Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001381 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001381
Unique NameTCONS_00001381
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4547

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001381 ID=TCONS_00001381|Name=TCONS_00001381|organism=Clytia hemisphaerica|type=transcript|length=4547bp
TACAACACCAAAATCATCGACCATACAAACTACTTGTGGATGTGGAAACC
CATCAGATACGaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGA
ACAATCTCCGGAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACA
ACCTCCGACTGTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGG
ACGCGTTGAACCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAAT
GCCGTCAAGgcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACT
CCGTTATACGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATC
CTGTCCGTATATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTA
CGTGCAAAAGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTT
GACAGACCTTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAG
TTTTCATGCGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAA
GCGGTTGACCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATA
CCTGCGGAAACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGA
AATATTGGCGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAG
ACGCGGCTACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGAAC
TCACGAACAGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAA
GGAACGTCATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAAT
GACTATCCTAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGC
GATCAGGGAGAAGGCGGACAATATGATGGGTGATTTACTGAAAGATACAA
TGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGACGAATTGGAATCA
GTTAAAAACGTTGGCGTTAAgctaaaagaaaataaagcgcCCGTAGAAGT
GCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAA
CTGGACGCTCTGACGGTCATTTATATGAAGAGATAGGAAATTTCGAATCT
GTATTTAAAACGTCGGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAA
TTTGGTGAAATTAAGACACAAAGACAGTAACGATGAAAGTCGACGGCAAA
AATTCTATAGACGCTTATCGTTCACTCATAAAGACAAAAGTAAATCTAGT
ATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGC
GCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTGGTTAAGAACACGA
CAACTGGCATTACGACGCCGGCGTCACATTCTAGTGGCCATCACCATGGG
TCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCAC
GAGGAAAGGGTCGAGAAGAGATACTCCCAAAGACAAACGAAGTCACAGAC
GATCTTTGACAGCGGCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAG
CTGGAAGCACTTAATGGATTCCTCATGAAAAAGGTAGCAGATATGAACAA
ACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGTCACTTTCAAAC
ACGCGTTACATAAATATCACGGAAATTTGTTATTCACGTGTGCTAACGCT
TCTGTCAATCGCAAAGAAGAGATTCTACTGAAATTCAATGACTTGGTTCA
TGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTG
TCTCTAaagaattttctgtcatggGCGTCAACCTTTTCCGAGGAATTCTG
GAAGAGTTCCAAAAGAacaagGATAAACTGGTCGTGAAGACGAGGTCGAA
TATAAAACATGTAAAGAAAAAACGAAGGAAAACGGCTGAATTTTACgagC
ACAAAGGACACGTTTatacatttcaaaatttcaacataCGCACTTACTGC
GAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTG
CGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTA
AAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCC
ATGTCAGAATTGACTAGTCCAAATAATCCTATACCAGAAACTGTCATAAA
ACTCATGATCGAAATCgaaaaaagagGTCTATACACGTTAGGAATATACA
GAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACG
TCTACCGAAGCGGAAGAATTAATCTTGGAAGATGAGAAACCACACACGTT
AGCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCAACCGATTATAC
CTTTCAATTACTACGATGACTTCATACGATCTACAGacTTGGAAAACAAG
AAAGAAATTCATTCCACGCTCTACGAACTGATTCAACATTTACCAAAAGA
GAATAAATTATTATTAGAAAGACTTATCGTACATTTAGGAAGAGTAACTT
CATTAGTGGAGCACAACAAAATGTCACCCAACGCCCTAGCTATCGTTTGG
GCGCCTTGTTTATTGAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATT
AGCTCAGTTGCCAAAACAAACAAAATGTGTAGAGATTTTGATTGAATTCC
AAGTGAAATCACGGAAAGATATGCTGAATGATATACAAGCTTTGTACAGG
GCTGAAAGTACAGCAGGAGAGAAGCTGGACGACATCATTCAATCGGAAGA
AACAGATGGCGATCCCGAgaagaataaagaaaatgacgaaatgaaagaaa
tcttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGGAGAGGATCACA
AATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCTTTAGATTCTGT
CGATGATCTAACGGATATGGACTATCATTTAAGAGATAGTTTTGAAGTAC
TGCATTTCCCTGAAGatGGTGACCATATTTCTGTTACACGACAATCTAGC
GTTATGGACATTTCAAACGAAACACCGTCGACGCCGACGTCAACAGAAAA
ACGACACGTCGACGGCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTG
GTACGTCAAAGTAATCTCCTGCTAAAACGtaactttaatttttctaaagg
aTCTTCTACTCATTTGTCTgtctttcttatattttttcaaacaatgtgtt
ctttttttaaaagataatttaaattattttagaaattcTTCTAGTTTACC
CTTTCTCTTCTTTTTCGGTCCTTGTTGAATTCGAGTCGagtcatccaaaa
aataaaGCTTTGTTACGTCCATTGAGGCACTAGCtgacttttttaaagaa
atatttcaaattttttgtcttttgactTTTTTCCAGGGTTTCATCGGGCT
CATCTACGGGGTTGGAATAGAAAATAATAGggatataaaatattttttaa
cattttaaaaagACATGGCTTTTATTACAAACTTCGttagtgaattttta
aaaatcaattttttttttcatttttttttttcaaagtcagTCAGAAAGAT
GTTTTTTATATTGTGAAACAGAAATGATCAAATAATGAAGCTACATtgta
aagaaatcaaaaagaaagcaAAGGTTGACTAAATGAATACACGTGTTTCT
ATGTAAGAATAATGAAAGTTTGAGGCCAAATCATCCTCTCAGGACCTGAT
TAGTCATCCTATCTATACTCGATTtagaagaatattttttgaagaatttt
taatgattcaatttAATAATTTAATGATAATAGCAACAgtaaataaatgt
ttttttgttattattgttatttttaacagtttttttttttgctacaaAAT
