Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001395 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001395
Unique NameTCONS_00001395
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1876

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001395 ID=TCONS_00001395|Name=TCONS_00001395|organism=Clytia hemisphaerica|type=transcript|length=1876bp
GGTTCGCCCACCACGCCACCACCCCTATACAGTAtggatttttaatggaa
cagcccatgaCATATAAGATTTTTCGGTTTgatattttataagaaattac
TTCTTCTTTACAGCNTTTCTTCCAAAATGATGATTTTATGCTTTCTGCTT
CTCGTGATAAATCAGTTAGACTATGGaacatacatcaaaagaagaatCTA
GTGGCTTACAAAGGACATGCGTACACTGTATGGGATGTTTCTGTCAATAC
GGATGGAACGTACTTTGTGTCTGCGTCATTGGATAAAACATTGAGATTGT
GGAATACTGAATATGCATGTCCGTTGAGGATACTGGCAGGTCATGGTGAC
AGTGTCGATTGTGTAGCTTTTCATCCGAATGGCAATTACATAGCATCAGG
TTCATCAGACAAAACATGTCGTTTATGGGATCTCCAAAGTGGACAGTTTG
TGCGTGTCTTTGTTGGTCATAAGGGACCAATTTATTCATTAGCATTCAGC
CCAGATGGAAAATATTTAACTTCAGCAGGTGACGACTCTGAAATCAAAAT
ATGGGACCTTGCCAACGGACAACTGTTAAACGAGTTCAAAGCACATTCAA
AAACAATATACAATTTAAGCTTCAGTAACGATGGTTCTATGTTCGCTTCT
GGAGGTTTAGACAAGACTGTCAAAGTATGggaaagtgaaaatatttttcg
taaaaaaaCAACTTCATTGTTCAAAATGGCAGACGAATGTATTGGTAGTT
ACCCTGTTGATAATATCAGTAGCATAttggacttgaaattttcggacgGT
AACCTGTTATATACGAGTGTTCTATCCAACAGTGTCAGattttttaagaa
GTATTCAACACTAACGTGGAAATCTTCATTACATAATTGGTGTACTAATT
ATTGCTCTTAATTATGGAACTGCCGGTACATTCATACTTTACGTCATCAC
AGAGGGCCCGACAGTCCATGACGCTTTCCAGAAATGCAGGCAAAATAGTG
GGATGTTGACTTATAAGACTTTACCTGATGAGGAAAGAACACTATACGCT
GGTTTAATGCAAAAcAATGGATTGTCTCAAGCTGTTGGTTTCAGCGCAAA
CAAAATATGCTACATTTACAAAATTGGTCAAGAGGGTTATACAATGGAGA
GATGCTCAGAAGAAATTTCCAAGCATTATCTATGTAGATACTTTTTTACA
ATACCACCCGTCCCTGCttcatccttattttttggTCCCAATAACGAATA
CGAGCAAATAACTCAACAAAGTGATGGGGGAGTGTACCCTGATACATTTC
TATCCGCAAAGAAATCTTGTGAAGCGAAAGGCAAAGAAGTTTTATCGATT
GAAAATCTGGCAAAGTTCGAAAGTTTCTTCGATCTTTTTGCTGAAGCAGG
CGCattCCTTCCTACTTTGTGGCTAGGAATGACATACGATCCATTTGACA
AGAAGTTTCGATACTGTAACAAAGAAATCCAATCAACTTTTCGACCATGG
TGTTCCAacacaaatgattttgatgacgaAGGAAGACTATGTGTAGTTCT
TGACTTCATAAGCGGTTGCTTTCGACAAGTTTATTGTGGCTTGAGCACAC
CCAGCATTATTTGTCAGCATCAATTTTCGCCTTTATCAACTTATGTTCGA
ATTGCACAGAATTTAATCAATGAAATTAAGAGCGATTGTAAATCATgcaa
gaaaaattgatgaaattgaCCCTGGTTATTCTTATAAGtgctatgcttat
aaatatcgTTTAAAAAAAGTGCTATAAGTATTTCTCCGTAATGGCCGGTC
Tctactttcgcgcgaaatgagcgacagtttttttcttaaccttttttgcc
cgaagaaaagattacgtcataaaaaa
Run BLAST on NCBI

transcript from alignment at sc0000010:1031457..1039613+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001395 ID=TCONS_00001395|Name=TCONS_00001395|organism=Clytia hemisphaerica|type=transcript|length=8157bp|location=Sequence derived from alignment at sc0000010:1031457..1039613+ (Clytia hemisphaerica)
