Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001379 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001379
Unique NameTCONS_00001379
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6987

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001379 ID=TCONS_00001379|Name=TCONS_00001379|organism=Clytia hemisphaerica|type=transcript|length=6987bp
TTATAGAATGTCTTCTACTAAGAAGgtcaaaaaagaacattttaaaaagc
tataaaaaGTTGAGGTATGGTGTAGTTAAACACCAATGATACCTGAAAAT
GCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGTTC
TGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAGTG
AAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATACA
GACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGATT
TGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATGCT
GTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCTGT
ACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAACA
TGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGAGT
TATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGAGA
TGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGAAG
CATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATCTT
GTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGTAC
TCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGATAG
CAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAAAT
gcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCTAT
TGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATGTA
TTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGTTA
ATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTTTT
GGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAgGCTTTTGGCAATG
CAAAGACAAGCTACAACAACAACTCCAGTCGTTTTGGAAAGTTCACCCAA
ATTAATTATAGGGCAGATGGTGTAGTATGCGGGGCTGTCCTAAAGAAGTA
TTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAAACT
ACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGGGAA
ACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGACACA
ATGTTATACCATTGAGGGGATGGATGAGGTCTACGAATTTGCTCGGCTAA
AGAATTCCATAAAGAATATAGGAATTCCATCAATTACACAGCAAAGAATG
TTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTTTAGAAA
GCGATCTTTCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcattg
aaatcattgcaGAGCTCATACAGGTTGACAAACAAGAACTGATCGTACCA
ATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTGTACGACAGTA
CAAAAAGGATGAGGCAATTGCCACCAGGGATTCAATGGCAAAATGTTTGT
ATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCATATCATGGTC
AGTAAACAAGGACGAAAGGTTGACAAAAAGGCTTTCTCTATTGGAGTGCT
TGacatttttggatttgaagattttgagaggAACAGCTTTGAACAATTTT
GCATCAACTTGGCCAATGAAAATCTTCAGTTTTATTTGAATCAACACATC
TTCAAAATCCGCCAGGATGAATATGTAGAAGAAGGCTTAGACTGGGATCA
CGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGATGGTTGGAAAAC
CCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGCTTGACAATCGGT
ACTGATGAAAGTTTGCTGGACAAATTCAATCAACACCATTCCAACAATAC
GTGTTATGAGATGCCACCAACCAGAGAACCTGTATTTTCTATATTACATT
ATGCTGGAAAAGTCAAATATCAAATTGAGGGATTCCGAGCAAAGAATCGT
GAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGAAACAGTCGAATGCT
TTTCGTGCGAGAGCTCATGGGCTCTGATCCAGTTGCGATCTATTACTGGT
CAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTGGC
GCTGCTAGGGCCAAAGGACAAAGAATGTTTGAGCCGAAAGCATCAGTCAG