CGAAATCAATCTTCTGCCTGTGTACGAAATTTCTGAAAGCTCAATACTCT
GAATTCACAGTCTGTGCCGTCATAATGAGTTAAAccttttcaaattgaat
ttgagtttttatttttcttgtaaaatataaatgaaTGTCATGAAAAAGGG
TTTTAAAGAGGTACACTTATGGTAGATCTAGAATGTGTTAATATAAAAGA
TTTTAATTCCAAAATACCTAGATGATTTTCAAAACCAAACCCACTtactt
tatgaaaaaataattatctaCACACCTTTTTTTTCCTTTGTACATAGCTC
AATTTTCATGaggttgtttgttttttgaaacTATAAAGAAAGCGCTCAGT
GGGTTTTTATGCGCGATAATAGATAGTCAGTAGGGAAGGCTAGTTCGTGC
AGAATGTTACGCTTATACACGCGTCTGTTCTCTTTAATAGGGACATACGA
AACTTATCagaaatttgttttataaagaAATACATTTATTAAATACAATA
ATTTATAACCACTTTACAATTTACTTTTTGTGTACTTTTTTGCTAATTTT
CAACGAGATTGAAAATAGCAAAATCAAGATTTAACTTTATAGGTTAC
Run BLAST on NCBI

transcript from alignment at sc0000010:761845..782620+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001381 ID=TCONS_00001381|Name=TCONS_00001381|organism=Clytia hemisphaerica|type=transcript|length=20776bp|location=Sequence derived from alignment at sc0000010:761845..782620+ (Clytia hemisphaerica)
TACAACACCAAAATCATCGACCATACAAACTACTTGTGGATGTGGAAACC CATCAGATACGGTAAGTGGCTACAATCTGTGACTAATATTGTGACAAGAA TTTTCTTCCTCCTAGTATCAGTGTTGATGGGTGGAAAGGCTGCCACCATG CTCAGAAAAAGCTCACATCAACACTGATATTAGGGTGGaagagatttttc aagaaattgccctatattttgtcactgattgtagatgcCAAAGTCTGCAT CACTTCTCTTATGGGTACTATAGTGATGCacagtctccataactcgaaca cgcacggggggaacacaaatttgttcgagttcaaggagttatggagtaag gtttataagggaTTGCTAACTGAAAGGACGAGAAAaattgttcgaattaa ggagacatATAAGTTACAGAGGTTCAAGTTAAAGAGAAACTActttatct tgattttttttggatatcGGATCTGGTACAGCAGACAAGCCTTTAGCAGA ATTTTACATGCGACTTATATGGATACTTTTTATGCTTTTTTACTTCATGC TTTTAAATTCCTTGGGTAGGTCTCTTATAGTTTTAAATGGTATACACTCt ttttacactcttttttataagaaacagtaTAGTTTTTATGatgctcggct gttcttatttttttgcactttgagcctcaaattgttcttatcctgttctt attaaTAAGTCATCTTGCAGTATTTAATTGTAATTGAGGTACTTTACACC TACTTTTTACTACCCTTACTACGCTACGCTTTACTACGCTTACTTTGATG TGTTTCTGGCAAGGTTTTTACGATATTCCACCATACTTTACCGTTCAACA TATACTTTGTGCATCATGCATACTTTTTACTCACATGTGACTAATGTGAT GGGTAAAGACTTTGAGCACTGATGAAAACAATCCGTACTTAGTTCTTAGC TCATAAGCAGATTTCATTACAAATGCTAATTTCCCTCTATTCTTTCACAA AATACGGCTAATGTAATAACTTTCGTCTTAATTCAATGATTTACGTGTTT CAATTATCTCGCATTGAAATTAACGCATCTTATCGATGTTTAATTATCTT TCTTGTGAAAAGTTTTACGAGCATGGCTCATAATATGCGTATTTCCTTCA GGGGTGAGTTACGGAAAATCGGGCTTTGGGGTTTTCTATGGTCCTTGATG GTTTTTTAACTGATTTTCATCTTCTTTAACAATAAATGCTCTCATGGTAC ATATATGTTTGGGCCTTCATGAATTGCAATgtcattttaaaaagttttga taatATACTTATGGCACAGTCTACTTATTCATTTTTCAAGAACTCTTTCG ATTCAAAATAGTATCACAGTTGTGAAATCTTGCGTAATAATGGTAAGACA AcagtaattatttttaaaaaaatctcacaTTATTCTgtcttttaaaaaga ttttctgattgACATTGTCAGCATTGCTACTTGATACCTTTTTAAGGCCC TTGTCactctattttatttttaatctattTCCAGTAAGTTTTTCGAGAGA GGCCAAGTTGTTGCTGTTTTTTAAAGATCCGCCCCAAAAATGAgttgaag ttttttttcttaagaTTGCCAAAGTTCTCATCAGGAATAGGGGAAGTAAC AATCCTCTTAATATAATGTAATTTTCTTACCAAATCGAAAAATGAACGGT CTTCAATCAAAAACAAAGGCTGGGATGGCTGGACTACGGATGACTAAAGT GAAGTGATCTCgatgattgaaaaatattttttgcttgcaAAATGAAGGGG CCGTGGTGCAACTCTGTTAagagtttttgtattttgaattgagaattgag aaaaaaaaatcaaaatcaactaatcattttcttttcagaGTCCCTCAAGG ATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTCCGGAGGGATGTCAGA ATATGCACGAAGAGGTGGTCTAAAACAACCTCCGACTGTCGTTGCTCAAT TTCAGGTATGGTTTTCTCTCACATTGTCTCCCCTTGTCATCCCATGTAGT AGTTGTAGTAAGGTTATAAATTTACTTGAAAATTATCATTATTGAAGAGA CGTTACCTTTTGCTACCGTGGATCACCAAGTAGACGTCTTCTTCTATTTA AAAATCATCCTTAAATTTTTCTGCATATTCCTTCGAGCTCATTTGGTATT CTTTATAGCCTAATTAGAATACACGACGGATGTGATGTTGGTGTTGAGGG CGTTACTCTCCTTTTAGTTTAGAGAGTCTTTGTCCAACTTAgtctacaca atatattggcgAACAACACTTGACAATATAATTTGAGGActgtaatgtac gaagtaaacgaCAGGCTCTATTTTAAAGGGTATCTTTGTGTAAACAACCC CTCCCCCCTATATTGTTGAATTATTGCAAATAATCCAACAATATATTACC GGCACAACTAACCAATATATTGTTTAACAATATATATNTGCAAATAATCC AacaatatattgccggcacaATTTACCAATATATTGTTTAACAATATATA TTATGTTGTAGCCCTATAGACTATAATTTTATCATGAGAACGTTCTTTTG TTTCCAGTCTTCACTGATGGAGCTAATGGACGCGTTGAACCAGTCACATC CGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAAGGTGAGTTGACGA ATCTTATTCTGGTGCATTTACAACATTGGTTCCCAAACCGTTCCACGTGT CAATGCTCCTCTATTAAAATGAATTTGTTTGGTATCCTCTAATACAatct tcagcaaaattcctcTTTGATTCGAGATTGTGCTTACGATGAACGAATTT CTGACATAAGAAATAAATCTTTTGAGCAAAACCTTTTTCGTTAAAAAACT GAGAGAACTTTTAAATGAAAGATAACCCTGTACCATGgcctgatgttttt ttttttaatttactaCCTAAAGACATGTTTTAAGTACTCATTACTGAAGA TGCTCACTGCCCCCACAACGTGGTAGCAATTGAACCAATtcttattatta attttttttcataggcACCATTGAAATTCGAGGCGGAGTTAGTTTTACGG CAACTCCGTTATACGGGCATGTTGGAAACTGTGAAAATACGACAGGCTGG TTATCCTGTCCGTATATTCGTTAAGGTGAGTCAGAGTTTCGGTTGGAATT TTCACCTTTTAGGGTTTTAGGGTCTCTCTCGAAAaccatgaaaatcaaaa aacggTCGCTCCGAGTGTCCCTTCTTTTACCCATTTTTCCCTGTGAGGGT CACTTTTTCGTTTAAATTTAATCTCTTTAAAAAGTAAGGGACCAAAGGTC TGACTTTTGCATACCCAACATTTTCATCCCTATACTCCTTCCTCGGGGTT TCTTCTCTAGGGCCATTCCGAAAAATTGTCAACCACGATTCTATGCCCGA TTAAAAGGTGCATGGGTCATGGAGCTCCTAAGTCCCTACTGACGGTATCC AATCAAAAATGAGTGTGACGTAATGTACCCCTTACTCTGGAATGGCCGTC TATCGCTTGGAAAATTTTAAAGCGATTGCCCctttgaattttgataatgg CGCTCTCATCCTGAACAAAAGTTGTGATCATTACCACCAGTGCTAGCTCT GTCACCACAGGTTTGAAATTTATGTCACGTTAAACTTAGTGTAAGAGTGT GTTAGCAACTATATCTGTTCATCTGTTTCCAGCAATTCGTAAACCAATTC CGTATACTCCTACGTGCAAAAGACCTCGACAGAATATCAGAAGACGAATT AACGCAAATGTTGACAGACCTTGGTTTAGACACGGACGAGTTCCAAGTGG GCGCCAACAAAGTTTTCATGCGCGAGTCACAATACCAACTACTACGTGAC AAAATGCAACAAGCGGTTGACCGCGCGGCCACAACTATACAAGTGTGGTA TCACAGGAGATACCTGCGGAAACTGAAAGAGCTGGAAATCTCTAGCGCCA TTATTATACAGGTAATTTTCAAGGATTTCGCTTTATTATGATGTATGAGT AGAGAACGCATTTTCACGATTCGGGCTACTCTAAAGTCCAACGCAAGAAA AACCATGAAGCTTGTTAAATGTTAGGGAGCACCTCACCAAACGGGATGTT CCAACTCGTTTCttggtgagttccactttgacgattttctgaaaaacgaA CCCTTTCAAGTGTCCTGGCGCAATTCGATTTTTCCCTACTGCAGGAACGA AGCTTAAAGTTGTctcgcaaatcgaacgtttggaGCCCGtaaaaaagtcg caaagtggaatagatgttaattgcgtagaaagaATGCGGGTGGTGTCTAG TATATGCTAGCCAAATGCGTCTTTTTGGTCTTCACAATAACAAGTTTTGA TCTTCTCATATAATAGATGTATTCACCTTTCTGACACTGCAAATCTACTG AAACATTTCCATATAAACTATTTTATTCGCACCTTTTTCACAAATGTACA GAAATATTGGCGTGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAG AGACGCGGCTACGTAACAGGTCCGCACGGCgtattcaaaacttttggaGA ACTCACGAACAGACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAA AAGGAACGTCATCAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGA ATGAGTAAGCTTTTTTCACTGGGAAACTTTCCTTGATTGATCAGATTCGG TACGGGTTTCATGTAACTCTTGACTAGGCTGCTAGCATCATTCTGATTCT AACAAAATCATACCATGATCTACGAGAAATCATTTCCAATAAAANTCTAG GCTGCTAGCATCCTTCTGATTCTAACAAAATCATACCATGATCTCCTACG AGAAATCATttccaataaaaaaacttttacataCATACTTTTCTGATCCT TTTGGAATTACTAGTCATTAACTGTTCCTGATTATTCCTTTTTAGCTATC CTAAGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGG TACCCTAGCTATTTTAAGAGgaaatttcttctttatttatTCTATTATGT CGTACCATGTTCAGCACATTCAACACCTCAACTGTACATAGCTTGTTTTC TTAACCAGCACTTTTCTTACCTTGCACCTAACTAAAAAAGAACCAGCAAA CTTTCGTTGACAGTCTTGGTGCATATAACCCCAACCATACCATTTAATCT TTAAGTAGGAATCAATCGCATTTTGATAAATTAAAGACCATATTTTCCGA AagcaaatttcttcaaaattatcAAACTTACTTGCAGCGAAAAGTCTGAT AAAAGTGATGAGACTCAACATCTTACTAAAGAACCCATCCAACAACCGCC ACTACCGCCATCTCAAAGAAGAGATCCGCCCGACCTACCGCCCGGTCTAC CCTTCGATTCCACCCACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACT GTTACCATCACATGTGCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAAC CATTACGTAAGGGCCTCTCGTATTTGAACCCATaaaaaacatctaaaatt ttgtttacTAATTTTCATGCATGCTTCAATCATATAAATACATACAATTA TACACATGTTCATTCTTAAGAAagtccaaaaaatttaaaaacacgGATGA TGGTACTTCCCGTTCACATNActcattgggctcttccagaaaaagtccgt tcattgggggtggaggatgaagaattgtccaggggtattgaaaaaaagcc aaaaaattgcaatgtccaggggggtaaattccaatgtccaggggtaattt tttgtgtccacggggttgatttgatgtttgtccaggggttgatttgatgt ttgtccaggggtataacccgtgtccagggggttaaaaatcaaaatgtcca ggggtaattcatgaaaataataatatatcctccaccccccatgaacagat tttttctggaagagcccattcttaagaaagtccaaaaaatttaaaaacac gGATGATGGTACTTCCCGTTCCCATAACTATTTGGCTATAAGACGGTTTT CCATTGAGCTTAATTTCCTCTCGGGTTGAGTTTTTCTTGGACTGAATTTT CATCTAgttaaattgcttaaaaaagtcaGTTACAAGCCAATTTGTTATGA TGTAACATCATCCGAGATAGTAAAGAGAACATATTCCGGCTTTTCACTAA GAAAGCAatacaaaaatgatttgatATTGCAACGAATCAATTCGCCAAAG CATGATCGCATGttataaaacaacaacaaaaaaacacatTAATGGAATGA ATTTAGCCACACACATACACATACATACAATCTACTAATGGTTAACATTC GATAATCAACAGCACGCTTCTCTTCACCCACCCTCTCCTATTTTCCAACA TGGTGTTATCACAAtaaggccttttcataaataatTTTGAGTGCAACCAT TGCCTCATTTTAAAACCGTTACCAAGGGAATTAAATCCCTtgagttttta agtttttcttttataaatagagtaaatttctatgaaattgaaaattaatt tgaaaacgaggtaaatgttgctcgtgacgtaatttatgaaaaggtctatt ataggccatttcacagtcgcaaagcgtaatgggtaatcagtaccactgcg cgctaataacgacttactattggtctaaagttttgaaaaaaattgaagat ttttgcgtctagccaacgggaagccgtaatggaggcgcaatcagtcctga ttacccatgatccatttcgactgtgaaatggcctattctCAGATCGATTG TgctcatattggtttcggaacgtttcgaatcaagaaaacgaaGCAGCTTC GTTCCGAAGTTtatagtggagcgaaaccgttttgatctgttttgctttgt gaCGTCTTCTTTTTTAACGTTTCCAATTTTGACGGTCACactttcggaac cgtttcgtttcggaacaaTATGGAACCgcaacgtctgaacatggtctcat ATCGGCTTCCGTTATCAGAGCGtggtggtcctgattacccataattCCTT TCGACCGTTAAATGGTCTATCGTGCTTGTAATgtaagaaattttcaagaa ttaGATCATTCGCAAACTCCCGTGTGATTTGATGGGATTTAATTCTGCGA ATTGAATTCATTCATTTTACGGAAATTAAATTTTCGAAACGTtgtaaaag aagaaatataaGAATCTGATCGTCGTAGGAAGAgggtttggtcaattttt ctgATCGCGAAAATTTCTCACATTAAAAAATTACTCGTTTACATTTTATT AATGTAACGgttatacagttgacgctctctaattcgacgttctattattc gatatgGCCGAACATTCGATAATTTTGAAGAAACACTCATAAACGATGCT CTGcttttcgatacgctcccttattcaatgaaaatccaattcttcttaaa gatcgaattagagaatgtCAACTTTAGTTCGATTATGGATTTTTAGAACT CCTTATATCCAAGTTTACCAACCTCTTATTCCAGGGAGAAGGCGGACAAT ATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGATTCGCAAAAAGA ACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACGTTGGCGTTAAgc taaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAA CCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTCTGACGGTCATTT ATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAACGTCGGACATTG AAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAATTAAGACACAAA GACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAGACGCTTATCGTT CACTCATAAAGACAAAAGTAAATCTAGTATACACTTAAGGAAGTCTAGAG AAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGTAGTGAACTTTTA CAACCTGTCAATGTGGTTAAGAACACGACAACTGGCATTACGACGCCGGC GTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATACACCAAAAGCAA CGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGGTCGAGAAGAGAT ACTCCCAAAGGTAAGTTAATGGACAAGGCTGGAATGGGGGCTCATTTATA TTGTCTGTATTTCATGTTTCGCCATTGTTCCTAGGGCCCCTTGTGACACG GAAATCGTGTATAAAACGCTAGATGGAGCTTCTAGCTTCCTAGCTGAAGA AAATAATGTGCCATCTATATAAGTAGAAAACAGCTCGATACCGGCCATTT GATCAATCAAGAGCATTCTCTCCCCTCCCCGTTCCAGCCATGTCAGAAAT TCGTGAATGATAAATTGGGTGTTTTCAGTAAAAGATTCTTTTAGCGAATT GGACCACAGTGCTTGTTTCCTCTCGAAATGACGAAACCTCATTGGTTAAA AGGTacatcaaatgttttttttcgttGTGAAGAATTCGCCACCTCATCAA ACGCTACTCGTCTCTTTCAGACAAACGAAGTCACAGACGATCTTTGACAG CGGCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTT AATGGATTCCTCATGAAAAAGGTATGTATGACACACTGGACACGAcgaaa aacctcaaaaaaccTCAAGAAAACCTCATTCGAGTCTTTATTTCTCAAAA TCGaaagttagctaaattatgacttcataaaagtgcaaattatgacgtca cttgaCTCTAGctcgatttttcaaaaaaggattttcgagttagctaactc tgTTTCTTTTTTCACAAAGCCTCGANGAAAAAGGTATGTATGACACACTG GACACGAcgaaaaacctcaaaaaaccTCAAGAAAACCTCATTCGAGTCTT TATTTCTCAAAATCGaaagttagctaaattatgacttcataaaagtgcaa attatgacgtcacttgaCTCTAGctcgatttttcaaaaaaggattttcga gttagctaactctgTTTCTTTTTTCACGAAGcctcgagaaaaaaatattc gaGTTAATTCTAACTTTAAAAttctaatttaaaatttctaatcctttttt aaaaatgaaaaattgagttagagtcgagtgacgtcataatttagctaact cgaaaattgcttaatcgaagttttctaactcgaagattccgGGCCTCCAT TTTTGCTTAcagatttatttgaaaatcaagTCAATAAAAGTTACGGGCCA CTGCGGCTGATTTATGACGTTATCAATGAATAAACGTTGACTTTATTTCA AACATTTACACTTGTATTCAACtgtaatctttataaattttagGTAGCAG ATATGAACAAACCTGACCCTGAGAAGAAGAACGATTCGGGTGCTGACGTC ACTTTCAAACACGCGTTACATAAATATCACGGAAATTTGTTATTCACGTG TGCTAACGCTTCTGTCAATGTAAGAGTTTTGAACTTGGAGTATATTTAAG TTTTTATCAACATGTGATTCGCTTGTCCCTTAAACAGTCAAATGTACTTT GTACTTAGGAGCTGAATTTGCCAATTTAATCTCAGTCAGTAAatctatga ttttttttaattttaagtatTAAAAATCGCCACTGAAATTAAACGATCTA GAATCTTGAATAAATATTGTGGCAAGAATTCCCTCCCCCCCTAGTATCAA TGTTTATGGTTGGAAAGGCTGCCACCATGCTCAGAAAAAGCTCACATCAA CACTGATATTAGGGGGGAAAtggatttttcaagaaaagatTTCTTGATGC TTATACTATGTGATTCCCAATTTCAGCGCAAAGAAGAGATTCTACTGAAA TTCAATGACTTGGTTCATGGCTTCCAAGAGACGCTCGAGCAAATCATCAA CCAGGCGGATTCGGGTGTCTCTAaagaattttctgtcatggGCGTCAACC TTTTCCGAGGAATTCTGGAAGAGTTCCAAAAGAacaagtaaattttttca agtgTAAAATTCGATCCTATTTGAATTTCCATACAACCTTTTCCATTATC GAGATAACTTgatttaatcggattaattttcacgaatttctcgaattttt tgccttttttctcACAAAAGTAAATCTCAAGACATCACGTGAAATTGCTG ACTCGCAAAATTTAACCCACCCTAAATTGCATATTAGATTCTCGGTCAAG AATACACTGtctgttttgtattttttacgAAAAATTGCTCCAGAAATTTT TGTAATTGCTATAGTTCGTGAAAATAAATCCAGAAAACTTCGCGAAAATT GAACATCCATTTCGTTTTGAGATCTAACTGACCGAGAAGTTTTTAATTTg gatcaaaagaaatttttatggAGTAAACCCCTTTAAATTATTTCACAGGT AGAAACTACTTcatgattttctgattttaattttcttttgttgtttttta ggGATAAACTGGTCGTGAAGACGGTATGTACTATGTTTCACtcaacacgt ttttttataagaacaaactatataagaacatctagATTTGGATTTAATAA CATTTGAAGGATTCATGGACTCTTAAAATActcaaattttttagaaaatg gcacaaaatactcacaaaatggtgaaacgaagaacattttaagaacattt taaggcttaaaactgaaatgttaagaacatacgaaagcttcaaaaatttt ggacgttTTTATTATGTTCTAAATCAAAAAATGTACTCTATCTTCTTTAT TGAAAACTACTGGATTgaccatattttcaaaattgttttgatcaattttt aaatCGTTTTCATGTCTCATGGAAGATGGAAAACATGCGCTGACAGAGAT AAatcttatttctttatttttctcagAGGTCGAATATAAAACATGTAAAG AAAAAACGAAGGAAAACGGCTGAATTTTACGTAAGTTATGTTATCTATCT GGTTGTATCATCTTCCTTGCTACGTCGCCGGGGCTATACTCCCCAaccca gcaaaaaaaaattattgataccTAATCCGATCGAATggaaattgattgaa attcaatttaacataaatcttttaatttgtattttttatgttgttttttt tcaggagCACAAAGGACACGTTTatacatttcaaaatttcaacataCGCA CTTACTGCGAATATTGCAATTCCTACATCTACGATAAAGGCTTGGTTTGC CAAGGTAAAAAGTGTATAAATtccttgaaaataatatttttacgaAAAAA TGGTCCCATGAGAAAAGCATGTTTTGGTATACTTTCTATTATTGAATGGT GGCAACTGggatttttattatattattctTTTATTCCTTTTTCTTGTAAC TTTTAGCTTGCGCGTTCACTTGTCATAAAAAGTGTCATAGTAAATACCCA AAGACCTGTAAAGGGAGGCGACCTTCACTTTGTGGCCCTTCAACGGTAAG CGTTTTGcagtgttgcaacttttccgTCTGTAGACGGATATCCGTCCAGT TGAGATACAAATATATCATTTCCCTCTTGCCAGTAAGAGGGTTTTGGTTC AAATGACCATCTAATCCTAAGGTTTCCGTCCATATTCACAAAACCTAGTT GCAACACTGATTTTGAGTAATCTTTTTCTTGCTAGAATGTCTCAATGTTC tttcgggtgcctaataaactggggggggggttcaaaaTAAAAGGGTGGag taaagattttttcaaatttgaataaacgGAGGATCTTAATTGCCGGAGTG TAATAATTACTTATATTGTACTTCTGAAAGCCCTAAAATTGGGGTATAAT ATAAATATAGGCTAGAATCAGGTTGATcagagcaaaataagagacttgTG AGCTAACAAAGTGTTGTTCTTGGCGTGCGATAAATCTAAGATTTGTGTAT ACGGTTTTAATAATGATGCCTAATGTGTTTTGATATCCGCTAACATagct aaatatttcaaaaattaaaaaacggggggtcctaataaggtctaCGGAGG GGTGgaataaaatcgaaaaaatattaGGCATCTGAGAATATCTGTATTTA AGAATGGTTTCCAATCTAACATACCACTCTTCGTTACTTTCCCACCAAAC TTAAATCTTTGATACTCTGAAGAAATCATATTTTTGTACTTTACAATTTC ATTTATTATTATACTCATTTACATTCTTTAGCTATTTGGAACGCCCATGT CAGAATTGACTAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTC ATGATCGAAATCgaaaaaagaggtatgaaataaaacttttattatGGGCT TTATATATTTCCAAttcgtgatatgcaccactgcaatgtcttctgacatt acgtcatggaaccaatagctcattggttggaagtgacgtaaaagcagtca atacgtcactttcaaccaatcagctactgggtggaacggaagacattgca atggtgcgtATCATGAATAAGAAGTTACAGTCAACTCTCACTAATTCGGA CTTGTCCAGGAgatctaatttgttcgaattacagaaagattcgaactatg gagaggttttttttttaatctcctGCTGATGGTAACCGAAAGTTATATCG AATTATCGAAAGATTCgagaaaagaagtttgaataaGCGACATTTCTCTG CATCACCAGTACACTGTCGATTCGTTTCACAATTTTCACGGGAGTCAAAT CACAATGTTCATTCAACCTATTGTTTTTTCTACCCATTCATTTAGGTCTA TACACGTTAGGAATATACAGAAAACCTGGACCACAAGCAGCAATCAATAA TTTGAAAAGCGTCCTGACGTCTACCGGTAAGTGCAAACatttataaaaaa ccccggtccggaaagcttttgtttctttctattggTAACAGTTAAGAGCT TTCGTACGTCATAGCTTTGCATATTTTTAATCACGTGACTTGAAAATAAA CTAGTCTCAAAAGTCGAATATGACAACGTggtcaaaaagtatgcaaattg CAACTTGTCTTTTATCGGACAACAGAAAACTTGACGATAAAGTTGAAACA ATTTACCAGATCCTGTTTTTTACAATGACTTTCGTTCGGACTTCATTAAA TAGCTTGTAATCAGAAGTACCTAAGACAAAAATATTAGACTAGAGTATAC TTCTGACTGGAATTGGCTTTGCgtttatttttgatgacgctgtaGCCATG TGTTTATCAATCCTTACGTCAAAATCCGTGTATGAGATGGGGGAGAGGGG ATTGAGTTCGAGTTTAACAGGGTAAAATGATATGAAAAAGTCTGAAGTCG TCACATGAACAGACATGCTACGTTCAAATCAACCCTTGTTAACTAAAACC CAATCCTCTCGTAAGATGTTTCACGTGTACAGTAGAGTCTTCATAACTCG CATGTCTCctcaactcgaacaaattttctggTCTCTTCAGTTGATAATGC CTAATAAACAAATCTCAATTACTCGAAACTTCCataccgtaaatcaccga ttaagcgccccgcttgaattatcgccccgctcgaataagcgccccccatt tagttaaaataattttataagcgccccgctcgaataagcgcccccctttg aataagcgcccccctccAGGGAGGGGCACTTATTCGAATTGGTGGCATAG GCTAATTTCCGGGATAAGAATTTCTCTTCAGATGATTAACAGtcgaaaaa aattaacttgTTATTGAAGAAGATGAAGACGAGGACAAAgatattgttat tgattgaataagatattgtcttaaaaagaaaaaaacgattaagaataaaa tgatagaaattgtcaattggatttttcttttattNCTTCTCAACTCAAGC AAGACTTGAGCGAAAAGTTTATCGTCGGTATAATTGCAGTATATTTAACA GGAACCACAAGGCcgatttctctttttctttttccagtgACTTCTGCCAT CAAATTATTAAGTTAAGTTaagttaagtttaagcagattccgaatttgtt gatatacgaatttctgaaataaaaaaataagcgccccgcttgaataagtg ccccgcttgaataagcgcctccctcagagcctgaaaaattaaacaagCGC CCGGGTgcttaatcggtgatttacgCTAATCCGAATAAATTTCTGtttcc cgtgcgtgttcgagatatggagactccactgtattaaGCTCTAACGTCTA AATCTGCATGAAAAGGCTCAACATCCCAGGGTAGAATGATATCCAAACGC CTGAATTCGTCACAGGAACACAATATTGACGTTCGATCAACCCTTGTTAA CTAACACCTTCAAACCTAGTGTCTTAGgtgttttaaacttttaaaggtct tatttttacataagtgttcccgtttcatatcagacacatgtaaCATATAA GGGCAGTATCTGcattttgttatattatgctgatataaacaaaaaaatgt ttttcctttcctctttctgaccaatcttgctccacatccgtgtcaattca atataaaaaagcttgtaaattaaaattgacgagtaagcatactatatcac tcttattcaaaaacaaaacctttagaaTCTATTGTTTATTCTCATTACAA CTGTAGAAGCGGAAGAATTAATCTTGGAAGATGAGAAACCACACACGTTA GCGTCAATACTGAAGTTGTTTTTCCGTCAACTACCTCAACCGATTATACC TTTCAATTACTACGATGACTTCATACGATCTACAGGTAACTACGTTCTCT TTCGTTTGGAGTTCCATCATTTCTATGAGATATGAGATATGAGATATGAA CTATGAGATCATGATTTTGNTGTTCCATAATTTATATGAGATATGAGATA TGAGATATGACATGTACTTAACTTTCATAAAGATtaaagaaaagttttat ttcttttcaatactcgGAGTTGCCTGcttaccccggggggggggcacgcg atttcgaaaattttgccgcgcaaaatctgcttttcaaaatcgtaccctta caatgcagttcaatatggctaaAAAGATACCCTGTCAGTGCATTTCCTCT TGATTTACCCATCCCCTATAGTGTACtgtatttctcagctgtaaatttgt gtgaaaaaagaagcttgggaaattttctgttttaaataaaaactgagaaa aatattcttgtcagctgtaattatcatacaatagaaactttttcaaacaa acgagaagtaaaaatttttttctttatcaaattattttgattttgtttta aaattctacccttgcagtgcaatctcacaggaACACACACTTACAGTGCA TTCTGGATGCTGAAAACCcaacccttaagcgcggcacatgacgtaggcca gatcatatgagtgtcCCCCCGGGCTGCTTACGCactcatcagttgattag aaacttactttactctccataGTTTGCTTGATGATTTGAATTGGGTGTTC ATTCATAAGCGATgaactttttattcatttttcatttttttagacTTGGA AAACAAGAAAGAAATTCATTCCACGCTCTACGAACTGATTCAACATTTAC CAAAAGAGAATAAATTATTATTAGAAAGACTTATCGTACATTTAGGAAGG TGAGAAGGATATAAGTtctcatttttttggaaaatagatTCCAAATTTCG GCATTTTtcataaagatataaaaaatggGCTTATCTGTTTgttgttatct tttttccgtCTAAGAAGAAAATACTTAATCACTGATTTTGATGTTCATGG TGAAATATCATTGTATTCATTTCTATCTTTCGAAAGTAGTCTTCGGCTGG AATTTCAAATGGTCGAAAACAATTCCAACGtttatttcataaaatctttt ttctataGACTGGGACCCAGAATGTTTACATTGAGGCCAAACACTTTTAG TTTTAGAGTTTGTAACGAAAATAAGTACTACTCAATCCTCAATgatttta attatttgaacaCTGGATTCTTTTTTCCTTTCAGAGTAACTTCATTAGTG GAGCACAACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTG TTTATTGAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGT TGCCAAAACAAACAAAGTAAGAATATCTTAGGTTTTGCATCAGAAATTCC TACATAACCAAATATATGCAGTACTTTGACACAAAACTTTCAGCTCTCTT GCCGTCTATCGACTTAACATTTAAAATTAAGGTTCTATAATATTATCTAC TCGTTTTTGGAACCACCCACTCATCCTACAGGTTTAGAATACcttcctaa aatatttttttttcttcattgtaatgaggcccccagcggaccttcaattc acgcaatcacgcaattttttttcgaaattcacgcattcacgcaaattttc ctcgagtttcacgcaataatccgatttttcagaaatcggaaagtattttg tgaaaaatcggggaaacattggaaaatcgagaaaactgcacataattggt ggaaaaaagggaaaattcacgtattcacgcacaaaatagcccagattcac gcattcacgcaatcgaAAAGTACATTTTcccgttcacgcaagttttttca attcacgcattcacgctttttttttttaattttcacgcattcacgcattc gaaaagtacattttcacgttcacgcaagtttttttaattcacgcattcac gctttttttttttaattttcacgcattcacgcaaccaaaaatgcccattc acgcaatcacgcaaaccgcGGGGCCTCTGTAATATCAATCTAGTACCGGT CTCCTTTTTTTAGATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATCA CGGAAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTAC AGCAGGAGAGAAGCTGGACGACATCATTGTAAGTATTATCGATGAATTTG TACTTTAATggtttaaattttgcggatttctcggatttgggtgtcatccg ccaaattaaggccgattggaaatttggaaagattGAAATATCTTAaatta aaacttcaaaatgtcaAGTGAGCtcctttttgaatgtttactggcatctt AGGAGCGCTAATAAAGcgaatttcaacaaccaacatgcatgatttggccG TAAAAGGCAAACAAAATCGTGAAGATATTGTCTCTCAATCGTGCCACcgg cgaaattaagtccccgcggaTGAGCTCAATCGCGAAATCTAATCCCTGTG AAACTTTATTCCATTTAAATATGCGTTTATAAATCTTCTGACTTccacat caaaacaaacactgCCTCGATTTTTTCAACAAACCTATGTCGATACATAA TTTCGGTATATAATTTAAAATCAAGTGAGAACTTTAATTTGCTTTTCTTC AGCAATCGGAAGAAACAGATGGCGATCCCGAgaagaataaagaaaatgac gaaatgaaagaaatcttGAAAGCTCAAATACAAAACATGAGCACAGAAAG GTAAGAGTGCGTGCAATTCAACTCAATTCTAGAGCAAACATTCAATGGAC CAACCCCTAATGGTCGATTCAtacttaaaagaaaaaaacgtaccATCTTC ATGATGTTACTCGCTATTATAACTCACTCTGAGGGCATTGTAgtgtattt gacgtcaattttgctGGCATAAATGATAGCTAACCGGGCTAAATACAATT TCAGATTTTGCTTTCTAAAgtcaatattttgttttgaaaagtagaaaaaa gcATTCATCTTAATTGTCCATAGAATGGACCCTTTATTGTTAAGTATGCC CTCTTCTTCGACTAAGACATAAATATCACTGGCGGGCCATAAATGAACAA TCGCGGGCATAGCGTTATTGGTATATTTAAGGTTGGTTTGTATAATAAGA GAAGGATTTTAAAACAACAAATGTATTTTTTGAGAACGATAGTTTACTTA