACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAG
CTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACC
AATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGA
CGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGA
AGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGG
TCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGAT
GGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGAT
CAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGAT
TATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAAC
ACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAG
AACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAAT
CCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAA
GAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCG
ATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCT
TTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGA
AGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGG
TTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCA
ACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTAT
TACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAA
GCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGG
AGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACA
CAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATA
ACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGT
GCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAA
CGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTT
GAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAA
CGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGG
TCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAAT
TAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACAT
CATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGA
TTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGT
AACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGT
GTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAG
CTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTA
CAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTT
GGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAG
GTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTC
CACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCA
TCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATA
ACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTT
CGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAAT
GAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGC
TTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACA
CTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCT
ATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAA
CAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGC
CAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAA
TGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTT
GAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGA
TAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATT
GCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGC
AATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAA
TTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAG
TAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCA
TATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAA
TGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCG
TATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGT
CACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACAC
AATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTA
AATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCT
GCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAG
CATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAAT
CCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGT
CATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCA
ATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGG
AGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTA
CAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTT
TGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATA
CCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGG
CAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTC
ACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAA
AGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACT
GACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGT
GGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGA
ATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAA
GAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAG
AAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGC
ATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTC
TCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTG
GATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATAT
CAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATC
GCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCT
TCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCA
AGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAAT
TCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAA
CTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTT
CAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTC
GTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGT
GTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCG
TCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAG
ATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCAC
GTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAG
GAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTG
GTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGC
TCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGA
ACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAA
AACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCAT
CAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGA
ATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGG
CAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGA
AGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCA
CGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCA
AAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGC
ACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGA
GCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATAT
AATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGA
GATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATT
TGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAA
GCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCA
AAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGA
CGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTG
GGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATC
AATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCT
CATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAAT
CGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAG
TTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTAC
GGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAAC
TACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATG
GACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATA
CATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCA
CTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGC
TCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTAT
TCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAA
GAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCA
TGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGG
CTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGA
CAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTA
TTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAAC
AAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTT
CACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAAC
GAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGA
ACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAG
ACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTAT
AAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGG
AAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCT
CTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGT
TTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAA
GACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGC
TAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTT
TGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGC
AAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGA
CTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGAT
CAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGG
ATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTA
AAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGT
CATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATA
TTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACC
GATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATC
AACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGAT
ATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAAT
CATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCT
TGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCT
ATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATA
CGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCA
GTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACG
TGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAA
CAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAG
ACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCG
TCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACG
TGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACG
AGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAG
AAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCA
CTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAAC
AAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAA
GTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGA
TAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGAC
TGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAA
TTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGA
GGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCA
ATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAA
GAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGA
ATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTG
ATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTC
AATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGA
GGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTG
ATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGA
TCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGA
ACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAG
TGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAA
TACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATC
TATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTG
CTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAA
TTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTT
TATCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCT
CACACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAAC
ACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACAC
GAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACA
AATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACA
GCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTA
AGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGA
GAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAG
CTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAG
AAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCT
TCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTA
TGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCA
GAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATT
GAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAA
TGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAA
ATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGT
ACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAA
CAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAA
AAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAG
TGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGAT
AAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTT
TTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTT
GTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTG
GCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTC
AATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAA
ACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAA
GAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGT
GGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCT
TGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGAT
TTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTAT
CGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAAT
GGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGC
GAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTT
TGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAG
AGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAG
AGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGG
AAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAG
CAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATAT
CTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAA
AATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGT
CATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGA
TTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTA
AATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTC
CAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGA
AACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGG
ACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAA
GCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAA
TATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTT
TGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCA
GAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCA
GAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCAT
GCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGG
ACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATC
CAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTG
GGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGAC
CCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAAT
TTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATT
ACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTC
ATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAA
AACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGG
AAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGG
TTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTT
GGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAG
AATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCC
AAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGAT
TTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAA
AAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGAT
CAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTT
CCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACC
CTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACG
GCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCG
ATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATC
AAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGA
ATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATAC
ACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAG
GTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTA
GAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCC
GTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAG
AAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGAT
TCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAA
CGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAA
TCACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATC
CAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTT
CGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCC
CACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGT
TCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGT
GTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGC
GATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCAT
TAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAA
CATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAG
ATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCG
TCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGC
TATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCC
TTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTT
GACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAA
CCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACG
TTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATA
AATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTA
CGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCA
TTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCA
CAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACG
TTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAA
ATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGG
AACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAG
AACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTC
AAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGG
AGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCC
AGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGA
TCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGA
TCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTC
ACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAG
GGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTT
TGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAA
TCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCT
TCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATA
ATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATA
TGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTG
ATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCT
TCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGA
AGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTG
GCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTC
CAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCG
AGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAG
AAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTG
ACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGT
GGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTG
AAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAAT
ACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGA
TTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATA
GCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACT
TGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGA
TTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCC
ATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTC
CATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAG
AACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATT
AACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGA
AGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAA
TCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCC
GTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAA
CGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGC
TGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTA
AATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACG
ACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAG
ACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACG
ACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGA
GAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTT
CCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAAC
AAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGA
TAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTG
AACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCG
ACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTA
ATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAA
AACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATC
CAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTC
TATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATAC
TGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAG
ATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTG
AATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATG
GCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAG
CTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATG
GAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGT
GCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTG
ATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAG
TTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAG
TACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATG
AGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAAT
TGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGT
TCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAA
TCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTC
AACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACG
TCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGT
TTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTC
TGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTA
TATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCAT
GGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCT
ATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACG
CAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATA
TGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAA
ATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAA
AAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTT
AATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGA
AGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGT
CTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAA
AATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGA
AAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCG
AACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATG
TTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGA
AAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACG
CAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCC
GAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCAT
TAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGA
CGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAA
AGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCG
ATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGAT
CAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGT
TGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGA
AGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGAC
GATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGG
TGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGA
GTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTC
AACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGC
CATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGA
CGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTA
GATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATC
AGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCG
AACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAA
TCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAA
AGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAG
ACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAA
AAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTAT
CTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAA
TCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCA
ACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACC
AAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTT
TGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCT
TCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCA
ACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACG
TCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGAT
CGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACC
TGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAA
TGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGAT
ATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAA
AAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAA
TTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAA
TGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATAT
TAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAA
CTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTC
CACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAA
TCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGA
AAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTG
GTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAA
GACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATAT
ATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGA
TCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTG
GATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACA
GAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAAT
CGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAG
AAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCAC
GGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAAC
TGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGT
TTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCAT
CGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAAC
AAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAA
CCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTT
TCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGC
ACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCC
TCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATA
ATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGC
ATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAA
ACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGA
CGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTA
AACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAA
GCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAG
TTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTC
ATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGA
GTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATG
ACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCG
CCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCA
ACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAA
TGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAA
GATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAAT
GAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATAC
CGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGG
CTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAA
AACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTC
AATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAA
CGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGT
CTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAA
CTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGA
AAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTA
AAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTA
ACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCT
CATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAAC
AAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATG
CAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTC
TCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTT
GACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCT
CTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGA
ACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTT
TTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGA
GCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCG
GCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAA
TATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAA
TTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATC
ATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCA
CCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCAC
AGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATC
AAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACA
AGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCAT
TGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGAC
TTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATC
AACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTT
CACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCT
CCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAG
TACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCAT
CGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCA
GATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGC
CTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACC
CGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGT
TCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTAC
GCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCAT
AATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACA
GCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAG
AAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAAC
GGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGA
GGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCAT
TAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGAC
ACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGA
TCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGAT
ACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATC
ATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCG
AAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAA
AAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCG
AACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCC
GAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGAT
TGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTC
AGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAA
AACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGT
GAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTG
CTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATT
CGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAG
AAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGT
AAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTT
GTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCAT
TCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGG
AAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAG
TTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCG
TACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTAC
CGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATC
AAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATG
GATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAA
ACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGT
TGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGT
TCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGG
ACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAAC
CATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCT
TGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCA
TCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCT
GCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGT
TGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCG
ATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTA
GAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGC
AAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAA
CAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCA
TCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGAC
TCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTA
AGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAG
TTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAG
ATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATG
ATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACT
AGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATG
AACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCC
AACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTA
CGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATA
CTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTT
GCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACG
AAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGAT
AAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGA
CGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTA
ACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAG
AAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAG
TATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGG
TCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAA
ATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAAC
ACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAG
CTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAG
ATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGC
GCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTC
AAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTA
TCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATT
TGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAAC
TCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGC
CACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAA
TGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCG
ATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATT
AAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGG
ACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATC
GGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATA
CTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGAC
CTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAA
CCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATG
CTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATC
ATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAA
CGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTAT
TTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTT
GAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTC
ACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAA
TGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCG
CTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACA
AGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATAT
GAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGT
GATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCT
CAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAA
CCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACG
CGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCA
GCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGAC
AGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCC
AAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCT
AGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTG
TCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATC
CCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACA
TTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAA
TTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATT
ATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAG
CACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGA
CTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGAC
ATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGT
GCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTC
CAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGG
AAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATG
AAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCC
ATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAA
AACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGG
TGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGC
TTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTAC
CGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAA
CAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGA
TGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAAC
GACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGAC
GCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGG
GCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGG
ATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAA
TTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCT
TGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACAC
AAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTG
CAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACC
GGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATC
AATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGG
ATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACC
ACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGT
CTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCA
ACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGA
TGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGC
TGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAA
ACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCT
AGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACT
CGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTC
GGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATT
GAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCG
AAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAA
GTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAA
TTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGC
TAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAA
TGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACAT
CGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAAC
AATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAA
GTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAG
AGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACA
GATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGA
CCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTG
ATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAA
GAGCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGAT
CACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCG
TCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGA
CGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTA
TGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGT
CTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATT
GCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAA
CATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTA
CGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAG
TACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTAC
TCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCA
GAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTG
TAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTAC
AGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGAT
GATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGA
TGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGA
ACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGC
AGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCA
CACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCC
GCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGAT
AAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGG
ATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGAT
CAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCA
AGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCG
AAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTC
GAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCAC
GGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTAT
TTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACT
TATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCT
AACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCA
AAGAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTT
AAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGA
GTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGG
GTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAA
GTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCT
GAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGT
TGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGA
GAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAG
AAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAG
CAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATC
CGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTG
GTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAA
CAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCT
GACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATC
TGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTC
ATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTT
TGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTG
AAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGA
GTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACT
CCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCT
AACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAAC
AGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAA
CATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTAT
GTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATC
GGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTA
GTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCA
ATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGT
AGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATG
CTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATG
CCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCG
CACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTG
GATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACA
GTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATG
TTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATT
GTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGC
ACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCA
AAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGG
ATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAA
TTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTT
TAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAG
AATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGA
AATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATG
GAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAA
CGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAG
CGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATT
CTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACT
TCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATT
CATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAA
CACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCA
TGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCA
TGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAAC
GGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGAC
GACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCA
AATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCA
GTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCT
GGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAG
CTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCT
GGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGG
CTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAA
AGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACT
TTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACG
CAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCT
CGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAG
CGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACAT
CAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGG
TCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATC
GATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGAC
GTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTAC
GAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTA
GAAGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCA
AAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTT
TGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTT
GTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTG
CCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAA
TTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGT
CCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGAT
GGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAAT
TTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACA
ATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAA
GAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGT
CGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGC
GACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTG
AAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATT
GGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGT
CGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATC
AGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTAT
TATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAA
CTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACA
GAATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCA
TGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAA
GTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGA
TCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGA
ACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTC
CACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAA
AGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTT
CAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTA
TCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCAT
TTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCA
ACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCG
TTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATA
TGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAA
GCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACG
TAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACG
ACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAA
GTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAAC
GAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATT
GGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGT
GATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAA
ATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGA
AAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCC
GTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACG
TCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCG
CAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTA
CAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGA
AAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCT
TCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGAT
TTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGA
GAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAA
CAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAA
CTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGA
TCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTT
TGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAAC
TGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAA
TACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATT
CAAACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCA
CAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGT
TGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATC
GGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATT
CACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAA
AATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCC
TTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCA
CGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCT
CGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGG
CCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAA
TTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGA
TATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATG
ACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAA
CTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAG
AGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGG
GAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAAT
TCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTT
GGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCC
TCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCT
TGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTT
CTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCA
TTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATC
CGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACG
ACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGG
AACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTC
GTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCA
AACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGT
CGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAG
GAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTAC
AAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGAT
CCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACA
GAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGA
AAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAAT
CTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAA
TTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTC
TTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTG
TTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAG
AAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAG
AAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTA
AATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATT
AGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCT
ACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATG
CTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCG
AATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTG
AAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAA
GCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAAT
GTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTC
ACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACA
CTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGC
GGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGA
ACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAAT
CCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGC
AAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAA
TTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTC
CAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCG
AGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGT
CTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAA
CTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAA
CCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAAT
TTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGG
AAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATG
TGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGA
AACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGC
AAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGA
GGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAG
GCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAAT
GTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGT
GGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACG
TCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAA
TAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGC
AAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATT
ACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCAT
CAACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCG
AACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACC
ACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCG
TCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAA
GAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGA
TTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATT
CTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTAT
GCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGG
CATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTC
CACTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCA
CCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCA
GCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTG
AGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTT
CACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAAT
TTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGG
GGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATC
ACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCA
AAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCT
GTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAAC
GAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGA
CTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAA
TTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAA
GTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGA
CGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCG
GTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCA
GCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAA
AGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACA
GAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCC
AACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGA
CAGCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACA
GAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGA
TTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACA
ACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATC
CAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCAT
TGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAG
GTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGA
TTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATA
TGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGAT
TTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGT
GGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAAT
TAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAAC
AGATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCT
TGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAA
TCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACG
TTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAG
CGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTC
GGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGG
GAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCA
GATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTA
TAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACAC
AACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAA
CAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCC
ATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGA
AGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGAT
TTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTT
TGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAG
ATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTT
TAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAAC
AAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTA
CAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGC
GAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAG
CATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACA
AAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAAC
GGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGC
TGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACG
ATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGA
AAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACG
TGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTC
TAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTA
GGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCA
TGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATT
AAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAA
CTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGT
TGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCT
CGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACA
ACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGG
CGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGT
CTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCA
CCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATC
TGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAAC
ACAACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCG
ACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGA
GAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTT
GGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACT
TGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTAT
GCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACA
ACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCA
GTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATG
CGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGA
AATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATA
ACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGC
GTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAA
TATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATT
GAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTA
ACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATA
TTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATG
TATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTA
TCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCA
CGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAA
TGGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAA
TGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGC
AAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCA
TTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCC
ATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCA
TATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAAT
TACATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAG
AATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACA
AGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTG
AACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACC
TGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCA
AGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCAC
AACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAG
AGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGA
CCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGG
GAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAAT
GGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGA
GCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAA
AGTACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCAT
CACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTC
ATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGA
TGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCA
GGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGC
CTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTC
AGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAG
CGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTC
CAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACT
AGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCA
AAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGT
TGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGT
ACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTC
ACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGAT
GTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGT
CACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGA
GTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGT
GTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTC
AACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAAC
GTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAA
CATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCA
ATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAAT
TTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCA
AATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAG
AAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACG
TTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAA
ATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCAC
GTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGC
AAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAA
TGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGA
TAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTG
TCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGC
TCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAA
GATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACG
CCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGG
TCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAA
TCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCA
TAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCG
GTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTT
GGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGG
ATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTA
CGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGA
CAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACA
TTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACT
ACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTC
CAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTC
GACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGA
ACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATG
CCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCT
CAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACA
GGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATT
CGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAA
AACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCA
CAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGA
GGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAAC
TGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGAC
GCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAA
AGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAA
GGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCT
CATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTT
CTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGA
CCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTA
AAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTG
GACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAA
GAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACT
TAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCA
GGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGAT
GAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAA
AGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCA
TTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATT
GACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGA
TATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAA
CAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATAT
GAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCA
TGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTG
AAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTAT
CGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACG
AAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGT
ATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTG
GATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACA
AATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGAC
GTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTC
ACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTG
TTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAG
AAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAA
AAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACT
TGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAA
GTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGT
CAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATA
GATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTG
GACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATT
CTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGG
ATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAAT
AACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGA
AATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAAT
TAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGAT
AATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAA
TGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGG
GAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGAT
GAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATC
TGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAAC
AAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTG
TCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATA
CAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTA
TCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCT
CGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATT
TAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTA
TCGACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCA
CACCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACAC
CACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGA
AAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAA
TCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGC
GCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAG
CAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGA
AGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCT
GAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAA
ACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTC
GAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATG
GAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGA
ACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGA
AACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATG
AAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAAT
CACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTAC
AAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACA
AAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAA
GCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTG
AATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAA
ACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTT
TGGATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGT
GTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGC
AGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAA
TTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAAC
GCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGA
GCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGG
AAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTG
CTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTT
GAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCG
AGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGG
ATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGA
ACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTG
GTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAG
TCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAG
ATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAA
ACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCA
ACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCT
CGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAA
TTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCA
TATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATT
TGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAA
TGGACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCA
ACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAA
CTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGAC
GCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGC
CAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATA
TCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTG
TCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGA
GCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGA
ATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGC
AAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGAC
AAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCA
GACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGG
TAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCC
AACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTT
GGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTAC
TGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCAT
GGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAA
CGGTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAA
AAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTT
AATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGG
CTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAA
TGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAA
GGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTT
GCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAA
AAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCA
ATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCC
GCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCT
CACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGC
TCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGAT
GGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAA
GTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAAT
CAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACAC
AAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGT
CGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGA
ATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGT
CACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAA
ATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTC
GACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACG
AGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATC
ACAAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCA
ACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCG
TGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCA
CCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTC
CATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGT
CACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGA
TCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTA
GTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACA
TGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGAT
ATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTC
AAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTA
TTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTT
CGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGA
CTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACC
TTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTT
TTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAA
TGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACG
ATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATT
ACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACA
AAAACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTT
ATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAAT
TGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAA
CGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAA
CAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAA
AGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAG
TGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAG
ATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATC
AGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATC
AACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCAC
TCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGG
AATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTG
GAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATC
GTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTC
GTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAAT
TCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATG
GTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGAT
TGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTC
TGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAG
ATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGC
AAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCA
ATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAG
TCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAA
GCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGAC
ATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGG
AGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAA
ATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATAC
TTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATT
TGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGC
TTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTG
ATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATT
GGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCAT
CCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCA
TGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAA
CATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAA
CCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAG
GAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATC
AAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGT
ACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACG
TTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTG
GCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAA
TGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGAC
CAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGAC
GCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGAC
TGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGA
ACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCC
AGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAA
ACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATA
GAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAA
CGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGAC
TTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAAT
GGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAA
CGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCA
GTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTA
TGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTG
GCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGAT
AAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAA
TAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGC
AACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCT
GAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGA
AACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGC
AACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGAT
GTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTT
TCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTA
CAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAG
AACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTG
AAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTC
GACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATC
AGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAA
CATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTC
AATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTT
ACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTG
GCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATA
TACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGG
TTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTAT
GGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCA
GCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATG
TGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAAT
TCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAA
GAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAA
TGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAG
GGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCT
GGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAA
TGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAA
GCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAA
CGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTT
GAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAA
ATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCA
GGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGA
AACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTA
GCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACG
ACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAG
AACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGAT
GAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCA
ATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTG
TGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAG
AAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGA
TTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTG
GAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGT
GTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAA
CAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCA
TGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACG
GACGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGA
TGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAG
TATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAA
CAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATC
CGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAG
CGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGAC
GATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAA
ACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCT
CACTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATC
CAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAAC
ACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAA
GTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTG
ACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTC
TCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAAC
TGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTC
ATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCG
AATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTG
CTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATG
TCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATAT
GATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAA
AGAACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATT
GAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATG
AGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTA
AAAGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACT
TCTAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCA
CGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATC
GAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAA
AGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGT
CAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGA
CACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATAT
CGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATC
ACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGA
TGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGA
AAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCG
AAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAA
AGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGG
AGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTG
GAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTT
CTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCG
AATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAA
GAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACC
TCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTC
CAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCAC
GATCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTC
CACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAAT
ATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCAT
GCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAAC
GTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACG
GAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAA
CAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGC
GTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTT
CAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCAT
TGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGT
TCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGAC
AATATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCC
ACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAAC
AGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATG
CTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGA
TTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGA
AGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCG
TAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCT
TGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAA
CAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAA
TTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACG
CTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCT
GCTGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACT
TCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAA
ACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAA
ATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAAC
TTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCA
TCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAA
ATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCA
AAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTC
CACTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGA
CATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCT
GAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAAC
ACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTT
TGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGC
TGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGC
TAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATA
TACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATT
TCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCAT
TTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACC
ATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAG
ACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAA
ATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAG
AAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTG
CAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTT
GACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAA
CAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCA
CCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCC
CAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTA
CGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCG
TCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGA
TGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCT
TCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCG
ACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTC
CGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGC
GAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAA
TCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGC
CGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAA
GATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGG
TCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGG
AGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTA
AACGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACAC
CTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATC
TTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATAC
AGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCAT
GGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAA
GAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAA
ACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAA
CCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGA
AACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTG
TTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAG
ATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAA
CTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGA
AATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCT
TCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCG
AACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAA
ATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAA
AGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGT
TAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTC
AAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAA
ATTCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTT
ATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTA
CCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCG
ACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAA
AGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGA
TGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAAC
CGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTG
AATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTC
GGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGAC
ATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCA
TTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTG
GTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATC
GAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGC
ACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTG
CAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGAT
TTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGA
GAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAA
GAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACA
ACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATC
AGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTC
AACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAG
GACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTT
TAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGAT
TCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGAT
TTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAG
ATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAA
CTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAA
CACTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACG
TCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACT
CGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGC
GTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAA
AACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAA
ACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACG
ACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAAC
AAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAA
GTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTA
TCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTC
GAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAAT
GGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACAC
GTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCT
GAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGAT
CGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGC
TTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAA
GAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATC
TTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTG
ATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTC
GATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCA
CAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATG
ATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGAT
CGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAA
ATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGAC
ATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGG
ATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACT
AAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCT
CAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACC
TCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCT
GAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCAT
GAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACG
TCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTT
TTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGA
AAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCAC
TAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATG
CATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCT
GGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAG
TTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGA
GAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGA
TCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCA
AAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACC
ACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCG
GGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGC
TCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAG
GTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAA
ATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAG
CCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTC
TTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCC
TGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATT
GAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATT
GTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTAT
TGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCA
CCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACT
TTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACAT
ATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGC
TCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCA
GATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAA
GAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAA
GTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCAT
TGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAA
CTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTG
GAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTT
ACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCG
ATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACA
ACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATG
ACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGA
CTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGC
TGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGC
GTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGAT
GATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATT
GAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTG
AGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAA
AAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCA
ACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGG
CTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAA
TCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGAT
ACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCAC
TTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCT
TCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAAC
GCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATG
AAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTG
AGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAAC
TGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAG
AAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCG
ATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGG
CAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGA
AATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAA
GGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGT
GAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATT
TGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTA
GGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATG
CGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCG
AGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAA
TTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGT
CATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAG
AAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGA
TTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACC
AACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGAT
GAAGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGA
GCATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCA
CCACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTC
TGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACG
AATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATG
GAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCT
ACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGC
AACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACA
TGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACG
TCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTA
CTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTC
AATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGA
GAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTA
AAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAG
ACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGA
TGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATG
CAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAAC
CTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAG
CCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACA
CAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGC
AACAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAA
ACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGAT
ATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCA
AATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAG
CAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAA
ACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGA
ACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGG
TGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTT
GTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTA
TATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAA
CCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAA
GAAATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAA
ACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGT
TGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGT
GTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGT
AACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGA
ATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTG
GGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGA
AGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAA
GAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCA
GATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCG
AATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGT
GAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACA
ACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGA
CAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTG
GAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCAT
GATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTG
GAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAA
ATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGT
GTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCC
GTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAA
CGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAG
GAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACA
TGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGT
GACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGG
ATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGT
TGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAAT
CAGAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAG
AGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCT
ATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCC
ACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCA
CTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGA
TGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGT
TCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTT
AACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGT
GGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCAC
TATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAA
AGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGAT
GAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATT
CAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTA
ACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAA
TGGATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAA
TCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGA
AGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACG
GACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCG
AAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCT
AGAAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTC
TCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCA
TCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACA
CCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATG
GTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATG
TGTCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGG
AACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGA
CGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAA
TCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGT
GCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGG
ACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCT
TAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGG
ACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCT
AGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAG
AGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTT
GATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCA
GACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCG
ACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCG
TCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCA
AGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTC
GATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGA
TACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGT
TAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGA
GTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGA
AGATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAA
GATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTG
CCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGT
CAAAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCC
ATATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATT
TGATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCC
TATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGG
AAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTT
GATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAAT
CTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGA
AATAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCG
CCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGA
CGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAA
ACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGG
TCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCG
CAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAG
CCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTA
TTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACT
CATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGA
ATAAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATG
TTTAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGT
CGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATC
GTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAAC
GCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCA
CAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAG
TTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCA
AACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATC
AACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTT
TGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAAC
GAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTT
ACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATG
CAATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGC
ACAACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTA
AAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGAC
GAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGT
CTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGA
ACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGG
TTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGA
TGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAAT
CATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAA
GACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGT
TGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTC
TTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCA
GAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACA
AACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAA
GCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTC
CTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTT
ATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGA
AATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACA
GATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACT
TGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATC
TGACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTG
TTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTG
GTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATA
CAGGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCA
AACTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACA
GACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTG
GAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGG
TGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCA
CTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAA
TGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTT
CGGTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACG
CCTGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCG
ATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCC
CGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATT
GACCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATA
TTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGAC
GAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACT
TTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAG
CGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGA
ACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTC
CAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGG
AAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTC
AATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTG
TTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCT
ACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATT
GAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCG
TGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGAC
AAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAA
CAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGT
TGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAA
CAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCG
CATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGA
ACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAA
GTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCC
TAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGA
AATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAA
ACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCT
AGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATT
AGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTT
CAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTT
TCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAA
AGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAA
GAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAA
TGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAG
TTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTAC
CAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCT
TAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAA
TGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAA
ATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGC
GGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGT
CGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCAC
GAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACT
GAAACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGG
ATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAAC
GAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCC
ATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAA
AACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATT
GCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCA
AGAAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAG
AAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCT
ACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACT
CGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACC
TCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTT
GCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAA
AGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTG
CTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAA
CATCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAA
AACATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGG
ATGACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGC
GTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGT
TTGTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGG
AAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTC
ATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATA
AACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAA
GCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTAC
ACGACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCA
ACGCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAA
CAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCAC
TTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTC
AAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGA
AGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATT
ATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCT
TTAATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGC
TGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCA
TCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCA
CTATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACC
AGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGC
GTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAG
GCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCA
CTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTT
CAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGG
ATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCAC
AACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAA
GACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGT
CAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGA
ACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACT
AGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATT
CAAATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGT
CTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACG
GAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGT
CGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGC
TTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAG
AAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGA
GATTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAA
CAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACA
GCACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGA
ACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATT
TAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAAC
GCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCA
AAACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTG
CTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGT
TTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATT
GGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATG
GGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTT
GGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGG
TTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTA
GCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAG
ATTACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTG
CAAACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATC
GGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTT
TCAGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCG
TATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGG
GAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGA
AAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGA
TAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATA
ATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAA
CTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACA
ATTTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCAT
TATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAG
GGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTT
TCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTG
CAAAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGAT
ACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTA
GCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAA
ACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACA
ATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGA
GGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCA
TCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAA
ATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGG
TAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTG
TTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGAT
CAGACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAA
AAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTG
AACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTA
ACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGG
GCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATG
TGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAA
ATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACT
CATTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTG
ATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCG
TATGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAAC
GCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCG
ACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCT
TGAAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACC
CCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTG
ATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACAC
AACGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGAC
TCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGA
AACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGG
TTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTG
CTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGC
ATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAAC
TTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGT
ATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCG
GTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAA
TGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAAC
ACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGT
CCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATA
TCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGA
ACTTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAAC
GATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATT
CGAAAGTATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTA
TCGATATGACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATC
GGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACG
TGCTAAACTAGAAGATAAATGGAAATTCATACCACAAAAACGACACAATG
GGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATG
ACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAA
AAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACGTGGACAAGCATT
GAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACAAACGCAATCCAT
GGAAACACAATTTGATTCGATGGATGGAACAGTCAAAGAATTACGTCATA
TCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTGATCGACCAATTA
CATGACAGATGGAAACATTTGTTGAATGATTGCCAGATTCGACAGGAGAA
TTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAG
CTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTGAA
CGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACCTG
TTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAG
CTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAA
CTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAG
GAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACC
CACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGA
GAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGTACTGGTGAATGG
CGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGC
TGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAG
TACAACAACAGAATAAACACCATCAGGAACTCGAAGATGACATTGCATCA
CATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAAATTCTCAT
GGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATG
ATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGG
GATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCT
CTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAG
CAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCG
GAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGAAATTCCA
AGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAG
CTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAA
ACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGTTG
ATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTAC
AAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCACTACCGTCAC
CGAACTAGAAGCACAACTTGATAAACACAAGTCCATCCAATTGGAGATGT
CAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCA
CCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGT
ATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGT
ATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAA
CTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGT
TACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACA
TCATGAAGAAATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAAT
GACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTT
CCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAA
TCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAA
GTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTT
TGATTCGTTACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAAT
ACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAACAACCTAGCACGT
GCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAA
GACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAACCGGGATATAATG
TCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATA
GGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTC
CGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTC
AAGTACAAGATCTGACCACAGGACATAATCCCTAATGGATGACCCAAAGA
TCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCC
ATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTC
ACTACAAAAATACAGGGATGACCTCAAGGACCTCTATGATGAGATCAATC
GCAATGAATTCAAACTGAATAACCTCAATAATACTGGCACGACGCTCATA
GCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGT
AAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGG
GATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGAT
GATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACG
AGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAACCCGTATGGACA
GTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAACAAGCATACATT
AACCAAACCACGCCTGAAGAAATGCATAATATTGATGTTCATCTCACTAC
CATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCA
GATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACAATGGTTATTCGA
CACTTTGAAATTGACCTCATATGAGAACAAGATGAGAACAGTTGAAGAAC
TTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAAGAAATTCATGCC
GTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCA
ACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAGCGTCGAGACAGG
AGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCG
GCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAA
CGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACA
ACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGG
GTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTG
TCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGC
AGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAG
AAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGG
TGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCA
TCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGGTTTCT
TACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACC
AACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATGACAGATGCTAAA
GAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGGACCCATTTTGGA
CCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGA
AAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATGAAGAATGACTTA
ACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGG
AGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGA
GATGATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAG
CTAACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTCATT
CTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGA
CTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATA
TTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACA
AATGTTTCTGTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGA
ACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAACAAGAAATCATG
AGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAA
ATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCG
GCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAA
AGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTAT
TGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATTTGAACACGTGGA
TCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAA
TGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGTCATTGAAGACGT
CACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCGTCAC
TCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTT
CGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACGAGAA
ATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAGAAAA
AGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTATATGCTCACTTG
GACACACTGAACGAATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGT
ATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCA
AGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGA
TTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGA
CAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAACTACAACAATTCT
TGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGAT
CTCATCACGTCTACACGTCACTCGATACAAGAAATCCAAAGTGCCAATAA
CCAATCGAAACTCGACCAACTCGGCAATCTCTCAACACAGATTGAAGAAA
TCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTA
GAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAA
TCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATG
ATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGA
GAAATGAAGAAACATCAACAGCTAGGCGATGACGTCATTCGAATTGATGA
ATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAATCGATGGATCTG
TCGACCTCGAGGATGACTACATCGAGAGTATACCTGCTATTAGCGAACAA
ATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTCAACGAGAGTGTC
CAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGATTGATGAATACA
AGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATC
GAAATTGACGTCATTCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCG
AGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAGATTGTCAATTTA
ACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAAAGAATGTTTATC
GACATACATTACACGACTTGAAGAGCATGATCAACTTCTAACATCTCACA
CCAACACCATCAACGCCCTGATCACCACCACCTCCACGCCAACAACACCA
CCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGAAAAAACACGAAA
AACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATC
GACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCAAATTGACAGCGC
TATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCA
AAAAGCAAGATTATCAGGCATTGCAACAGGATATATCGACGGTGGAGAAG
AAAGTGGATTCTTTAATCGAAACATGTACCTTGATCACCAACAGAGCTGA
AGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATGGGCTGAAGAAAC
GTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGA
AATGCGGGTCCACTATCACTACTCAATAAACAATCGAAACTTCTTATGGA
GACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAGATGTATCAGAAC
TTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAGGCACGATTGAAA
CGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGAAACGGCAATGAA
GGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCTTGGAAGAAATCA
CTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAATCACAAGTACAA
GAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAA
GCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGC
AATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAA
TGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGATCGGTGATAAAC
ACAGACAAACGAACGATCGGATAAACAGTACTCCTCCACAGGAGTTTTTG
GATAAAATGACTAGTATTAAGGATATTGTCAATAATATTTTCCCTTGTGT
CAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGCAGACATTGGCAG
ACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGTCGCGATTCAATT
ATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGAAAGCAAAAACGC
CGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACAATTTTCAAGAGC
GTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAA
GACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCT
GGTCATAACAGAGATTACCACTTATATTGAAGTCATTGTCATTGATTTGA
AAAATAACCCAACAGAATTGCTAACCATACTCGAGTTCCGAAGTATCGAG
AACAACTTGACAGCACTACTCAAAGAAATCGATGACAATATAGAATGGAT
CACAGATACAGAACTCTTACTTAAACCTTCATCGCCACCAGATCGCGAAC
TAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAGAATTCTTTTGGT
GATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTC
ACCAGCCATCCAAAACATACAAGTAACAATGGAAGATTTCAATAAGAGAT
GGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAGCATATGGGAAAC
TCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTAACCAAGAGCAAC
GATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCG
CTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACAAATACAAAAATT
AAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATTCATTAAGTCATA
TGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCTACAGCTGATTTG
GAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGCTGTATGTAAATG
GACTGGTAACAGATTACATCAACAACTGATGAAACTTCAACAACTCCAAC
TCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAACATCATCGAAACT
ACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGC
TCACAAGACGTTTCAGGAATTCATGATGATTTTAACTTCACATCAAGCCA
GTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATC
GTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTC
CGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGC
TAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAAT
GGGACGATTATAATGAGACGCTAACGCAAGTCTTGACATGGCTCATGCAA
GCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGAAAATGTGGACAA
AGTCAAAGAACAATTTAGAGAACATGAGATGTGAACACGGACCATCCAGA
CAAGAAATCCATTATAATGTATGTGACCACGCTTTTTGAGACGCTGGGTA
AAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTGGATCAGACCCAA
CTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGG
CACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATACCACCATTACTG
GAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTCACTAGCTCATGG
AGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTTCAAGTGAAAACG
GTGATCCAACAAACACTCCATGCCACAGATTCCACCATGGAGGTGGAAAA
GACCTTATTACAATGGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAA
TATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAATTGATTCTTGGCT
TAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATG
CGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGG
GTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGACATTCGATTTGC
AGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACAACAGGAAAAAAA
ATCATGAACGATCAGACACCCAAAAGAAGACCTTCACCAGATGGATCAAT
CATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCAAGATCTTTCCGC
CCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCA
CCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTC
GCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGG
ATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGT
TATGAGGATTAAATCTCTAATGGAAGAATACACCCGACTGAAGGGAATCA
AACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATACACAA
GACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCG
TTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTAGAAT
CTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCA
CAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAAT
GATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTCACCACGATTCGA
CAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAG
GAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCAC
AAACAATAACACAACGGCCAACGGAACCAACGACACCTGATCTATCCAAC
TTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTTTCCGATTTCGTG
AAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACC
AAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCA
TTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCA
CTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAACAACTCAGCGATC
GATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGT
CTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATG
ACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATAT
CGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAA
ATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATT
ACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCG
GTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACT
TGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAACAACACAACCTT
CGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAATCATCAACGTTTT
ATCGACCATATTCGAAAGTATCGATACGAATCGTAAAGAATCGATAAATG
TCTCACAATGTATCGATATGACGTTAAACTGGTTGTTAAACGTTTACGAT
AGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAAAGCGGCCATTAC
TTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAATTCATACCACAAA
AACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTAT
CGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTG
AGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGACACCATGGGAACG
TGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAGAATGCAAGAACA
AACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAAG
AATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGTG
ATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGAT
TCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCAG
TTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAA
CAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTC
AAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGAA
TTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGA
ACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGT
TCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGT
GAGCAACTGACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTC
GGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGAATGTCATATGGT
ACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTG
GTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTG
ATGTCGAGAAAGTACAACAACAGAATAAACACCATCAGGAACTCGAAGAT
GACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAA
ACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAAT
CAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTC
GTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTCATTACAAGAAGC
ATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACAT
GGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAG
TCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAAT
GCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTT
TACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTG
AACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTT
GGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGAT
AATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGG
CACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGTCCATCC
AATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATG
GCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACA
TTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACC
AAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGA
GAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAA
AAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTAC
AAAAACAAAACATCATGAAGAAATCATTAGAAACACGTAAATGCAACGTT
CTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGAAGGGGAGCTGGC
GTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCGGACAACTAAATG
TCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTTAAAGAACGACCA
GTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGAACGTCAAGACGC
TCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTTTCACAACGACTG
AAACTTCAAAATACAAATATGAAAGCAAACGATTTGATGTTGTTGAGAAC
AACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTTCCAG
TTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAACAAAC
CGGGATATAATGTCGACCCTGAGAAATGTGAAAATGATTTGACCGATAGA
AGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACG
TCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTT
CCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAATCCCTAATGG
ATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGATCAAATCAAAACG
CAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAAACCACATCCAGT
GGATGCTGGGTCACTACAAAAATACAGGGATGACCTCAAGGACCTCTATG
ATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGC
ACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAA
ATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATA
GCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAA
CAGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGA
AAACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGAAATGGAAA
CCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGTGCAA
CAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTGATGT
TCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAGTTTC
GTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTTCACAGAAGTACA
ATGGTTATTCGACACTTTGAAATTGACCTCATATGAGAACAAGATGAGAA
CAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATCAGAGAAATTGAA
GAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAAGAAACCGTTCGA
CCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCACCTACAAAATCAG
CGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAACA
TCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTCAA
TCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTTAC
GTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAATTACGCGTCTGGC
ATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATATA
CTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGGTT
GAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTATGG
CCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGAAAGATACGCAGC
CGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTG
CCGATTCTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTC
AAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGA
AACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTGAAAGTTTAATG
ACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATCGAAAAGAAGGG
ACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCACGCCAGTCTGG
CGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGATATTTCAAAATG
AAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAGACCGAGAAAGC
GTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGTGAGCGTCGAACG
TGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAACGATGTTGA
AAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAGAAGAAAAT
GCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGAAGTCCACGCAGG
CGTTGATATTGACTTCGACCAATTAGATTCTGGCTTACCCCAACCCGAAA
CTAAAACCGATATTTCGATTTCTTCAACTCCTACCGATGTCATCATTAGC
AAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAACGACAACGACGAC
TAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGACAAAGAAAAAGAA
CAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACTGGTTGCCGATGA
AGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTAGATCAAT
TGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAGTGTTGTG
GAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGGAGAAGAA
ACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGGTTGACGATT
TGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAGAGCATCGGTGGA
GTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGAGTGT
CATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACA
ATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATG
GAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGA
CGGCGACGAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATG
AATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTTTCTGAATCAGTA
TATGCTCACTTGGACACACTGAACGAATGGTTGTCTTCAACGGTCGAACA
ATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGCCTGAAGAATCCG
TCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAAGAAATTAAAGCG
AATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAGTGGGCGAGACGA
TCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTGAATATGAAAAAC
TACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAAGAGAGTATCTCA
CTAAACGAGGATCTCATCACGTCTACACGTCACTCGATACAAGAAATCCA
AAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCAATCTCTCAACAC
AGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAATCTCAACCAAGT
CGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGGGTCCGTTTTGAC
TGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGAAACTATCTTCTC
CTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTGGAGGTTCAACTG
ATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGGCGATGACGTCAT
TCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCGTACTTGATCGAA
TCGATGGATCTGTCGACCTCGAGGATGACTACATCGAGAGTATACCTGCT
ATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATTCGATGAAATGTC
AACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCATTTTGGATATGA
TTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAAGGCTGTAAAAAG
AACCAATCTATCGAAATTGACGTCATTCAACACAGATTTAGAAGAATTGA
AAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAACTAAAAAATGAG
ATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGAAGAAATATTAAA
AGAATGTTTATCGACATACATTACACGACTTGAAGAGCATGATCAACTTC
TAACATCTCACACCAACACCATCAACGCCCTGATCACCACCACCTCCACG
CCAACAACACCACCGCCTACCGAACAACCACCCGTCTGTATTGAAATCGA
AAAAACACGAAAAACTATAACCACTTTGAGAGGACGAATCGAGTGAAAAG
TTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGAATCTCTTGGTCA
AATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTACTTAAACAAGACA
CGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAACAGGATATATCG
ACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATGTACCTTGATCAC
CAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTCAGAGCTTGGATG
GGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACTGAAAAACAGAAA
GAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAATAAACAATCGAA
ACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGAAATGCCAGAAAG
ATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAAAAGATCACGGAG
GCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGACTGAGGAACTGGA
AACGGCAATGAAGGAGACTGTTCACTGGATGGATGATGTTGATCGTTTCT
TGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCAGAAACCATCGAA
TCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCTACAAGAACAAGA
AGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCCCTAGCTAACCTC
TTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACAAGCAGCTTTCCA
ATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAACAGAGAGCACGA
TCGGTGATAAACACAGACAAACGAACGATCGGATAAACAGTACTCCTCCA
CAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATATTGTCAATAATAT
TTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAATCAAAAGCATGC
AGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCAATCAAGAAACGT
CGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAACACTGATGACGGA
AAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAACAACAATTAAACA
ATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTGGCCGAAAAGCGT
GACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGTAGAGCAAGTTCA
AAAAATCTTGCTGGTCATAACAGAGATTACCACTTATATTGAAGTCATTG
TCATTGATTTGAAAAATAACCCAACAGAATTGCTAACCATACTCGAGTTC
CGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGAAATCGATGACAA
TATAGAATGGATCACAGATACAGAACTCTTACTTAAACCTTCATCGCCAC
CAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTGACACAGCAACAG
AATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGTTGCACAAATGCT
TGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAACAATGGAAGATT
TCAATAAGAGATGGAATACCATTGCTAGCATGCTGAATGCCAAAATGAAG
CATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGGAACAATACCGTA
ACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAGGAGAAAGGCTTG
AAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGAAGTGCAAAAACA
AATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGATCCACGTCAATT
CATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAATCTGAAAACGCT
ACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGAACGATGGTCTGC
TGTATGTAAATGGACTGGTAACAGATTACATCAACAACTGATGAAACTTC
AACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACAACAGCTGAAAAC
ATCATCGAAACTACGGGACCAATCGGATCAGATCTGGAAAGCGTTAAAAT
TCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGATGATTTTAACTT
CACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGAAGTCAGCTCATC
AACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAATTAGGGAACAAAT
GTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGTCCGCTATGCAAA
GACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGTCGTCCGTCTCCA
CTATGTCAGAATGGGACGATTATAATGAGACGCTAACGCAAGTCTTGACA
TGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGAACCTGTCTCTGA
AAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATGAGATGTGAACAC
GGACCATCCAGACAAGAAATCCATTATAATGTATGTGACCACGCTTTTTG
AGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGATGGATCTGAGCTG
GATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTGGCAAGCCGGCTA
GTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCAGAATTCAATATA
CCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAGATCAAGAATTTC
ACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTATTCTTCATCATTT
CAAGTGAAAACGGTGATCCAACAAACACTCCATGCCACAGATTCCACCAT
GGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACTCTGTTCACAGAC
AAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATGGTAACATCAAAT
TGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTCCAGAAACAAGAA
AATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAACAGAGCATTGCA
AGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGGTTAGGGACTTGA
CATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTATTGGAATCAACA
ACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAGAAGACCTTCACC
AGATGGATCAATCATATTTTGAAAAAAATGATGGATGAAAATAGCTCCCA
AGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACG
AATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTC
TTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATG
AGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTC
CCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAGAATACACCCGAC
TGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCG
GAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGA
ACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATC
GACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCG
AAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGA
TATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAAATGAACGGTC
ACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAG
ATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAA
CGGTGAAATCACAAACAATAACACAACGGCCAACGGAACCAACGACACCT
GATCTATCCAACTTCACTTTCGACTCGGCACGACGACGGGTGAAGATCTT
TCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATCTCGAAGATACAG
GAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGCAGACCATCATGG
AAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGACGTGTCTCGAAGA
GTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGGCTAAAAAC
AACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACGCCGAACC
ACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAA
CTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTT
GGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTTGTCAGAT
TTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAGCAAAAAACT
TGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAA
TCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTC
GAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCATTCGAA
CAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGGAGAAAT
CATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATCGTAAAG
AATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGGTTGTTA
AACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATCATTCAA
AGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAATGGAAAT
TCATACCACAAAAACGACACAATGGGATCACCCAAAGATGACGGAGTTAT
ATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACC
TCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCAAAGCGTACCGAC
ACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAAAG
AATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATG
GAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCG
ACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAA
TGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGG
ATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCTGTTGGAGGACAT
CGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATT
GGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGT
GATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTCATCGA
ACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATCTGCAC
AAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCGTTGCA
AGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTCGATTT
ACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATTAGAGA
ATGTCATATGGTACTGGTGAATGGCGCCAATTATTATTGGACATGCAAGA
GATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCATGTCTCAACAAC
CAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAATAAACACCATCAG
GAACTCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAA
CGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGA
CAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTA
GGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGCGCACCAAGATTC
ATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTT
CAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGAT
TCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACT
ACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAACTTGGGCCAACA
CTTACAATACTTTACGACAACTAGCTGAAACCATTTTGTCGACGTACGTC
AACGAGGATTTGAACGACTTCAAAACGACTGTCAACGAGACCAATACTCG
GTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTACAACGAGTTGCGT
TTACAACTTGATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAA
CCAACAGATTGGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAAC
ACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGAC
GCTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAA
GTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGT
CACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAACGAGAACAGTATC
GGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGA
ACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGG
CGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCATTAGAAACACGT
AAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAGCTGA
AGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAGATCG
GACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGCGCTT
AAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTCAAGA
ACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTATCTT
TCACAACGACTGAAACTTCAAAATACAAATATGAAAGCAAACGATTTGAT
GTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGA
TGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACA
AGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAATGTGAAAATGAT
TTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCG
ATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAAT
CACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACAT
AATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAATCGGAT
CAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCATACTAA
ACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGACCTCA
AGGACCTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTC
AATAATACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGA
GCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGA
GTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTGGAGAAGAACGTC
GGTGAATGGCAACAGTTTACGGATGATTGTAATTCACTCATGCTATTTTT
AACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATGATGATGTTGAAA
AGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTA
ATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCA
TAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGG
ATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCGTAAACACAAGTT
CACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAGA
ACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGATC
AGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTCAAA
GAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAAAACCAC
CTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGG
CTAGTGTCAACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTC
CAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGT
GGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAAAACTTTCCAAAT
TACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCC
AGTATTTATATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTT
CGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTG
TTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGAAGAAAACATTGA
AAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTGCTGAACAATTGT
CAGACATATGTGCCGATTCTCTCATCCCCAAACGACAAATCTCATTATTG
AACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACAAGTACAAGCACC
AGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTT
GAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATAT
CGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTC
ACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGA
TATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGA
GACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGT
GAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTG
AAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACT
ACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAGTCGTGTGGTGGA
AGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCTGGCTTAC
CCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCCTACCGAT
GTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGGTAACAAC
GACAACGACGACTAAACGATATGAACGAGAAGAGAAAGGAGTTTGATGAC
AAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAACGACT
GGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTG
ACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGT
TCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGA
TCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGA
AGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCTTGAG
AGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAA
ATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCAAC
AGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGGCT
TTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAATC
GCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGATAC
AACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGATGCGCTACCACTT
TCTGAATCAGTATATGCTCACTTGGACACACTGAACGAATGGTTGTCTTC
AACGGTCGAACAATTAGAACAAGTATCCACCAATCCATTGCCTTCAACGC
CTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAACAGTGTGATGAA
GAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGCAAAAGAGCTGAG
TGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAGAAGTTAAAACTG
AATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAAAAGGGTCTAGAA
GAGAGTATCTCACTAAACGAGGATCTCATCACGTCTACACGTCACTCGAT
ACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCGACCAACTCGGCA
ATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTCGAGAAATTGAAA
TCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGCGGCCCTCGAAGG
GTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAGCAAAGAAAGTGA
AACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCTGTTGAGAATTTG
GAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACATCAACAGCTAGG
CGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAACATCGAAATGCG
TACTTGATCGAATCGATGGATCTGTCGACCTCGAGGATGACTACATCGAG
AGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGTTTTCAAACAATT
CGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTTGTAATCAAGTCA
TTTTGGATATGATTGATGAATACAAGTCACGAGTGGAAGGCATCAGAGAA
GGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCATTCAACACAGATT
TAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAACTTGCCGACCAA
CTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGCCGGAGCTGATGA
AGAAATATTAAAAGAATGTTTATCGACATACATTACACGACTTGAAGAGC
ATGATCAACTTCTAACATCTCACACCAACACCATCAACGCCCTGATCACC
ACCACCTCCACGCCAACAACACCACCGCCTACCGAACAACCACCCGTCTG
TATTGAAATCGAAAAAACACGAAAAACTATAACCACTTTGAGAGGACGAA
TCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAAAAAGATTATGGA
ATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAGACTTTAGTCTAC
TTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTATCAGGCATTGCAA
CAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTTAATCGAAACATG
TACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTGAACAATTACGTC
AGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATCATCGATAGTACT
GAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACTATCACTACTCAA
TAAACAATCGAAACTTCTTATGGAGACATTGTCACCAGAAAATGCAGAGA
AATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGTGCAGACTGTAAA
AAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGCTATTTTACAGAC
TGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACTGGATGGATGATG
TTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCAGAAGGTGATGCA
GAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGATGGTCAAGAACCT
ACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAACACAAGGCAGCC
CTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGACCCAGCCACACA
AGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCAAACTCTCCGCAA
CAGAGAGCACGATCGGTGATAAACACAGACAAACGAACGATCGGATAAAC
AGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAGTATTAAGGATAT
TGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCAAATACGATCAAA
TCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCTCTTGACCAAGCA
ATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGAGCAAGGCGAAAC
ACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCGTCGGCCTCGAAC
AACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTTTCCCGCACGGTG
GCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAAGAAGGTATTTGT
AGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGATTACCACTTATA
TTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACAGAATTGCTAACC
ATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGCACTACTCAAAGA
AATCGATGACAATATAGAATGGATCACAGATACAGAACTCTTACTTAAAC
CTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTAGAGAACGAGTTG
ACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGCTGCCCAGGGTGT
TGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAAACATACAAGTAA
CAATGGAAGATTTCAATAAGAGATGGAATACCATTGCTAGCATGCTGAAT
GCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTTTAAAAAGTTGGG
AACAATACCGTAACCAAGAGCAACGATTGAACGATTGGTTGTATGAGAAG
GAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGGCGACAAAGAAGA
AGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGGAGAACCAGCAGA
TCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTTGACGAATCCGAA
TCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGCTTTACTTGGTGA
ACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGATTACATCAACAAC
TGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCAAACTGGCTGACA
ACAGCTGAAAACATCATCGAAACTACGGGACCAATCGGATCAGATCTGGA
AAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTCAGGAATTCATGA
TGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTATTGGAGTTTGGA
AGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGAGGAGCGTGAAAT
TAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAAATCTTCGAGTGT
CCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATAGCCCGACTCCGT
CGTCCGTCTCCACTATGTCAGAATGGGACGATTATAATGAGACGCTAACG
CAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACTCAAACAACAGGA
ACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAATTTAGAGAACATG
AGATGTGAACACGGACCATCCAGACAAGAAATCCATTATAATGTATGTGA
CCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGGGCTGAATCGGAT
GGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTCAAAAGTTAGTTG
GCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCAAAAGCTCAATCA
GAATTCAATATACCACCATTACTGGAGCCTGAAGATACAAAGATGTAGAG
ATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGCTTTCAATGCTAT
TCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAACACTCCATGCCAC
AGATTCCACCATGGAGGTGGAAAAGACCTTATTACAATGGTGTGCGCACT
CTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGGAGATTGTGGATG
GTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATCATCCTACAGTTC
CAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAATTAGCAATGTTAA
CAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTAAAAACATTGTGG
TTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTTTTATTGGCACTA
TTGGAATCAACAACAGGAAAAAAAATCATGAACGATCAGACACCCAAAAG
AAGACCTTCACCAGATGGATCAATCATATTTTGAAAAAAATGATGGATGA
AAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAACGACATAATTCA
AGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAAC
GCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATG
GATATTCAGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATC
GAACACGCCTTCCCAACATCAAGTTATGAGGATTAAATCTCTAATGGAAG
AATACACCCGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGA
CAAATCGTTCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAA
GAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAG
AAGACCATAATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTC
TTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATC
ACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACC
AAATGAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGT
AACGATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTG
TCAATCATTAAACGGTGAAATCACAAACAATAACACAACGGCCAACGGAA
CCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCACGACGACG
GGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAATC
TCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTGC
AGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCTTCTGGTCTGGAC
GTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTA
GCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGAC
GAACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAG
CGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAG
TACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGA
TCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGA
CAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGAC
AACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTC
AGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAACTTAAACATCAAG
AAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGA
TGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATA
CGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTA
AACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGT
TTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAG
ATAAATGGAAATTCATACCACAAAAACGACACAATGGGATCACCCAAAGA
TGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTGCC
GCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGTCA
AAGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCAT
ATTTCATCAAAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTG
ATTCGATGGATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTA
TTGGCTAAACCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAA
ACATTTGTTGAATGATTGCCAGATTCGACAGGAGAATTTGCAAAATTTGA
TGTCTGGTTCGGATGCAGGATCAGTTATGTTACAAGCTGGTGAACAATCT
GTTGGAGGACATCGAAAAGATCAACAAAACTTTGAACGAATCTGAAGAAA
TAGTGAACCATTGGGTACTCACTCAAGATATACCTGTTGATAGTGTCGCC
TCTTATCTTGGTGATACAAGGGAATTCAAAGGCAAGCTGAACGCGCGACG
TGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAAC
ATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTC
GTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCA
ATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCC
TTGTATTAGAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTATT
GGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACTCA
TGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGAAT
AAACACCATCAGGAACTCGAAGATGACATTGCATCACATCAAGCCATGTT
TAACGGACTCAACGAAACTGGCAAACAAATTCTCATGGATCTTGAAGTCG
GCGAAGTAAGGACAGCTCTCCAATCAAAGTTGGATGATATGAATGATCGT
TGGAATAGTTTAGGTGTTCGAGTCGTCGATATCAGGGATAGCTCGAACGC
GCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAATTCCACA
AGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCGAAAGTT
GCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATACTTCAAA
CGTGGATGAACTACAAGGTGAAATGCAGAAATTCCAAGGCGAATTATCAA
CTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACCATTTTG
TCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGTCAACGA
GACCAATACTCGGTGGAATAGCTTGGAAACTCGTTGATTGGCGTCGTTAC
AACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCTGATATGCA
ATTGAACGAAAACCAACAGATTGGCACTACCGTCACCGAACTAGAAGCAC
AACTTGATAAACACAAGTCCATCCAATTGGAGATGTCAAACCGACGTAAA
GAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACGACGA
AAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCT
TGAACAAGAAGTCACTTATTAACCAAGCTCTGGTGTATTCTTCAACGAAC
GAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTT
GAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATG
AAGATGAAATGGCGGCTGCCGTACAAAAACAAAACATCATGAAGAAATCA
TTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGA
CTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTG
GCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTT
GCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGA
GACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAA
CCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAGC
AAACGATTTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCT
TGATGAACTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTAT
TGGAAGGCCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGAAA
TGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGACGTTTAACAGA
TGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCCAACCAACTTG
ATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGTACAAGATCTG
ACCACAGGACATAATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTT
AATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGT
CTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACA
GGGATGACCTCAAGGACCTCTATGATGAGATCAATCGCAATGAATTCAAA
CTGAATAACCTCAATAATACTGGCACGACGCTCATAGCCTTGTCCACAGA
CTCAAATGCTGAGCTGAAAGATAAATTGGAATCGGTAAACAGACGTTGGA
AAGAAATCATGAGTGGATTGAATAGCAGGAAGTTGGGATACGTATCGGTG
GAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATTCACT
CATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAAAATG
ATGATGTTGAAAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCG
GTGACGTCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCC
TGAAGAAATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGAT
GGAATGCGCTGGATAAAGAGTTTCGTCACAGCTCCAGATATCTTGGCCCG
TAAACACAAGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGA
CCTCATATGAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATT
CAAGATGTGATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGA
GTGCTTCTCAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTT
TAAAAAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGTCGAGAGCG
CTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAATACGGGAAC
AGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAAAAATTCCA
ACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATGGCTTGGAA
AACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAAACCCTCAA
TGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGACGCTTGTT
TTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGCCGTTCTAC
GTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTGTTCATTGA
AGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTTAACATCCGTG
CTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCCCAAACGACAA
ATCTCATTATTGAACAAAAAATTCAAATTGGTTTCTTACCAGTTGGAACA
AGTACAAGCACCAGAAGAAAAAGAAACTGGAAGACCAACTCAACTCGTTG
CAACCCGACTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACA
GTTAGGACATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCA
TGAGTGGTGCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAAC
GCAGATTCCAGATATTTCAAAATGAAGAATGACTTAACAAACGTACAAGT
TTGGTTGGAAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTA
ATAAAATGAAGTGAGCGTCGAACGTGACTTGGATGAGATGATCACAGAAA
TCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAACGATGAAAAC
GAATTCAAAACTACAGAAGAAAATGCACAGGTCATTCTAACACAATCTAG
TCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAG
ATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCA
ACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTC
TGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAG
GAGTTTGATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGA
AAAGAAACGACTGGTTGCCGATGAAGAGAGCTTGAAATCCATGGTAAATG
CAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAATTAGTT
CAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATCTACCA
ACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCATGCTTA
AATTGAAATTGAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATG
AGCATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAAT
GGAAACACAAAAATTCGAGAGTGTCATTGAAGACGTCACGAAGAAAGCGG
AAGACGTGCAACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCG
GATGAACCGGCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGA
AGTCTATCAATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGA
AACAATGGATACAACAGTTAGATGAATACGAGAAAAAGGTTTTTGCGGAT
GCGCTACCACTTTCTGAATCAGTATATGCTCACTTGGACACACTGAACGA
ATGGTTGTCTTCAACGGTCGAACAATTAGAACAAGTATCCACCAATCCAT
TGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGAGCTTGCAAAA
CAGTGTGATGAAGAAATTAAAGCGAATGCTGATAGATTTGAAGAAATTGC
AAAAGAGCTGAGTGGGCGAGACGATCGTGGACTGGACAAGCAAGTCCAAG
AAGTTAAAACTGAATATGAAAAACTACAACAATTCTTGAAAGGTCGAGAA
AAGGGTCTAGAAGAGAGTATCTCACTAAACGAGGATCTCATCACGTCTAC
ACGTCACTCGATACAAGAAATCCAAAGTGCCAATAACCAATCGAAACTCG
ACCAACTCGGCAATCTCTCAACACAGATTGAAGAAATCAAAACTAACCTC
GAGAAATTGAAATCTCAACCAAGTCGGAAAGAATTAGAAAGACAATTTGC
GGCCCTCGAAGGGTCCGTTTTGACTGATATTGATAATCTGAAGAGGAAAG
CAAAGAAAGTGAAACTATCTTCTCCTGAAGTCAATGATATTCAATGTGCT
GTTGAGAATTTGGAGGTTCAACTGATGTTTGAGGGAGAAATGAAGAAACA
TCAACAGCTAGGCGATGACGTCATTCGAATTGATGAATGGGTTCGCAAAA
CATCGAAATGCGTACTTGATCGAATCGATGGATCTGTCGACCTCGAGGAT
GACTACATCGAGAGTATACCTGCTATTAGCGAACAAATCGAGACAGGCGT
TTTCAAACAATTCGATGAAATGTCAACGAGAGTGTCCAAATCGAATGTTT
GTAATCAAGTCATTTTGGATATGATTGATGAATACAAGTCACGAGTGGAA
GGCATCAGAGAAGGCTGTAAAAAGAACCAATCTATCGAAATTGACGTCAT
TCAACACAGATTTAGAAGAATTGAAAGCCCTGCTCGAGAATGTTAATAAA
CTTGCCGACCAACTAAAAAATGAGATTGTCAATTTAACATCCAAGCAAGC
CGGAGCTGATGAAGAAATATTAAAAGAATGTTTATCGACATACATTACAC
GACTTGAAGAGCATGATCAACTTCTAACATCTCACACCAACACCATCAAC
GCCCTGATCACCACCACCTCCACGCCAACAACACCACCGCCTACCGAACA
ACCACCCGTCTGTATTGAAATCGAAAAAACACGAAAAACTATAACCACTT
TGAGAGGACGAATCGAGTGAAAAGTTCCAACAAATCGACGATGGCGTCAA
AAAGATTATGGAATCTCTTGGTCAAATTGACAGCGCTATATCGAAAGAAG
ACTTTAGTCTACTTAAACAAGACACGCTTTTAAGCAAAAAGCAAGATTAT
CAGGCATTGCAACAGGATATATCGACGGTGGAGAAGAAAGTGGATTCTTT
AATCGAAACATGTACCTTGATCACCAACAGAGCTGAAGAATCGTATGCTG
AACAATTACGTCAGAGCTTGGATGGGCTGAAGAAACGTTGGTCTGGCATC
ATCGATAGTACTGAAAAACAGAAAGAAAATCTTCGAAATGCGGGTCCACT
ATCACTACTCAATAAACAATCGAAACTTCTTATGGAGACATTGTCACCAG
AAAATGCAGAGAAATGCCAGAAAGATGTATCAGAACTTGAACGTCAGCGT
GCAGACTGTAAAAAGATCACGGAGGCACGATTGAAACGTGTCAGTGAGGC
TATTTTACAGACTGAGGAACTGGAAACGGCAATGAAGGAGACTGTTCACT
GGATGGATGATGTTGATCGTTTCTTGGAAGAAATCACTGGCACAATTTCA
GAAGGTGATGCAGAAACCATCGAATCACAAGTACAAGAAGTCGAGGGGAT
GGTCAAGAACCTACAAGAACAAGAAGGCAAAACAAAGCGAAGTATCACAA
CACAAGGCAGCCCTAGCTAACCTCTTATCAAAAAGCAATGAAATCAAAGA
CCCAGCCACACAAGCAGCTTTCCAATCCGAAGTGAATGCAGTTTCTGTCA
AACTCTCCGCAACAGAGAGCACGATCGGTGATAAACACAGACAAACGAAC
GATCGGATAAACAGTACTCCTCCACAGGAGTTTTTGGATAAAATGACTAG
TATTAAGGATATTGTCAATAATATTTTCCCTTGTGTCAGTAAGGAATTCA
AATACGATCAAATCAAAAGCATGCAGACATTGGCAGACGACTTGAAGTCT
CTTGACCAAGCAATCAAGAAACGTCGCGATTCAATTATCGTCTTGACGGA
GCAAGGCGAAACACTGATGACGGAAAGCAAAAACGCCGGACAGTCGGTCG
TCGGCCTCGAACAACAATTAAACAATTTTCAAGAGCGTTGGAGCCAGCTT
TCCCGCACGGTGGCCGAAAAGCGTGACCTTGTGGAAGACAACGAAAAGAA
GAAGGTATTTGTAGAGCAAGTTCAAAAAATCTTGCTGGTCATAACAGAGA
TTACCACTTATATTGAAGTCATTGTCATTGATTTGAAAAATAACCCAACA
GAATTGCTAACCATACTCGAGTTCCGAAGTATCGAGAACAACTTGACAGC
ACTACTCAAAGAAATCGATGACAATATAGAATGGATCACAGATACAGAAC
TCTTACTTAAACCTTCATCGCCACCAGATCGCGAACTAGTCGAGGATTTA
GAGAACGAGTTGACACAGCAACAGAATTCTTTTGGTGATTTCAACAACGC
TGCCCAGGGTGTTGCACAAATGCTTGACGAAGAGTCACCAGCCATCCAAA
ACATACAAGTAACAATGGAAGATTTCAATAAGAGATGGAATACCATTGCT
AGCATGCTGAATGCCAAAATGAAGCATATGGGAAACTCTGCAAGAGGTTT
TAAAAAGTTGGGAACAATACCGTAACCAAGAGCAACGATTGAACGATTGG
TTGTATGAGAAGGAGAAAGGCTTGAAAGATATCTCGCTCTTTGATATGGG
CGACAAAGAAGAAGTGCAAAAACAAATACAAAAATTAAAGGATGATTTGG
AGAACCAGCAGATCCACGTCAATTCATTAAGTCATATGGTAGTGGTGGTT
GACGAATCCGAATCTGAAAACGCTACAGCTGATTTGGAAGAGCAATTAGC
TTTACTTGGTGAACGATGGTCTGCTGTATGTAAATGGACTGGTAACAGAT
TACATCAACAACTGATGAAACTTCAACAACTCCAACTCCAAGAGCTTGCA
AACTGGCTGACAACAGCTGAAAACATCATCGAAACTACGGGACCAATCGG
ATCAGATCTGGAAAGCGTTAAAATTCAAGTGGACGCTCACAAGACGTTTC
AGGAATTCATGATGATTTTAACTTCACATCAAGCCAGTGTGGGAAGCGTA
TTGGAGTTTGGAAGTCAGCTCATCAACGAAAATATCGTCGTTGGTCGGGA
GGAGCGTGAAATTAGGGAACAAATGTCAGTTTTGTCCGAAAGATGGGAAA
ATCTTCGAGTGTCCGCTATGCAAAGACAATCAGAGCTAATCGATCAGATA
GCCCGACTCCGTCGTCCGTCTCCACTATGTCAGAATGGGACGATTATAAT
GAGACGCTAACGCAAGTCTTGACATGGCTCATGCAAGCTGAAACACAACT
CAAACAACAGGAACCTGTCTCTGAAAATGTGGACAAAGTCAAAGAACAAT
TTAGAGAACATGAGATGTGAACACGGACCATCCAGACAAGAAATCCATTA
TAATGTATGTGACCACGCTTTTTGAGACGCTGGGTAAAACCAAAGAAGGG
GCTGAATCGGATGGATCTGAGCTGGATCAGACCCAACTCTTTCGATTTTC
AAAAGTTAGTTGGCAAGCCGGCTAGTGAAAATTTGGCACATGCTTTTGCA
AAAGCTCAATCAGAATTCAATATACCACCATTACTGGAGCCTGAAGATAC
AAAGATGTAGAGATCAAGAATTTCACTAGCTCATGGAGAGATGGTTTAGC
TTTCAATGCTATTCTTCATCATTTCAAGTGAAAACGGTGATCCAACAAAC
ACTCCATGCCACAGATTCCACCATGGAGGTGGAAAAGACCTTATTACAAT
GGTGTGCGCACTCTGTTCACAGACAAAGCTGGTTAATATAAGAAGCGAGG
AGATTGTGGATGGTAACATCAAATTGATTCTTGGCTTAGTTTGGAGCATC
ATCCTACAGTTCCAGAAACAAGAAAATGGAAGAATGCGTGTACACAAAAT
TAGCAATGTTAACAGAGCATTGCAAGTATTCCAAGGGTATGATAACGGTA
AAAACATTGTGGTTAGGGACTTGACATTCGATTTGCAGGATGGTGCTGTT
TTATTGGCACTATTGGAATCAACAACAGGAAAAAAAATCATGAACGATCA
GACACCCAAAAGAAGACCTTCACCAGATGGATCAATCATATTTTGAAAAA
AATGATGGATGAAAATAGCTCCCAAGATCTTTCCGCCCTCCGAACGTGAA
CGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAGGTCTAAC
ACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAATTAGGGC
GCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACATCATGTG
ACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGGATTAAAT
CTCTAATGGAAGAATACACCCGACTGAAGGGAATCAAACCAAGTAACTCA
TTCGAAAACGGACAAATCGTTCCGGAAAATACACAAGACACGGTGTTGAT
CGCTGAAGCGAAGAGTTTACGCGAACACAAAGGTCGTTTAGAAGCTCGTA
TGCAAATTCTAGAAGACCATAATCGACAATTAGAATCTCAATTACAACGC
TTACGACTTCTCTTAGAACAGCCGAAAAGTCCGTCACAAATTTTGGCGAC
GTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTCTTG
AAGAGGAACACCAAATGAACGGTCACCACGATTCGACAGACTTCCACCCC
AATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAACATCATCTGAT
CAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAACAATAACACAA
CGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTC
GGCACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAA
CAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTT
ATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACACTTGCT
TCTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCAT
CAATATAGCTTAGCGGCTAAAAACAACTCAGCGATCGATTCCAACAACTT
TGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTAT
TACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGT
ATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATG
TTTTAACTTTGATCTTTGTCAGATTTATTCCGTCAAATTTCGGATAACAC
CGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCC
AGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATC
GAACCTAGCGTCAGGAGCTGCTTCGAAATGTTGACTTGTGTGAATTGAAC
TTAAACATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGA
TAACTTGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACC