Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001411 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001411
Unique NameTCONS_00001411
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1923

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001411 ID=TCONS_00001411|Name=TCONS_00001411|organism=Clytia hemisphaerica|type=transcript|length=1923bp
atatgctTGACCGTATGAGGCAAATTAATGTGCCTCACCCGGTTCAGCAA
ATACCGTGCGGGGAAAATCGGGCATCACTATAAACGATACAATACAAGAT
TGTAGGGgcTGGGCAAAAATAAAACGTGAATTAATAACAAGTAAAGGAGA
AAGGAATAAAGACAAAGAAAAGTTTGACGAAAATTCGCCCTCGTCTACAC
CCGAAATGCGCCCTGTAAACACCCTACCGAAATCACCACACCTTCAATCA
AAACGAAACCCGGACCAATATTTCGATCAAAATAATAATGGTAGCACATT
TACGGGTTATAATCAGACGGGGATTCTGTCACAAAATAATAACCACCTGA
ATACAAGTTATTTGATGGCACCAGGAGGTATGGATAAAAGAAAGTGTGTC
AAATTACTGATGCTAGGGCAAGACGGAGTTGGAAAATCCGCGTTTGTGGT
AAGATACCTAACAAGGCGATACATCGGAGAATATGATCCAAAAATAGAGG
GCATATTCCGGAAGACAGTCAATATGAATAATCAAGACATTAACGTTGAA
ATCAAAGATACATCGAGAGGGATCAACTGGTCAGGCAGAGCAAACGATCT
AATCTGGACCAATGGGCTAATATGTGTCTATTCAATAAACAATCGAAGCA
GTTTTAATGAAATTCAATCTATCAGTAAAATGTTATTGCAGCAAAAGAAA
TCAAGGGGTATCCCTTGTTTACTGATCGGTAATAAGAAAGACTTAGAGAA
AAACGAGCGCCGGGTTCAAGTTAGTGAAGGACAGCAATTAGCTGATTCGA
TTAATGGTACATTTTGCGAGTTAAGCGTAAGTGATGGATATATTGAACTT
GAAAATATTGTTAACAAATTTATCAAGGATAAATGTAGTGACTTAAAAAA
TCATCTGTTACCTCAATCGAAGATTTTATCAAGTAAATCCACTCCAGAGA
TTCGGAAACCGTTGGGCGGTGGACAGGGCGGTTCGAATGATGGTGGTGGT
GTTGATATTGAAGtgaaaactgaaaagaaaacaagAGCTTTATGGCAAAA
GTTGTTgacaaataataataaaaaacaatagtGTTATTTAAGGGATTTAT
TTTATGTTAAGTCAtctataaatcaaaacaaaacatcacaAACACGTAGT
CTACAGTGTGTCTGTAAAACAGTGAAATAATATCATTTCATAGTATCTTA
TGATTTCATTTCTAAGATTCTAAAATCATATTTCcgattttccttgagaa
ataaaaaatatactaaaTTATTGGGATGGCAAATGATGTTTGATGATGTT
TCAACTTTACGGCCACACTGTAGACAAAAAACCGaaagtcaaaatattat
aaTTTATTAGGAAAGGAAATTCAGTAGAAAAGCCCCTTCATGAACTTCAC
GAGCTTATAATCTCATATTCAGACATTTACTAATAGTGCATTATCGCTTT
GCCTAATGTCCGAAATGATAGCAACgatacaatcaaagtcataatattag
ATTAAGTGGAATTACTTCTGAGTTTTAACTTCTTGAGACCAtttgagact
taagacttagatcCTAacgctcaaaaaagttttccaaaacGAAATTAATT
AAAGTGAATTCTGAAAaccgttaaaatacccaaaatgaTCAATATATTAC
GAGGTTGATTGTAGCGTATTGAAGTCCTTGGTTAAGATTAGGACATGAGG
GGGAGAAAAATATAtgctaaatttcaaatttctttgaaattgagATCGAT
TATGTTGATAAAATTTTTTCGTACATTTGTAAATATAAACTAATGCTGAT
TTATATTAGCTtctttgtaaaatttttgattgaaagaatTAATCTAAAAA
TCTTAATCGTGAACGGTCAGTTTTCTAAAACAACAAATTGCagtgctctg
aattatcttgTCAACGGTATATA
Run BLAST on NCBI

transcript from alignment at sc0000010:82890..110285-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001411 ID=TCONS_00001411|Name=TCONS_00001411|organism=Clytia hemisphaerica|type=transcript|length=27396bp|location=Sequence derived from alignment at sc0000010:82890..110285- (Clytia hemisphaerica)
ATATGCTTGACCGTATGAGGCAAATTAATGTGCCTCACCCGGTTCAGCAA ATACCGTGCGGGGAAAATCGGGCATCACTATAAACGATACAATACAAGAT TGTAGGGGTAAGTATAACGTATTTCACCATGTTCAAAGTATTTGAGAGAG CAAAAATGTTTTTGCCTGTATAATCAGTTGATAACATTGCTGATACGTCA TAATCCTGTTGTCTAGCGAGCACAAGGTCAACGGTGTCTATGGTAAGCGC CGTAATTTTCTGATCTACAATGATGGACATAATATATTGGCAAACCTCGA TTTTTCTTGTTTCCGGTGGATAACTTGGGCCCAGACCCTCTTTTACCCCC AGTTCAATGTTGGATAACACTTGGTAAACGATAGCAAGCCTTTCCCACCT ATCAATATTGATTTTGGGGGTGGAAGGGGAGATTTTTTTAAATCCCAAAG GTTTTTGCCAAATATTTTCAACATTTCAACATCCAACATTGTAGAATAAA TGATAATCGCACTATCAGTGACCCCGTTAGAATCTCTTAGCATCTCAAGA TGAAATGAAGAGCTAAATGCCAATGCGGATGGGAGGCTAGTTTTAACCGC TTTTGTTTTTATCTCAGTGAAAACTTTTTGTAAAGAACTTCTTTCTGTGG AAAAAGCTTGGGTTTAGGGATAAGGCTTAAGGAATCTACTGCTCTGAATT TCTTAGTGGCTGATGAGAATTTTGTGAATTTAGTAATGGGGTAGAATTAG AGACGATCCTATCGTCTACACAAGATCACTAAAAAAGGGATGAGTTTGAA AACGGTGCCCAGGGGCGGAGAAAGCAGTGGCGGAGATGTTTACAGTGTTT GTTTCAAACTCTACCGCTACTTTTTTCCCGTAAACCACCCTAACGCCCTG ACTTTGACTCTGACGCATATATCTCCCCGCGTTTACTGACCTACTAGCGG ACGATAGCTTCGTTTCGGGTAGAATTCGAGGTAAATTTTCTCACCGAAGA CGATTCTTCTTTGAGAGAGAGTTCCAACAGGTCACATGGAAGCCTATAAA AAAGGTGTCTGGAAAGGTGACCCCAATTTCAAATGACACATTAAAAGCCT TTCTAAGTACGTTTTTTTTGTTTTTGTTTTCTGGAAATATTTCTTGGGAA AATCTGGAAACCACGAAGGAGAAAATGTTTTCATTAAAGGTTGAATGGTA GGAGGCTTTATTGGGAAAAGATGTTATTAAAAACTAGAAGAAAATGTTTT CCTGAAAAACGAAAAATAATCAATCTGTCTTTGTCTTTATGTCTTTCATT TTTGAAGTTTAAATGACTTAGCGATATTTACGAGTGATTGAACTTTTTCT ATGCCACCTATGCTAAATTTGATCAATTTGGAACGGTTTCTCTATTCGAA ATACTTTTAAAATCTTTAATTCCATGTTTTTCAACTTTTCAAAATATTCG AAGATTGAAAAATAACAAAGACGAAGTATGGAAGATTCAGTGAAAATGAA TTATTTGACGATTGAAAAAAATATCGAATATCGTATTTCAAGTGGTAGTG ACATTTCGCCTGGCCCCAGTCCACCTGGTTCACCAAAAACACAGACCAAG ACGAGAGGAGGTAAGGAAAATCACTTTTTTGAAAATTTAGAAAGAATTGG CAAGAAAAGTAATGTCCTTGAGTGAGTTAAGGTTGTCTGCAAATTTACCC TAACCTTTTAACATCAATAACAATCGTACTTTAAAAAACGTTATACCTTT AAGTTTGTCTATTGTACATTAAAGTTCATGAATCACACGATTTTTACGAC CCTTATTGGGACTAATTTGACCAAATTTTGATCTTTCAAGGAGCAAAAAG TTGAAACTTTCCTATTTTTCAACCCTTAGTTGGACTGAAATTTGATTTTC TGGTTTTTTCCAACCCTTACAGGGACTTTCAGGTCCCAAAAAAGTCACCC TTAGGGGCGGCACATACCCATATCCTTCATTTGCCTAAGTACCCCACCGG ACCAAATTCGAACCAGTATGCATCCCCCATGCATCTGACCAATATTTAAC TTCAAAAAAATTGTTTTGAAAGATTTGACGACGTCAGTAAAAATAAGCGT CAAAGCCGGTTGACGACACACGCTCTGACCATAGTCGAAAAGTTGATTTA AAGTATTTGAACATGAAAATTATGTTTTAGGTTCTTTAACACTTTTAACA AAGAATTGCCTTTATAAATTGATTTTTAATCAAATCCCTTACCCTATTAG CCCCAAGCTTTTTTGACTTTTGTATCCCTAGGGGGGGGGGTAGAATCTAC CACCCTCGATTATTTTCGATCTAGAAGAGCTATGGCCATGAAATTTGGTA CAGATGTTCTCCATCATGACACAATTTTCCAGGAAGAAAAAAAAAATTGA TGACGTCATTCAAAAACTGATGACGTCATCACAAAATTTCCACCTGTCGG AAAAAAGCCCAAATATATGGTTTACAAAAATGTCTATTACAGTCGAACCA ATAAAGATATTTCGATTCTGTTTAAAGATTCTGAGAGGTAAAAGACTGTT CTTTAACATAATTGCAGGTTTTGCAATTTCCATGAAATTTTTTTCTTAAA ATCTATGCTGAAGATGAGTAAAATTTTCAAAATTTGATGACGTCATAAAT GATGACGTCATCATTTTCAAAAATTTTCTTTAGATTTTTTAAATNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT AAAACCTGATCTGGACAACCTATGACCCTAAAATTTTGTACAAGTACTCT TAATAAGATTTTATTAAAAGTCAGAAAGTTTCAAGTCGTTTAAAAAAATT TTCCCCGAGATATAAACAAAAGAACTCCAGCGTGGTAGATTCTACCCCCC CTGGGGCTAATAGGGTAAAGAGTAATTAAGAATTTAATTGCAAAAACGAC GTTATGATTATGAACTTTAAAAAGACGTTAATAATATGTTGCATCACATT CTTTTATAAAAGGTGCTAAGTTTTGATGGATGATTAACATTTATGTTTCG AAGTTTTTTCAAACTGTCCGCAAAGAATTGAACTGTTTTAAATTTTTCGG AAAATTTTCTAAATTAATGCATCTAAAGTTATGGCTGTTTTTCTATGAGA GATTGGGATGAAAAATTGGTCAAAAAGCAGTATTTTCAAGATTTTGAGAC AAATAAGCTTTTAGAAAAATTTTCCGAAAACATATTTTTAGTTCGGTAAA AGATACAACATCTAACACAAAAAACTATTCAAAATGTTTTTTTCTTCGCC GAAAATAAGCTCTTCAAAGTTGAAATACTCTTCTTCGCGAAAGGCTTCAT TTTCTTCAGCATCAAATTTTTTCTTTGCTATTCTTAAATTTTCAGACTCA AGGATAATTGACCTAACAGAAAATGTATAACATGCCACAGTTTTATGTGC TACATCAGGTAGAAATTTATATTTTGTAAGTGGTAAATATTAAAAATTCA CTATGGTCAGAATCCCTTTATTAAAGGTATAGGACATTTTAACTCCACCT CAGACAAAAGTGGCTAATCCTGTAAGAGGTTATATGAAAGTTGTATTAAA ACTCATTAACTTCATTCGACAATAGTATATATATGCTTCCGATTCCGATT GGTCAAGCACTCTTCTGATGAATGAGAGTTCAACTCAACAAGAAGTGAAA GTTGTATTATAAATTTTGAGAAGAAAGAAAAATCACCAGGCAAGTACACA AAGTTCTATCGTCGCTTATAAAACGTTGCAAATGTAATTGCAAGTGGACA CCATGAGTATTGTATTGGCGTAGATTGCCGCCATGTTGGTAATAAAGAAT TTTACGCTAGCCATAAATTTCCGTTTTCTAAACGAAAGAAATTTTCCTAC GCATATTATTTACTCAAAGACCACAAGTATTTTGATGGAGTAAATATATA TTTTAATAATTCTAGCTTCAAAAATTCAGCCATCTCTTCTGCGTTGGATT ATTGTCCAGCCACCTCCTATTTTTGGACGGCTTTACAGTTTAAAGCCTAA AAGACAAACAAGTGAAAAAACAATCTAGCGTGAATCAGTCGGATGTGAAT GTCTTTCGTAATTGGAAAGAAAAATTAATGATTAAATGCTGAAAACTATT TAATTTCTCAAATTTGACTTTATACTTTAGAATTGAAAATTGAAATTGAC CAAAAACTTTTCCTCGCTCTCCTATGCAGCTCCTATTTTAGAAAACCCCC GGCCCCCTTTCCTGTCTTCTGACATGATCAATTAACAGACTAGTTTTCTA GTCTATTTTAGGCGTACAAACTTTCACGAGCAGAAACTTTCGCGAGGTCG AAAAATCGCGAAATTCACGACATAAACTTTCGCGAATCGTAGGATAATAA TGAGAATTTTCGAATAAAAATCGCCTTAAAAGTGAAAATTATTCCTTCAT CCGCTAAAGACGGTATAGCTCTTCGACTTTAAAAAGGCATTAAAAGATAA TAATATGTCGAAAATTTGAAATTTATTACGATTTCGAGGTTTTATAAATT TCTAACTTTTTTTGAGAATTTTTCGCGAGCATAAACTTTCGCGAGTTGCC CTGTTTAGAATTTTCAAAGACATTTACTTTCGCGAAAAAGGCCAAAATTC GTGAAAATTCGCGAAAGTTTCTGCTCGCGAAAGTTTGTACGCCTAAATGA TGGACCCAAACCTAAAAGTGTGCAGTTGAAATTAGAAAATTCTGAAATGG CCTGTTTTTCTCCTAGCAGAGGGTCCAGTGCCATAAAGCAGGCTTAGAAT GCAAATCAAGTTAATTGCTATAAAATTACTCGTCTTGATTCTAATTATAA AAAGATTTTATCAATGGTCAAACGAAAAAAAGGTCATTTAAGCTCAGAAG ATTGCAATAGATAAAACAAGAAATTAGGAGGCTAACACCTTTATACAACA CGATAGATACTTGATTTATTTATAAAATTCGAGTTATTTCAGTATCAAAA CTTGTATGGTTGAAAACAACTAAGATAAAATCTTGCTAAAAATCAATTCT TTAAAGAAAATAATTTAATTTTGGTCGTGCGGTGTGGTATGTTATTAGAT AATGAAAATGTTTATCTTGATGAACGTAAATATGGCGTATAGGAAATATC ATTCCATTTAGCAATTTTAGAAATTGACTCGTGTAAGAAAAAACACTTGA AAAATAGAAGGATTATTGCTCAGTTGAACCTTGTACTGACTGGTAAATTT AAAAGACTTAAACAGTTTGGAGCGAGTAGATTACATTGTGTAGATGCTGT GACTTCAAACCAATGATATGTTTCGAACACTGGTGTCTTTCAGATAATGT TTTAAATGTTGTTTGTATGTTTTCAAAGTATTCTTGTTTTTGCACACTGC ACTTGCTGGATTTGCATTGGTACTTTCATTTCCTTTTCAAGGTAATATGC ATGCCAAAATTCAAGATTATTCACCAAAATGAGTCTATACGCTCTAGTGT TATGATTCAAAATTAGATTTGATGACAAATGAATGGGTTAGGGTTTCCCA GAGTTGAATGGGTAAAATGTCCGAAGTCATTCAATTGACATTCTGGCAGC TGTAATAGCATTTGAAATTCTTTGTTAACTGATTTCAAGCTAGTTGACTG GATCGGGGTTCCCATATAAAAGGTAGGGTGTTCAGTCTTAAGAATTACCA GTCCACCGTCTTGTTTTCAATTCTGGTCATCAGCGAGGCCCCCCAAGCGG ACCTTCAATTCGAGCAATCACTCAGATTTTTCCCCCAAATTCACGCATTC ACGCAATGTTTTTAGCAATGCACGCAGTTTTTGTTCACGCAAAGTTTTCC AATTCACGCATTCACACAATTTATTTTTAATTATCACGTATTCACGCAAG TGAAAAAGCCCATTCACGCAAACCGCTGGGGCATTTACAGTGCAATTTGA ATGTTTTGAATTTTGAACGTTCGAAATTCTAAGGTTAATAAAAAAACATA GCAGACTAGTCCGACTTCATAACTGGACAAACTTCCAAAGGAAAATTATA AGCATAGTTAGCCTATATCACTAGCGTAGACAAGGAGAGCAGAATTTCAC GACACAGTAATTATCTATTCAAAGTATAATAAACCAGCTGCGCTGGAAGG TCAGCCCTAAAGGATAAGATAGTTCAAAGGATAAGCTGGATCAAGAGAGA GTAGAAAAAAGGATGTGATCACAAGATAACGATAAACTACTCTTGGAGGT GGCTTAGACAAAATGGGTGCAAAAATCGTCAACATTTTGTCAGGGTCGAT TACACATTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTCTTAACGACGAGCGGG AAAAAAATCGCGGAACAGATTTGAAGGGTCACCTGGGCTGACCAAAAATA TAATTTTAGTGCTATAAAAATCTACTCTCCTACACAAATTTTGCGCCCCT CTTGTCTACGCTAGTGTATATAGTGTGAAAAGAAATATGATATACAGTAT GTACCTCTGGGGGGAGGTACTAGGTTTGTGAGATGACGCGTATGTCGTCC GAGCTAAAGTTCGGAAATCAAGACCCTTAGAGAGACTGGATTTCAAAAGA TTTTGTCCATTTTTTGATGTTTTTGCCACCCATTTTGCCTAAGTAACCAC CCCCGGATGTTCCTTTATCCCTGGTAGACTCAAGCCCATTCTCCTTGTTG CGTAAAAGTTGAAAAGTGTCTTTAAAATAATCGAAGGTTTTGTACGTTCG TAAGTCAGTCTTTTCCTCTTTCTTAAACGTGTGACATGATTAGAAAATTT ATCAAAAATCTCATCACAAAAGTTGAAGAAAAGAGGTTGTTCGTCGATCG ACATTTTGGTTGATGGATATAAAGTATTGGCGGTTAGTTTTACTCTTTAT TTTTATTCAACGTCAATAGAAAATATCAGGCGATTTTGTTGAAATTTCTT TCAGTTTGTACGTGTTTGATTTTGGCTTCAAAACGTTTCTTTAAGTTTAG ATGGTTTGGGATTGCTAGCCAGGTTTCGTGCCCAAATCTCTTAGGAGTTA CATTTCCAGCTTTAACGAATGTTGCATCCTATAATAAGGGAATTATTTTG ATGTTTTCGAGATGATTGCTCTATAGATTGGGCTTTTAGAAAGAATTGGT TCAAAAAGACAATCTCGTACCCAGAGCAAGTTGCACCATTTTTGGAGTAT AATTGATAAGCGTAGTAAATCATAAAAAACGAACTAGGGAAAAGATTAAC AGTGGAATCCCCATAACTCGAAGACACACGGGACAACAAAATTGTTCTAG TTAAGAAAATTTCATTGTAATATAAGGATGTGGATGAGTTATAGTGAAGG AGTGGAGGTGTTAAATTAGCGATTTTACTGTATGTAAAGTAAGTAAGTCT ACGACTGTCGTCGAAAGCGCCACGAAGGTTCCTCTTTCGATAGATATCTA CCAGAGACATCGGGCATCACCCTTTCTCCCTGGTTTGTTCTACTTACCCT TCTCTTTCCGGTCAAAAATATATTTTCGAAAAATTTAAATTTAGTTTAAA TTTCGGACCATGTTGGATGTTAAAGAAGGTTAAAGTCTGAGAGGGGGCAG GCAGTGGAGAAATAGAAAGACTCAAACATTTAAGCAAATTGCTAAAACTT AACATTAATGTTCAAAGATTCACGAAAGCTTAACATCTCGAAGTCAAAAA CTTTATTTATCACCTTTTAGTTACCATCTTTCGTAAAGGCGCCATGGCAA ACCCCAAAACAGAAACCATGAGATAAAACTCTATTTTGAAAAATGTATTA GAGTCTGTTTACTGTGATTTATCATCTAGGTACAATTTGCGTCACGGGGA ACAGAAAAAAGAACTCCTCCTTTTTCCAGTGGTTTGTAGTTATCAGTTGA CATAAGTTAAAACACCCACTGTCACCCTCTAATAGACCCGGTATAACTTC AGCCAGTTGGGATACAATAACAGACTGAAGACTCGAAGGCAATCGATTTC CCCATGTTTTTTTTATGGCTGGGGATTTGAATTCCATTATTTTCAAGAGT TAAAAAAGTAAGTTGGGATTGAAAAATAGCACAATAGATTGTAGTGTTTA CTTAATTACCTTCAACGTGGAAAAATTAGATTATAATTTTCCACTGCCTA GGGATGATATTTTTCCAGTGGGAGGGGTCCTAGCGGTTCTATGAGAAAGG GACCAGTTAAATGGAGAGAAACCTCTCAGTTCATTTTCACAATTCTTTTC ACACTTGCACCATCAGTAAATTGAAAATTGTCGGGAGTTGTTCGAGATAC GAGATCGAAAGAAGACAATTCTTTTCATTCAAATTCTCCCCGCAATATCC TTTCTTTTTCTTGTCTCTAAACATACTTTGTGTTATTTGCCAGAAATAGA ATGAATAGTTGGATATCCATAAGGAGGAGTAGAGTTAAGCCTAGGCAAAA ATACTGATTCGTTTAAAAAACATGTAACTGGGAGATTAATAGTATTAAGT GTCTGATTAAAGTAGAATATCCAAAGGGTTCGAGTATCCTTTAACAAAAG GGGTATTCAGGGGATTCGGCATCTTGTAAGCTTCTCGTTATAGACCAATC AAATAAATTCAATTTAGGATATTTTATATCTACTTATGAGATTAGGCAAT ATACATCCTAATCTTCCCCACATTGTACTCTACAAACCAAAACTATTTCT CAATACGATATTGAAAATATGATTTAGGATGACAAAACTGTTCTTTGATG AGTGATGGGTCCCGCCGTGTTAGAGATTGACTTAACATTTAACATGTTTT ATAAAAACAAAAGCCTAGTTTGAAAGTTGCGAATTATCGGCTTTTCATAC TAAAAACAGTCTCGTAAAGTGATTTGTCATTTTAAAAAGAACGTTCAAAT CCTTAGTTCAACATCATAGCTCAGCGTCATATATATAGAGTAAACCCTTA AGGTGTACTTTCTCAGACATAACACAAAATTACTTGTAGACAAGAAATCA CAAACAGCCTATTGATTGGTTTGTAATTTTTTGTCTACAGTACATACTTT TTGTAAAAATCAAAACTTATTGGGTTTTTGAATTTGTGTTTGATGTAAGT AAGTTTTGGATATATTGTATTTGAAAGTATGGCGGAAAGAGTGTGTGCAG CTAGACTGATTCGTATATTTTAAACAGTGCCGTAGGAAGCATTTTCTTAT TGGGGGGGGGGGGGGCTGAAGTTTAGGGACACCGCGACGGCCCGGGGGGG GGGGGGGGGTTTTTAAAATTTTTTGCTCAATTTTATTTAAAAAAACCCAA AAAAAAAAATTTTTTTTTTGGGGGGGGGGGGGGGGGCTGAAGTTTAGTGA CACCGCGAGGGCCCGAGGGGGGGGGGGGATTTTGAAAATTTAAGCTCTAG ATTGCTTGAAAATGCACTCAAAACAAAATGCTTTCTTTGTGCGGACGGGA CCTCCGAAAATCGAACCTTAGAGTGACAAAATTTTAGAGAGTCTTTAAAA AAAAATTTTGTTAGATTTTTGAAAAATGTATTACCCTTTTTCCGACCCTG TGAGAAACTACTTTGAGATTTTCTGATTTCTCTCAGAAGTCTGTTTGACC