GCCTGACCAAAGCCGCTGACATCTCTTAAAATATAGGCAAATGTTGAAAG CTAACTTTGTGAtatattttgcttttatttccGCCAGGGAGAGGATCACA AATAACATGGCCGCCATTTCACCGCCCAAGACACGCTCTTTAGATTCTGT CGATGATCTAACGGATATGGACTATCATTTAAGAGATAGTTTTGAAGTAC TGCATTTCCCTGAAGGTATGTGCTGATGCTCTGATTTCAGTATTTTGTAT TTTAGCTTATTGGCTCTTTTTACGTCGCCCCTTATTAGCATGATTATTCC GTCATTGGTGTAATAACGGCTGATGTAAGAGATCGGTATTGAATTAGGGC CGggttaaaatggaaaaaatttagCTTTGGTGTAATAAATGCCGCCAATT ATGGGGACGATGAGGTATGTAATTAACGCCATTAACCTTGTTTTTCggtc aaattttttggatgaaattgttaccttattggtatatattttcgcgtgtt acaaattttcgcgggtacttaatttcgcgagttttttggtcaattttcgc gaaatttaatactgtttaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaatc agtctttttcttgctttatattccgaatcgcgaaatttaatacacgcgaa aattttccagaagtctgcaatcgcgaaatttaatacacgcgaagcacgtt ttttcgaaaaaattttgcgattcgcgaaaatttgtaacacgcgaaaatat ataccaataaggtagtcTAGTATGCTATGCGACATAGTCAGATAAAGTAA GAAATAGGAGAAAGAACAACAAATTGATATTATTCCTTAACAATAATGGT ATAATACATACAATACCTATATTTCTGTATTACACGATTGATTTACATTG ATTTCTCTACCACTTTTAATGAACGAATTTGTTCTGATATTGTTAGCTCG TTTGTGTAAAGCTTCAATTACTTTTTCAAGTTGATGATTTATCATATATA CTTATTGATTAATTTCGattttctctgttttttttttctattagatGGTG ACCATATTTCTGTTACACGACAATCTAGCGTTATGGACATTTCAAACGAA ACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTCGACGGCAATTC GTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAAGTAATCTCCTG CTAAAACGtaactttaatttttctaaaggaTCTTCTACTCATTTGTCTgt ctttcttatattttttcaaacaatgtgttctttttttaaaagataattta aattattttagaaattcTTCTAGTTTACCCTTTCTCTTCTTTTTCGGTCC TTGTTGAATTCGAGTCGagtcatccaaaaaataaaGCTTTGTTACGTCCA TTGAGGCACTAGCtgacttttttaaagaaatatttcaaattttttgtctt ttgactTTTTTCCAGGGTTTCATCGGGCTCATCTACGGGGTTGGAATAGA AAATAATAGggatataaaatattttttaacattttaaaaagACATGGCTT TTATTACAAACTTCGttagtgaatttttaaaaatcaattttttttttcat ttttttttttcaaagtcagTCAGAAAGATGTTTTTTATATTGTGAAACAG AAATGATCAAATAATGAAGCTACATtgtaaagaaatcaaaaagaaagcaA AGGTTGACTAAATGAATACACGTGTTTCTATGTAAGAATAATGAAAGTTT GAGGCCAAATCATCCTCTCAGGACCTGATTAGTCATCCTATCTATACTCG ATTtagaagaatattttttgaagaatttttaatgattcaatttAATAATT TAATGATAATAGCAACAgtaaataaatgtttttttgttattattgttatt tttaacagtttttttttttgctacaaAATCGAAATCAATCTTCTGCCTGT GTACGAAATTTCTGAAAGCTCAATACTCTGAATTCACAGTCTGTGCCGTC ATAATGAGTTAAAccttttcaaattgaatttgagtttttatttttcttgt aaaatataaatgaaTGTCATGAAAAAGGGTTTTAAAGAGGTACACTTATG GTAGATCTAGAATGTGTTAATATAAAAGATTTTAATTCCAAAATACCTAG ATGATTTTCAAAACCAAACCCACTtactttatgaaaaaataattatctaC ACACCTTTTTTTTCCTTTGTACATAGCTCAATTTTCATGaggttgtttgt tttttgaaacTATAAAGAAAGCGCTCAGTGGGTTTTTATGCGCGATAATA GATAGTCAGTAGGGAAGGCTAGTTCGTGCAGAATGTTACGCTTATACACG CGTCTGTTCTCTTTAATAGGGACATACGAAACTTATCagaaatttgtttt ataaagaAATACATTTATTAAATACAATAATTTATAACCACTTTACAATT TACTTTTTGTGTACTTTTTTGCTAATTTTCAACGAGATTGAAAATAGCAA AATCAAGATTTAACTTTATAGGTTAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000735XLOC_000735Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001381-exon-sc0000010-1491911889:761845..761905TCONS_00001381-exon-sc0000010-1491911889:761845..761905Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:761845..761905TCONS_00001381-exon-sc0000010-1510915933:761845..761905Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:761845..761905TCONS_00001381-exon-sc0000010-1575043694:761845..761905Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:763733..763849TCONS_00001381-exon-sc0000010-1491911889:763733..763849Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:763733..763849TCONS_00001381-exon-sc0000010-1510915933:763733..763849Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:763733..763849TCONS_00001381-exon-sc0000010-1575043694:763733..763849Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:764452..764532TCONS_00001381-exon-sc0000010-1491911889:764452..764532Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:764452..764532TCONS_00001381-exon-sc0000010-1510915933:764452..764532Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:764452..764532TCONS_00001381-exon-sc0000010-1575043694:764452..764532Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:764909..765019TCONS_00001381-exon-sc0000010-1491911889:764909..765019Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:764909..765019TCONS_00001381-exon-sc0000010-1510915933:764909..765019Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:764909..765019TCONS_00001381-exon-sc0000010-1575043694:764909..765019Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:765577..765855TCONS_00001381-exon-sc0000010-1491911889:765577..765855Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:765577..765855TCONS_00001381-exon-sc0000010-1510915933:765577..765855Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:765577..765855TCONS_00001381-exon-sc0000010-1575043694:765577..765855Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:766346..766548TCONS_00001381-exon-sc0000010-1491911889:766346..766548Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:766346..766548TCONS_00001381-exon-sc0000010-1510915933:766346..766548Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:766346..766548TCONS_00001381-exon-sc0000010-1575