GGTTCGCCCACCACGCCACCACCCCTATACAGTAtggatttttaatggaa cagcccatgaCATATAAGATTTTTCGGTTTgatattttataagaaattac TTCTTCTTTACAGCNTTTCTTCCAAAATGATGATTTTATGCTTTCTGCTT CTCGTGATAAATCAGGTAATATCAAATAAGGTGAAAGTTGTTTGTTTACA GTGACAATGTGCTCTACCAGGAGGAGTCTTAACAAGATTGAATgttgttt ttgaatttcataACTCGGGTTATATGGTGTTTGAATGTGATGAAGTTTTG CAATATTTTGTGTGGATGCTTCCATAAAAGAAGACATCCATACTTTAAGC AGAGGGGTGTAGCAAAAATTAGATACAGACAGACGTTCATTTCTTTAGAT ATGTTAactgggccattccattttatattaATACGTAATGGGGGTAATCC AAGAAGAATTTCTTGGGGGTCCGAAGGAGTATTTTTCAATCTttcaaggg ggtaaaaagttattcaaaaatcTCCAGAGGGTAAAAGACTGGTTTTCGTT CATCCACTCACTTGTAGGTATAAAAAGGGTTTCTCCGAGGGTTTCTTTGC CAATGTTACCATTTTCAAGGGGGTATTTACACATTTCCAAGAATCTTATT TTGGTTCGCCCACTATACAGTAtggatttttaatggaacagcccatgaCA TATAAGACTTTTCGGTtccatattttattttaattacttcttCTTTACAG ATAATCTTACTTTCCAATGTGCAATGAATTCAAGGAttgaaaatgttatc aaaatgTAAATTCTATTATGCATATTTTTTCATACAGTTAGACTATGGaa catacatcaaaagaagaatCTAGTGGCTTACAAAGGACATGCGTACACTG TATGGGATGTTTCTGTCAATACGGATGGAACGTACTTTGTGTCTGCGTCA TTGGATAAAACATTGAGATTGTGGAATACTGAATATGCATGTCCGTTGAG GATACTGGCAGGTCATGGTGACAGTGTCGATGTAAGTCTAAAAGCAAGta cttttttgctttagaatATTCCCCTTCTTCAAATCGTCGCATGAAAGTAA GAAAGccgtaaaaatttgaattaaagaaCTGTAGTTCAATTTTGTGACTT TCTGCTTTTNTTCCCCTTCTTCAAATCGTCGCATGAAAGTAAGAAAGccg taaaaatttgaattaaagaaCTGTAGTTCAATTTTGTGACTTTCTGCTTT TTGGACTTACCCGAATTAACGGCCAGCTATCCAgccagccagccagccag ccaagcactttttcttgattttctgttCGTAAATGAatgtgtttaaaaaa attaaatattccgATATTAATTGTTTTTCTTGTTCTAGTGTGTAGCTTTT CATCCGAATGGCAATTACATAGCATCAGGTTCATCAGACAAAACATGTCG TTTATGGGATCTCCAAAGTGGACAGTTTGTGCGTGTCTTTGTTGGTCATA AGGTAAATGTTCATCTTTGTGTTTGTGTTTGTGTTTGAATAACCAGAAgc ttcatgtttttgatgttgttaaaaagaaatattcgaCGCTCACTACAAGA GGTCATCTTCAGAgtaaaaaatctaataaaaaacgaaatcttttaaaaac aaattttcaaaaatagtaaaaatagtgctaaaaatacaattaaaaACAAT GCGGTAAATGATAGAGAAGATACCTTAGggactaaaataattgaaacGTG CAAAGAAAGTATTGAATGTGTTTTTATTGTTAATCATCGTTGTTGCTTTC GACAAACtatagtttttctgatttttgatgGGTGATCATTTCTATCTGAA TGGTTCGAGTCTGACTTCATAAAGCTTGATAGGCCGCCCCGACTTTAATA CTTTTGGCCAGTAATAGTAGAATACGTTTTTTATCAAGAAAAAGATGGAT GGGCTTTTCTAGAGAATTTCAGTAATTTCcgtaccccctgttgaggatat ccgTTTAAAGGAAATCACCCCTGGATGTCCAAGAAGATAGAGTAGATAGA AGGGGAGAGGATATCcatcccctggatatccaggcattTTGTCTTGCCCA TCACGGATATCTGTGACGGGCAAGACAAAATGCctagatatccagggggt acatGACACCCCCTGTATATTCAGATATCATTGAACCCCACTGTTCGATA TTACTGTATTATATATTATTCTGGGAAAGCCAAATACGGTTCTTCTTCAC TTTTAATCTACTGAATCGTATTTTCGTCCTATTTTGCAGGGACCAATTTA TTCATTAGCATTCAGCCCAGATGGAAAATATTTAACTTCAGCAGGTGACG ACTCTGAAATCAAAATATGGGACCTTGCCAACGGACAACTGTTAAACGAG TTCAAAGCACATTCAAAAACAATATACAATTTAAGCTTCAGTAACGATGG TTCTATGTTCGCTTCTGGAGGTTTAGACAAGACTGTCAAAGTATGggaaa gtgaaaatatttttcgtaaaaaaaCAACTTCATTGTTCAAAATGGCAGAC GAATGTATTGGTAGTTACCCTGTTGATAATATCAGTAGCATAttggactt gaaattttcggacgGTAACCTGTTATATACGAGTGTTCTATCCAACAGTG TCAGGTAACATCCGGTTTATttctaagaacaattttatttatGTATACAG TATATATGTATGTAAGGATTTTTAACAAATTGAATATCTGTTGGTATTAC AAACTAGATGGACTAATTCTTGTTATGTATCCAATACATATCATTAGTTT TATTACCGTATTTTGCTATAATTGATTTAAAACTTAATGAAATGTTTTCG TTCTCATTGTTTttcatttcgttttttttttctcgtttttcggtttgtgt atttgttttcaaattattttcgaattctGCTATAAGTTTCGAATGTATAT TTGAATGCATCTGTAGTTgcaaaaaatatatcaaatccAAGGTATTAAAA TAGAGACCAGTTCTTTTGTTTCTAATGTCCAGATTAATATTACGATTGAT AAACTGAAATAGACTTTATTATTGtgtatttgtaaagatttttttttgtt aaatccAAGCTAAACTCTTGGtcaattttttataatatttaaaaaaagat tatttgtATATTTTGACATGCACATATTATTAGAGGAAACACattcaaat attattttattcccaatattattattattattatttcgaCTCAAATCTAT TTACTTGTTTACTTttctaatatttcaaaaagtcttGAACTTTGGAAACG TGCAAATTTCTGTTCTTCGCTGCTTTTTCTTATTGTATTTTTAAGATTCT TAAAATatcaacaaatcaaaaattcatcaGAAAATACTTCCTATTTTTGG TTTGAGGAAACACAAATAACTGAAAGAATTGCCGAACGATATGTATCTTT gttgtttcgttttttttcataCATATTCAATACAAATGTattatgattat ttttataatcagAAGTGCATGCACGTTTTTTTacgagaacaaactatata agaacataaggcttcgagggccaaattgttaaaaacattttaaggctttg tagaccctagaacacccaatttcttagaaaaatggacaaaaaactcaaaa actgctgaaaataagaacatattaagaacattattTAGGTTTGTAACCCG AAAagtaagaacatctgaaggcttcaaaaatttggatgttcttataaaaa gaataacGTGTACAGTAGCCCGTTCTTTTATTGTATGTTTCACGCTCAAC CCTCAATATCCTTTAAATTAATcctttgatgttgttttttttctctttag attttttaagaaGTATTCAACACTAACGTGGAAATCTTCATTACATAATT GGTGTACTAATTATTGCTCTTAATTATGGAACTGGTAAGCttttattgtt tgtttgttttcgaTTCCCCGTCGTTTTAACGTttaatttctgcattttaa aaagatttaatgtgtaatatatttttttaatcataatttcttttcctcta gataaatttttgtgaaattttcaggagagatacataaaactgtggtggat ttgtgtgttaaaagtttttcatttgagttgattttgttttgagagtttgt tgttgcgtgcttgataaattgttttctcgctacgcaagtttctgcgtagc tagccggggtatctataaggctggaacactagattcttccagtcgttcat acaaactaaatcccgtaacaattatcgtattatcatataacgccgaTACT ATTGTATTACACGAATTAttaacgactccagtctataccAAGCGGTGATG TTTATCCCACTTGTCTCTAGTGAAGCCGCTAGTCTATTTTTATATGATAT TTCCTCTTGCTTGCGAAAAATAGATGAAGAAGAATGATGCACAATGATTC CCCGAAAATCCATACCGGATGCAGAGTGGTACGTAAACAATGATTCCCCT TCGTAATTGTGTACAATTGTAATGATTATTACGTAAATCAATGAATGCAA GATTAAAAGGTGGTATTTATAACGATGCTTTTTGCCAAATCCTAATTAGC ATTTAAGATACTGTACTCAACATAAAGTTGAAGCAAATAACGATGAAGGA TTTCGTTGGTATACTTTTCTTCTTGAGTTTTACTACAGGAATCAATTCAC AGGCTGTACCATGTTCAGCAAATTTGGCCGCTTTTGTTGCAGATCAAGAG ATACGAGATGAAGATCATTTCTGCGTACAAAATCTGTGTAGGCTTCAAAT TCAACCTAAATTTAACATGTCGTAAAAActgctctcatccataaattttg cagggtatctcgctacgcctttGCATGTGATGCATAATGAAGCATAAAAt agtatttttgtgaaagttttgagCCTTTCCCATGGGATAAATTATAATCA ACggttaaaaatgctctaaaaactACATTTTTGGGTTCTAATGCCGATTC CATGCAGGTGATATTTTTAGCAAATTTAATcatagatattcttataaagt atattcttataaaaaaccgtgtaGAAATGAATTGCCAAGTATCCTTACAT CTATTCAAATTCGACATATGGgaagtattttattttctctttcaGCCGGT ACATTCATACTTTACGTCATCACAGAGGGCCCGACAGTCCATGACGCTTT CCAGAAATGCAGGCAAAATAGTGGGATGTTGACTTATAAGACTTTACCTG ATGAGGAAAGAACACTATACGCTGGTTTAATGCAAAAGTAAGGAAACTTC TTATCTGTTATTTTGATGGCAGAtaggcggccgcccacgctaaagctatA AAGatgccaatttcccatcggagaggaatgataggcggcctttgatgtgc cgcatccccagtcgggttcaactacccttgcacgtaaacctaaaaaatat ttcggttgaaCCCGCCAATCcacgaaaacgagggctgggttaccagacct cccgctgcaataTCTTTGACGTGGTCTTGCAAatttccgtaatctaaacc ttccagatgttgaaagttttcCCGACTTTCCGAGCTTTAGCTTGTCGGat gccccggggggggggggtacttaggcaaatggagggtaagggtacctttt ttggacttccaaagtcccgctaagggttggaaaaatcagaaaatcaaatt tcagcccactaagggtcggaaaaataggattatttcaactttttaccccc tgaaagatcgaaatttggtcaaaattggtcaaaattgtcCCGCTAACGct cgagtgacttagggcaagtctcaaaaacctaacagtttaccctaagtttt cgctaccaatagcagccagattcagagagccacttagggctctaaagtac ctctataccttaaggtttcaggacccggtgttacgtaattaaatattaac ccaaaaattaattattaaagaaattgtaatggtgacgtcataatttgatc gaatttggtgacgtcatgaatcgtataattgctataatattaaaaatata tgtccaatctttcccaaattttaaccaaagatgtatctaactgaaatgta attttttgaaaaaaaaattttggaaaaatttgatgatgtcagcaaaaaat tgcgtttttcgattttttgcattttttgctgacgtcatcaaaatcttttg aaaatttttcattgaaaagtttgGCACCAttaagatgcatctttggtcca aatttgacaacgatttgacatgtacttatatagttagagctaatttacga tttatgacgtcataatttgatgacgtcataattcacaatttctttaataa ttaatttttaggttaatatttaattacgtaacaaacGGTTCATGGCACCT TAAggtataggtcatctaaaaatcTATAAGTGAATAcctgagaatgggtg ctattggtcgcggattcggGATTTGTGATATTTAAAAATCTAGACATACC CTAACTCACCCGAGCGGTCGTAAAactcccaaaattttcctttgcagATA AGGAAAGTTCTCTCCAATAAACGAGTAATGTTTTGTCTTGTGTTGGTCCA TTTCGTGAGGCATTAAGTCCCTTTTTGGGCGTCTTTGATATGATTCGGCT GAGGATCGAATCTACAatcttgcgcaccgtagctggatgctctaccgtTA TAGTATAGCCGCTTGAACGGTATTAGGCTATTAAATTTATAATTGTCAtc ataaaagaaatattttttcttttttttccagcAATGGATTGTCTCAAGCT GTTGGTTTCAGCGCAAACAAAATATGCTACATTTACAAAATTGGTCAAGA GGGTTATACAATGGAGAGATGCTCAGAAGAAATTTCCAAGCATTATCTAT GTAGATACTTTTTTACAATACCACCCGTCCCTGCttcatccttatttttt ggTCCCAATAACGAATACGAGCAAATAACTCAACAAAGTGATGGGGGAGT GTACCCTGATACATTTCTATCCGCAAAGAAATCTTGTGAAGCGAAAGGCA AAGAAGTTTTATCGATTGAAAATCTGGCAAAGTTCGAAAGTTTCTTCGAT CTTTTTGCTGAAGCAGGCGCattgtaagacattttttatttagattttgt TATGGTATCACTATCGATAGTACCTCTCAATACAAtattatgtcaaaaat atttgTATCATCGCCTTATCATTACCTAGCCTTTTAGCCTTAAATATTAT TCTAAAATGGCCAATTCCTTCACCAGTTAATAAAATCAACCACCTTACTG GAAGTTATTTCTCACCTCTCGAATATTGTTAGAATTTTGAGGTATAAGGA GGCACTTCGTAGAAAAAGTTTTAGTAGAAGCTGAGCGCTTTTTGATGTCT GCATTATAGTACCAGGATTTCTCCCAATTCACCGTGTCTGACCGCagtca gtagacaagaattcacttGCAGCTCTACCCAGTCGCAATTGAGTCATCGG GTTCcacatggacccgtagctcaatggtagagcaaatgccTACGATTGAC ATGGTTGCGAGTTCGAGTCTCGCTGGATCTGTtagttttccaacggttct