TAGATTAGACAAGAGCCTTTTTGGTTCTAACGGGACCCTTATGTAAAGGT TATATAACATTATCGAGTTTAACATTTTAATACATTTTTCATCTAACAGC TCATAAAATCCTTTCTTACGCCTTACAGTTCTTTCAAGACTTGTCATGTC GTGAAAAGGGTCAAATTTAATTTAAAACTGCGAGCTGTTACTTTTACACT ATAATCATACCTGAGAGAAGGCATTGTCTTGACTTAAGCCGCGATGAAGG GTTACTAAAGTATCATTGAAATATTTTAGTAAATTTTTCTATCAAAACTG GATCTCACAAAATTCAACAATTCTGCAACACAGCCTGAGAAAATAACTAT TTTTCACAGGCTTGGACCAACAGAGGATCTACTGTTAAGTTAGTACTTAT CTTATCTACAGTAATTTTTCTTATTTTTTAGGCTGGGCAAAAATAAAACG TGAATTAATAACAAGTAAAGGAGAAAGGAATAAAGACAAAGAAAAGTTTG ACGAAAATTCGCCCTCGTCTACACCCGAAATGCGCCCTGTAAACACCCTA CCGAAATCACCACACCTTCAATCAAAACGAAACCCGGACCAATATTTCGA TCAAAATAATAATGGTAGCACATTTACGGGTTATAATCAGACGGGGATTC TGTCACAAAATAATAACCACCTGAATACAAGTTATTTGATGGCACCAGGA GGTATGGATAAAAGAAAGTGTGTCAAATTACTGATGCTAGGGCAAGACGG AGTTGGAAAATCCGGTAAGTTTTAAAACCAAATTCTCATGATTACCTAAT ATTTGGTGAATATGTAAAATGGTTGGAAAAAGGAAAAATAAATTACCGGG TAAATTGAATACGCATGTCCCGGGTGGAAAGATTTCGAAAAATTATTTCC CTAGCACCATTATCTTTTTTAACCTGGAAAGGAAAATAATCTGTGAAAAT TTTTACCAAATTGGCAGCTTACACTAAGCTTGGACTAAATATTTGACAAA AAAGAATAAAACCTTTTTGAAAATACGGAAGCTTAATGTGGAATTTTATG CGTGGTTGTAATATGCTTTTACAACGAACAAACAAATTAATAAAGTATGT AAATGTGCCCATGGCCGATGTTTGCTTTGTCAGAAATATTAAGAGATTTG CACCTTCTATCTTTTCACCGCTATGTTTGAATTTTATCAATTTTCCGGAT AAATTCAAAGCTTAAAACACCCACTCTTCCGAAAGCTTTTAACGGATCTT CTATTTTTGTGGTACTTTTGCTTCCTACGTATTTTGTGATTGAGATTAAA GGCAAATTGTCCCAAGTTCATTGATCGACTTTATGAAGTTTATTACAATT CGAACCTCTACTATCCGAATCTTTCTGTAATTTGAACTGAAATATTGGTC CCCTCAGCTGGAAAGTGGTTTAAATTACTCTCTGTAATTTGAATCTTTCT CTTATTCTAAGAGAAATTTTAGCCGTCCAATGAAGATCGAATTAGAGAGT GTCAATAGTATATGGCCTTGTTGGGTGAGAAACCTGAATATCTGGTATAA TTCACTATTATATTATTATTCACACCTTTGACGAGAAATCTTTTGAACCC GTATTACATGAATTTTTGATTGAGAAATTAACCATTTTTTGATTTCAAAG ACCTCTAAATTCATATTATTATTCTTTCAGCGTTTGTGGTAAGATACCTA ACAAGGCGATACATCGGAGAATATGATCCAAAAATAGGTAACTAGAAATC AACTTTAAGCCAATTCCGCCCTCACATTATTCAGTCCCCTCAGTTTTCAA ATTTGAGAAGTTACAGTCATATTTCGAGAATAGTGAAAAGATTTTATAAT CTCGTAAAACTTGAGAAATCAAGACCATTTACTAACTTATTAAAGATTTT AGAAACTCTTTTAAATTACTTTTGCTCGAATAAATTTCACTCCTTTACAT CGAAGAGAACCAAAAAACGAAATTTCTAAAAATTTGAAATTTAAACAATA AAACTGGTAGGAAATTCTATATTATTTCAGGGTGGCTACCTAATGCGCGA ATATCAAACATAGATATTCCCAGTCAGAGGCTAAATGTCCCTCTCCAAAA CTTAATTTCTCTTCTTGATTCCACATTTTCTAGAGGGCATATTCCGGAAG ACAGTCAATATGAATAATCAAGACATTAACGTTGAAATCAAAGATACATC GAGAGGGGTAAGAACTTCAACTCAGATCCGCGAAAACGTTTAATATTGGA ATTATACGGGCTTTTTAGAAATAGGGGACAAAACTTTGACCACTGTTTGA ATCTAGTCCGTCACACCCTGGCGAAAATCCTTTTTTTCAATTTTTCTGTC ATTTCATAACAATTAATTACCTATTTCGAGAATATTCACCTTGTCCACTT TTACATCGGTTTTATCATATCTTTCATACCTTTATTTTGCTAGGCGAGGA