043694:766346..766548Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:766840..766893TCONS_00001381-exon-sc0000010-1491911889:766840..766893Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:766840..766893TCONS_00001381-exon-sc0000010-1510915933:766840..766893Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:766840..766893TCONS_00001381-exon-sc0000010-1575043694:766840..766893Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:769429..770054TCONS_00001381-exon-sc0000010-1491911889:769429..770054Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:769429..770054TCONS_00001381-exon-sc0000010-1510915933:769429..770054Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:769429..770054TCONS_00001381-exon-sc0000010-1575043694:769429..770054Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:770465..770565TCONS_00001381-exon-sc0000010-1491911889:770465..770565Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:770465..770565TCONS_00001381-exon-sc0000010-1510915933:770465..770565Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:770465..770565TCONS_00001381-exon-sc0000010-1575043694:770465..770565Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:771288..771413TCONS_00001381-exon-sc0000010-1491911889:771288..771413Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:771288..771413TCONS_00001381-exon-sc0000010-1510915933:771288..771413Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:771288..771413TCONS_00001381-exon-sc0000010-1575043694:771288..771413Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:771771..771931TCONS_00001381-exon-sc0000010-1491911889:771771..771931Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:771771..771931TCONS_00001381-exon-sc0000010-1510915933:771771..771931Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:771771..771931TCONS_00001381-exon-sc0000010-1575043694:771771..771931Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:772396..772417TCONS_00001381-exon-sc0000010-1491911889:772396..772417Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:772396..772417TCONS_00001381-exon-sc0000010-1510915933:772396..772417Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:772396..772417TCONS_00001381-exon-sc0000010-1575043694:772396..772417Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:772821..772874TCONS_00001381-exon-sc0000010-1491911889:772821..772874Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:772821..772874TCONS_00001381-exon-sc0000010-1510915933:772821..772874Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:772821..772874TCONS_00001381-exon-sc0000010-1575043694:772821..772874Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:773049..773148TCONS_00001381-exon-sc0000010-1491911889:773049..773148Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:773049..773148TCONS_00001381-exon-sc0000010-1510915933:773049..773148Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:773049..773148TCONS_00001381-exon-sc0000010-1575043694:773049..773148Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:773301..773389TCONS_00001381-exon-sc0000010-1491911889:773301..773389Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:773301..773389TCONS_00001381-exon-sc0000010-1510915933:773301..773389Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:773301..773389TCONS_00001381-exon-sc0000010-1575043694:773301..773389Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:774126..774216TCONS_00001381-exon-sc0000010-1491911889:774126..774216Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:774126..774216TCONS_00001381-exon-sc0000010-1510915933:774126..774216Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:774126..774216TCONS_00001381-exon-sc0000010-1575043694:774126..774216Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:774690..774770TCONS_00001381-exon-sc0000010-1491911889:774690..774770Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:774690..774770TCONS_00001381-exon-sc0000010-1510915933:774690..774770Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:774690..774770TCONS_00001381-exon-sc0000010-1575043694:774690..774770Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:776551..776679TCONS_00001381-exon-sc0000010-1491911889:776551..776679Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:776551..776679TCONS_00001381-exon-sc0000010-1510915933:776551..776679Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:776551..776679TCONS_00001381-exon-sc0000010-1575043694:776551..776679Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:777438..777543TCONS_00001381-exon-sc0000010-1491911889:777438..777543Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:777438..777543TCONS_00001381-exon-sc0000010-1510915933:777438..777543Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:777438..777543TCONS_00001381-exon-sc0000010-1575043694:777438..777543Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:777929..778060TCONS_00001381-exon-sc0000010-1491911889:777929..778060Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:777929..778060TCONS_00001381-exon-sc0000010-1510915933:777929..778060Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:777929..778060TCONS_00001381-exon-sc0000010-1575043694:777929..778060Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:778758..778872TCONS_00001381-exon-sc0000010-1491911889:778758..778872Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:778758..778872TCONS_00001381-exon-sc0000010-1510915933:778758..778872Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:778758..778872TCONS_00001381-exon-sc0000010-1575043694:778758..778872Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:779347..779444TCONS_00001381-exon-sc0000010-1491911889:779347..779444Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:779347..779444TCONS_00001381-exon-sc0000010-1510915933:779347..779444Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:779347..779444TCONS_00001381-exon-sc0000010-1575043694:779347..779444Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:779982..780109TCONS_00001381-exon-sc0000010-1491911889:779982..780109Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:779982..780109TCONS_00001381-exon-sc0000010-1510915933:779982..780109Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:779982..780109TCONS_00001381-exon-sc0000010-1575043694:779982..780109Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1491911889:781139..782620TCONS_00001381-exon-sc0000010-1491911889:781139..782620Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1510915933:781139..782620TCONS_00001381-exon-sc0000010-1510915933:781139..782620Clytia hemisphaericaexon
TCONS_00001381-exon-sc0000010-1575043694:781139..782620TCONS_00001381-exon-sc0000010-1575043694:781139..782620Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:761845..782620 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.192539 0.036164 0.17128 0.331258 1.76401 2.57303 13.2972 16.8601 11.1441 13.3378 5.69459 11.1099 4.77207 3.89141 5.03463 4.95757 4.83671 3.17216 3.67334 2.66671 0.176612 0.0664255 0.708561 0.237224 2.73795 2.21657 1.66704 6.32797 1.27669 0.941002
Blast
BLAST of TCONS_00001381 vs. Swiss-Prot (Human)
Match: MYO9A (Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2)

HSP 1 Score: 244.973 bits (624), Expect = 4.784e-65
Identity = 165/453 (36.42%), Postives = 251/453 (55.41%), Query Frame = 2
Query: 1529 KDKRSHRRSLTAAENDYVANGEVE-------LEALNGFLMKKVADMNKPDPEKKNDSGADVTFKHALHKYHGNLLFTCANASVNRKEEILLKFNDLVHGFQETLEQI--INQADSGVSKEFSVMGVNLFRGILEEFQKN-KDKLVVKTRSNIKHVKKKRRKTAEFYE-HKGHVYTFQNFNIRTYCEYCNS--YIYDKGLVCQACAFTCHKKCHSKYPKTC-KGRRPSLCGPSTLFGTPMSELTSPNNPIPETVIKLMIEIEKRGLYTLGIYRKPGPQAAINNLKSVLTSTEAEELILEDEKPHTLASILKLFFRQLPQPIIPFNYYDDFIRSTDLENKKEIHSTLYELIQHLPKENKLLLERLIVHLGRVTSLVEHNKMSPNALAIVWAPCLLRASEDADPLESLAQLPKQTKCVEILIEFQVKSRKDMLNDIQALYRAESTAGEKLDDIIQS 2845
            K KRS + S  A ++ +  N  V+       L++++ FL+KKV D++  D +K  D+  DV FK AL ++  N+ F+  ++++   +   +++ DL   F++ LE+   + Q DS       V  VN F+  L+E+    K      T+      KK+R+K  +  E H GH++    ++I TYCEYC+S  +I D+  VC+ C + CHKKC  K    C K   P L   S  FG  +S LTS +  +P  V KL+  IE  GLYT GIYRK G    I  L+  L  T+AE + L+D   H +AS+ K + R LP P++ F  Y++F+R+  L+ +KE    +Y +I  L + +   LERLI HL R+    + N+MS NALAIV+APC+LR  +  DPL+S+  + K T CVE+++  Q+   K  L DI +L  AE+ A  +L  I +S
Sbjct: 1833 KRKRSVKISNVALDSMHWQNDSVQIIASVSDLKSMDEFLLKKVNDLDNEDSKK--DTLVDVVFKKALKEFRQNI-FSFYSSALAMDDGKSIRYKDLYALFEQILEKTMRLEQRDSLGESPVRVW-VNTFKVFLDEYMNEFKTSDCTATKVPKTERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACHKKCCLKTTAKCSKKYDPELS--SRQFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGL-DTDAESVNLDDYNIHVIASVFKQWLRDLPNPLMTFELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEDTNRMSANALAIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAENKAKTRLSLIRRS 2278          

HSP 2 Score: 154.836 bits (390), Expect = 1.740e-37
Identity = 86/238 (36.13%), Postives = 138/238 (57.98%), Query Frame = 2
Query:  146 KQPPTVVAQFQSSLMELMDALNQSHPFFVRCIRSNAVKAPLKFEAELVLRQLRYTGMLETVKIRQAGYPVRIFVKQFVNQFRILLRAKDLDRISEDELTQMLTDLGLDTDEFQVGANKVFMRESQYQLLRDKMQQAVDRAATTIQVWYH----RRYLRKLKELEISSAIIIQKYWRGFVCR---REYVYYQETRLRNRSARRIQNFWRTHEQTAARKPNKFNRFKRNVIKLQSIWRGY 838
            K+PP++ AQFQ+SL +LM+ L Q+ P+FV+CIRSNA K PL+F   LVLRQLRYTGMLETV+IRQ+GY  +   + FV+ F +LL    +   S+  +      + L+ D +QVG   VF++E + Q L+D + Q V R    +Q W+     R++   L++    +++IIQ++WR ++ +   R+    ++  +   +A  +Q  WR H +       ++   +   I +Q  WR Y
Sbjct:  885 KKPPSISAQFQASLSKLMETLGQAEPYFVKCIRSNAEKLPLRFSDVLVLRQLRYTGMLETVRIRQSGYSSKYSFQDFVSHFHVLLPRNIIP--SKFNIQDFFRKINLNPDNYQVGKTMVFLKEQERQHLQDLLHQEVLRRIILLQRWFRVLLCRQHFLHLRQ----ASVIIQRFWRNYLNQKQVRDAAVQKDAFVMASAAALLQASWRAHLER-----QRYLELRAAAIVIQQKWRDY 1111          
The following BLAST results are available for this feature:
BLAST of TCONS_00001381 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYO9A4.784e-6536.42Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A... [more]
back to top