ggtggctggtcagaaaacaatatgagagcgactgtattcacttcattgta tTACAGTACCAGCAATTCTTGACCTTTCTTTGTTTAGCCTTCCTACTTTG TGGCTAGGAATGACATACGATCCATTTGACAAGAAGTTTCGATACTGTAA CAAAGAAATCCAATCAACTTTTCGACCATGGTGTTCCAacacaaatgatt ttgatgacgaAGGAAGACTATGTGTAGTTCTTGACTTCATAAGCGGTTGC TTTCGACAAGTTTATTGTGGCTTGAGCACACCCAGCATTATTTGTCAGCA TCAATTTTCGCCTTTATCAACTTATGTTCGAATTGCACAGAATTTAATCA ATGAAATTAAGAGCGATTGTAAATCATgcaagaaaaattgatgaaattga CCCTGGTTATTCTTATAAGtgctatgcttataaatatcgTTTAAAAAAAG TGCTATAAGTATTTCTCCGTAATGGCCGGTCTctactttcgcgcgaaatg agcgacagtttttttcttaaccttttttgcccgaagaaaagattacgtca taaaaaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000739XLOC_000739Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001395-exon-sc0000010-1491911889:1031457..1031621TCONS_00001395-exon-sc0000010-1491911889:1031457..1031621Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1031457..1031621TCONS_00001395-exon-sc0000010-1510915933:1031457..1031621Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1031457..1031621TCONS_00001395-exon-sc0000010-1575043694:1031457..1031621Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1491911889:1032294..1032487TCONS_00001395-exon-sc0000010-1491911889:1032294..1032487Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1032294..1032487TCONS_00001395-exon-sc0000010-1510915933:1032294..1032487Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1032294..1032487TCONS_00001395-exon-sc0000010-1575043694:1032294..1032487Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1491911889:1032845..1032958TCONS_00001395-exon-sc0000010-1491911889:1032845..1032958Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1032845..1032958TCONS_00001395-exon-sc0000010-1510915933:1032845..1032958Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1032845..1032958TCONS_00001395-exon-sc0000010-1575043694:1032845..1032958Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1491911889:1033746..1034110TCONS_00001395-exon-sc0000010-1491911889:1033746..1034110Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1033746..1034110TCONS_00001395-exon-sc0000010-1510915933:1033746..1034110Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1033746..1034110TCONS_00001395-exon-sc0000010-1575043694:1033746..1034110Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1491911889:1035307..1035390TCONS_00001395-exon-sc0000010-1491911889:1035307..1035390Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1035307..1035390TCONS_00001395-exon-sc0000010-1510915933:1035307..1035390Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1035307..1035390TCONS_00001395-exon-sc0000010-1575043694:1035307..1035390Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1491911889:1036602..1036743TCONS_00001395-exon-sc0000010-1491911889:1036602..1036743Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1036602..1036743TCONS_00001395-exon-sc0000010-1510915933:1036602..1036743Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1036602..1036743TCONS_00001395-exon-sc0000010-1575043694:1036602..1036743Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1491911889:1038238..1038579TCONS_00001395-exon-sc0000010-1491911889:1038238..1038579Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1038238..1038579TCONS_00001395-exon-sc0000010-1510915933:1038238..1038579Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1038238..1038579TCONS_00001395-exon-sc0000010-1575043694:1038238..1038579Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1491911889:1039144..1039613TCONS_00001395-exon-sc0000010-1491911889:1039144..1039613Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1510915933:1039144..1039613TCONS_00001395-exon-sc0000010-1510915933:1039144..1039613Clytia hemisphaericaexon
TCONS_00001395-exon-sc0000010-1575043694:1039144..1039613TCONS_00001395-exon-sc0000010-1575043694:1039144..1039613Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1031457..1039613 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.38421 0.802101 0.227885 0.166235 0.388535 0.398747 0.26017 0.201344 0.489404 0.725533 0.719406 0.9946 0.241258 1.21427 0.260333 0.185673 0.506796 0 0 0 0.516069 0 0 0.592053 0.0443463 0.19502 0 0 0 0
Blast
BLAST of TCONS_00001395 vs. Swiss-Prot (Human)
Match: TAF5L (TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.680e-63
Identity = 106/231 (45.89%), Postives = 146/231 (63.20%), Query Frame = 3
Query:  117 FFQNDDFMLSASRDKSVRLWNIHQKKNLVAYKGHAYTVWDVSVNTDGTYFVSASLDKTLRLWNTEYACPLRILAGHGDSVDCVAFHPNGNYIASGSSDKTCRLWDLQSGQFVRVFVGHKGPIYSLAFSPDGKYLTSAGDDSEIKIWDLANGQLLNEFKAHSKTIYNLSFSNDGSMFASGGLDKTVKVWESENIFRKKTTSLFKMADECIGSYPVDNISSILDLKFSDGNLL 809
            F  +   +LS S D S+R W++    N V Y+GHAY VWD+ ++    YF S S D+T RLW+ +   PLRI AGH   VDCV FHPN NY+A+GS+DKT RLW  Q G  VR+F GH+GP+ SLAFSP+GKYL SAG+D  +K+WDLA+G L  E + H+  I +L+FS D  + AS  +D +V+VW+  N +          + E +G Y    +S++L ++F   NLL
Sbjct:  350 FLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPAD--GSSSELVGVY-TGQMSNVLSVQFMACNLL 577          
The following BLAST results are available for this feature:
BLAST of TCONS_00001395 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TAF5L1.680e-6345.89TAF5-like RNA polymerase II p300/CBP-associated fa... [more]
back to top