GTTGTTTCATTTTAAATCTTCTTTTCATGATCCTTTCCATGNATACCTTT ATTTTGCTAGGCGAGGAGTTGTTTCATTTTGAATCTTCTTTTCATGATCT TTTCCATAGAACCTGATTAAGGAAAAATAAGTAAGAACTTTAAATTATTT ATCCCGAAGAATAATTTCAGACTCAATATTTCAATATTTCTTAGATCAAC TGGTCAGGCAGAGCAAACGATCTAATCTGGACCAATGGGCTAATATGTGT CTATTCAATAAACAATCGAAGCAGTTTTAATGAAATTCAATCTATCAGTA AAATGTTATTGCAGCAAAAGAAATCAAGGGGTATCCCTTGTTTACTGATC GGTAATAAGAAAGACTTAGAGAAAAACGAGCGCCGGGTTCAAGTTAGTGA AGGACAGCAATTAGCTGATTCGATTAATGGTACATTTTGCGAGTTAAGCG TAAGTGATGGATATATTGAACTTGAAAATATTGTTAACAAATTTATCAAG GATAAATGTAGTGACTTAAAAAATCATCTGTTACCTCAATCGAAGATTTT ATCAAGTAAATCCACTCCAGAGATTCGGAAACCGTTGGGCGGTGGACAGG GCGGTTCGAATGATGGTGGTGGTGTTGATATTGAAGTGAAAACTGAAAAG AAAACAAGAGCTTTATGGCAAAAGTTGTTGACAAATAATAATAAAAAACA ATAGTGTTATTTAAGGGATTTATTTTATGTTAAGTCATCTATAAATCAAA ACAAAACATCACAAACACGTAGTCTACAGTGTGTCTGTAAAACAGTGAAA TAATATCATTTCATAGTATCTTATGATTTCATTTCTAAGATTCTAAAATC ATATTTCCGATTTTCCTTGAGAAATAAAAAATATACTAAATTATTGGGAT GGCAAATGATGTTTGATGATGTTTCAACTTTACGGCCACACTGTAGACAA AAAACCGAAAGTCAAAATATTATAATTTATTAGGAAAGGAAATTCAGTAG AAAAGCCCCTTCATGAACTTCACGAGCTTATAATCTCATATTCAGACATT TACTAATAGTGCATTATCGCTTTGCCTAATGTCCGAAATGATAGCAACGA TACAATCAAAGTCATAATATTAGATTAAGTGGAATTACTTCTGAGTTTTA ACTTCTTGAGACCATTTGAGACTTAAGACTTAGATCCTAACGCTCAAAAA AGTTTTCCAAAACGAAATTAATTAAAGTGAATTCTGAAAACCGTTAAAAT ACCCAAAATGATCAATATATTACGAGGTTGATTGTAGCGTATTGAAGTCC TTGGTTAAGATTAGGACATGAGGGGGAGAAAAATATATGCTAAATTTCAA ATTTCTTTGAAATTGAGATCGATTATGTTGATAAAATTTTTTCGTACATT TGTAAATATAAACTAATGCTGATTTATATTAGCTTCTTTGTAAAATTTTT GATTGAAAGAATTAATCTAAAAATCTTAATCGTGAACGGTCAGTTTTCTA AAACAACAAATTGCAGTGCTCTGAATTATCTTGTCAACGGTATATA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000747XLOC_000747Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001411-exon-sc0000010-1575043694:110179..110285TCONS_00001411-exon-sc0000010-1575043694:110179..110285Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1575043694:86122..86454TCONS_00001411-exon-sc0000010-1575043694:86122..86454Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1575043694:85149..85205TCONS_00001411-exon-sc0000010-1575043694:85149..85205Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1575043694:84679..84752TCONS_00001411-exon-sc0000010-1575043694:84679..84752Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1575043694:82890..84241TCONS_00001411-exon-sc0000010-1575043694:82890..84241Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1510915933:110179..110285TCONS_00001411-exon-sc0000010-1510915933:110179..110285Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1510915933:86122..86454TCONS_00001411-exon-sc0000010-1510915933:86122..86454Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1510915933:85149..85205TCONS_00001411-exon-sc0000010-1510915933:85149..85205Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1510915933:84679..84752TCONS_00001411-exon-sc0000010-1510915933:84679..84752Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1510915933:82890..84241TCONS_00001411-exon-sc0000010-1510915933:82890..84241Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1491911889:110179..110285TCONS_00001411-exon-sc0000010-1491911889:110179..110285Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1491911889:86122..86454TCONS_00001411-exon-sc0000010-1491911889:86122..86454Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1491911889:85149..85205TCONS_00001411-exon-sc0000010-1491911889:85149..85205Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1491911889:84679..84752TCONS_00001411-exon-sc0000010-1491911889:84679..84752Clytia hemisphaericaexon
TCONS_00001411-exon-sc0000010-1491911889:82890..84241TCONS_00001411-exon-sc0000010-1491911889:82890..84241Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:82890..110285 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0223997 0 0.0259453 0.11957 8.31474e-09 0 0 0 0 0 1.04589 0.680139 0.848869 0.601746 0 0 2.25606 0.866287 4.10683 1.89208 3.70761 2.21419 0.284823 1.10712 2.33625 2.83213 0.150111 0.159695 0 0.0247295
Blast
BLAST of TCONS_00001411 vs. Swiss-Prot (Human)
Match: RERG (Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.533e-31
Identity = 64/195 (32.82%), Postives = 108/195 (55.38%), Query Frame = 2
Query:  380 MDKRKCVKLLMLGQDGVGKSAFVVRYLTRRYIGEYDPKIEGIFRKTVNMNNQDINVEIKDTSRGINWSGRANDLIWTNGLICVYSINNRSSFNEIQSISKMLLQQKKSRGIPCLLIGNKKDLEKNERRVQVSEGQQLADSINGTFCELSVSDGYIELENIVNKFIKDKCSDLKNHLLPQSKILSSKSTPEIRKPL 964
            M K   VKL + G+ GVGKSA VVR+LT+R+I EYDP +E  +R    ++++ +++EI DT+   +   R   + W  G + VY I +R SF E+  +  +L + KK + +  +L+GNK DL+ + R+V   EG++LA  +   F E S   G    E  + +   + C +++   + Q K     ST  +++ +
Sbjct:    1 MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLD-HSRQVSTEEGEKLATELACAFYECSACTG----EGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAI 190          
The following BLAST results are available for this feature:
BLAST of TCONS_00001411 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RERG4.533e-3132.82Ras-related and estrogen-regulated growth inhibito... [more]
back to top