CTGGatgaAGAGCAAGACTCCTCCGAACAAgAGTAAGGCATTAATGCGAC
AATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAGGCGA
GCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAATACA
GaGTCCCTCAAGGATGCGTTCTGGTTTGGAAGCACGCCGAACAATCTCCG
GAGGGATGTCAGAATATGCACGAAGAGGTGGTCTAAAACAACCTCCGACT
GTCGTTGCTCAATTTCAGTCTTCACTGATGGAGCTAATGGACGCGTTGAA
CCAGTCACATCCGTTCTTTGTACGTTGTATCAGGTCAAATGCCGTCAAGg
cACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATACG
GGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGTAT
ATTCGTTAAGCAATTCGTAAACCAATTCCGTATACTCCTACGTGCAAAAG
ACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGACAGACCTT
GGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTTTCATGCG
CGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCGGTTGACC
GCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCTGCGGAAA
CTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGAAATATTGGCG
TGGTTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCTAC
GTAACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAACAG
ACTGCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTCAT
CAAATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGACTATCCTA
AGTTACTAGCAGAACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGGGAG
AAGGCGGACAATATGATGGGTGATTTACTGAAAGATACAATGTTCAGCGA
TTCGCAAAAAGAACCTTCTACCGATGACGAATTGGAATCAGTTAAAAACG
TTGGCGTTAAgctaaaagaaaataaagcgcCCGTAGAAGTGCCTTCTAAA
CCTCCCTCTCAACCGCCCGTCCAACCACCAGAAGTCAAAACTGGACGCTC
TGACGGTCATTTATATGAAGAGATAGGAAATTTCGAATCTGTATTTAAAA
CGTCGGACATTGAAGCACCACCGGAGGAAAAGAAAGCAAATTTGGTGAAA
TTAAGACACAAAGACAGTAACGATGAAAGTCGACGGCAAAAATTCTATAG
ACGCTTATCGTTCACTCATAAAGACAAAAGTAAATCTAGTATACACTTAA
GGAAGTCTAGAGAAGCCGAGGACTTTGAAATGATTACAGCGCCGACCAGT
AGTGAACTTTTACAACCTGTCAATGTGGTTAAGAACACGACAACTGGCAT
TACGACGCCGGCGTCACATTCTAGTGGCCATCACCATGGGTCTTCGAATA
CACCAAAAGCAACGGGGCTTGCTGGGTTGTTTACACTCACGAGGAAAGGG
TCGAGAAGAGATACTCCCAAAGACAAACGAAGTCACAGACGATCTTTGAC
AGCGGCTGAAAATGATTACGTTGCTAATGGTGAAGTCGAGCTGGAAGCAC
TTAATGGATTCCTCATGAAAAAGGTAGCAGATATGAACAAACCTGACCCT
GAGAAGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCGTTACA
TAAATATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGTCAATC
GCAAAGAAGAGATTCTACTGAAATTCAATGACTTGGTTCATGGCTTCCAA
GAGACGCTCGAGCAAATCATCAACCAGGCGGATTCGGGTGTCTCTAaaga
attttctgtcatggGCGTCAACCTTTTCCGAGGAATTCTGGAAGAGTTCC
AAAAGAacaagGATAAACTGGTCGTGAAGACGAGGTCGAATATAAAACAT
GTAAAGAAAAAACGAAGGAAAACGGCTGAATTTTACgagCACAAAGGACA
CGTTTatacatttcaaaatttcaacataCGCACTTACTGCGAATATTGCA
ATTCCTACATCTACGATAAAGGCTTGGTTTGCCAAGCTTGCGCGTTCACT
TGTCATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGGAGGCG
ACCTTCACTTTGTGGCCCTTCAACGCTATTTGGAACGCCCATGTCAGAAT
TGACTAGTCCAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATC
GAAATCgaaaaaagagGTCTATACACGTTAGGAATATACAGAAAACCTGG
ACCACAAGCAGCAATCAATAATTTGAAAAGCGTCCTGACGTCTACCGAAG
CGGAAGAATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATA
CTGAAGTTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTA
CTACGATGACTTCATACGATCTACAGacTTGGAAAACAAGAAAGAAATTC
ATTCCACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAATTA
TTATTAGAAAGACTTATCGTACATTTAGGAAGAGTAACTTCATTAGTGGA
GCACAACAAAATGTCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTT
TATTGAGGGCGTCGGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTG
CCAAAACAAACAAAATGTGTAGAGATTTTGATTGAATTCCAAGTGAAATC
ACGGAAAGATATGCTGAATGATATACAAGCTTTGTACAGGGCTGAAAGTA
CAGCAGGAGAGAAGCTGGACGACATCATTCAATCGGAAGAAACAGATGGC
GATCCCGAgaagaataaagaaaatgacgaaatgaaagaaatcttGAAAGC
TCAAATACAAAACATGAGCACAGAAAGGGAGAGGATCACAAATAACATGG
CCGCCATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTA
ACGGATATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCC
TGAAGatGGTGACCATATTTCTGTTACACGACAATCTAGCGTTATGGACA
TTTCAAACGAAACACCGTCGACGCCGACGTCAACAGAAAAACGACACGTC
GACGGCAATTCGTCATCATTTGAAGATTTGTCGTGTGTTGGTACGTCAAA
GTAATCTCCTGCTAAAACGtaactttaatttttctaaaggaTCTTCTACT
CATTTGTCTgtctttcttatattttttcaaacaatgtgttctttttttaa
aagataatttaaattattttagaaattcTTCTAGTTTACCCTTTCTCTTC
TTTTTCGGTCCTTGTTGAATTCGAGTCGagtcatccaaaaaataaaGCTT
TGTTACGTCCATTGAGGCACTAGCtgacttttttaaagaaatatttcaaa
ttttttgtcttttgactTTTTTCCAGGGTTTCATCGGGCTCATCTACGGG
GTTGGAATAGAAAATAATAGggatataaaatattttttaacattttaaaa
agACATGGCTTTTATTACAAACTTCGttagtgaatttttaaaaatcaatt
ttttttttcatttttttttttcaaagtcagTCAGAAAGATGTTTTTTATA
TTGTGAAACAGAAATGATCAAATAATGAAGCTACATtgtaaagaaatcaa
aaagaaagcaAAGGTTGACTAAATGAATACACGTGTTTCTATGTAAGAAT
AATGAAAGTTTGAGGCCAAATCATCCTCTCAGGACCTGATTAGTCATCCT
ATCTATACTCGATTtagaagaatattttttgaagaatttttaatgattca
atttAATAATTTAATGATAATAGCAACAgtaaataaatgtttttttgtta
ttattgttatttttaacagtttttttttttgctacaaAATCGAAATCAAT
CTTCTGCCTGTGTACGAAATTTCTGAAAGCTCAATACTCTGAATTCACAG
TCTGTGCCGTCATAATGAGTTAAAccttttcaaattgaatttgagttttt
atttttcttgtaaaatataaatgaaTGTCATGAAAAAGGGTTTTAAAGAG
GTACACTTATGGTAGATCTAGAATGTGTTAATATAAAAGATTTTAATTCC
AAAATACCTAGATGATTTTCAAAACCAAACCCACTtactttatgaaaaaa
taattatctaCACACCTTTTTTTTCCTTTGTACATAGCTCAATTTTCATG
aggttgtttgttttttgaaacTATAAAGAAAGCGCTCAGTGGGTTTTTAT
GCGCGATAATAGATAGTCAGTAGGGAAGGCTAGTTCGTGCAGAATGTTAC
GCTTATACACGCGTCTGTTCTCTTTAATAGGGACATACGAAACTTATCag
aaatttgttttataaagaAATACATTTATTAAATACAATAATTTATAACC
ACTTTACAATTTACTTTTTGTGTACTTTTTTGCTAATTTTCAACGAGATT
GAAAATAGCAAAATCAAGATTTAACTTTATAGGTTAC
Run BLAST on NCBI

transcript from alignment at sc0000010:749360..782620+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001379 ID=TCONS_00001379|Name=TCONS_00001379|organism=Clytia hemisphaerica|type=transcript|length=33261bp|location=Sequence derived from alignment at sc0000010:749360..782620+ (Clytia hemisphaerica)
TTATAGAATGTCTTCTACTAAGAAGgtcaaaaaagaacattttaaaaagc tataaaaaGTTGAGGTATGGTGTAGTTAAACACCAATGATACCTGAAAAT GCCTGGAATGGAAGCCACCATAAAGGAGCCAACATCACCACTGCCTGTTC TGTATCCAATAACAGTTTACACAACGATCCTTACACCAGATGGAAAAGTG AAAACAGAAGTTAACGTTACCATCAAGACCACTGTTTCAGATGCTATACA GACTGTCTTAGATAGTTTCTCGATTGTATCAAGTGTTGAACTCTTTGATT TGTGTGAAGTGTATAGTGAATTTGGCGTATTTCCAACAGACCCAGATGCT GTGTTTGAGAATCTACGTTCTTTGAGTTATTCAGAATACCCACTTGCTGT ACAGAAAGCATGGACTGCAGGAGCTCCAAATGGCCTTGATAGATCAAACA TGTCAGAAGATGAACTCAGTGAAAAATCTCCAATGAATAATATACAGAGT TATCGATTGTATTTGACTCAAAAGTCAGATCAATTAGAAGGAGGCAGAGA TGTGAAAGTAACTTGGCTAGATGGTTTAGATAAAAAGATACCACCAGAAG CATGGCATTTTGATCCCTTATACCGTGAAAAGACTGATATTGACGATCTT GTTGCTTTACCAGTTCTTAACGAGACTGTCCTCTTGGATCAACTTTGTAC TCGGTTTTGCAAGGGTAGAATTTATACTTATGTTGGTGGAATATTGATAG CAATAAAcccttttaaatattttccaatttatAATCCAAAATATGTAAAT gcttatcaaaataaaaaactggGTGAGCTGCCACCTCACGTGTTTGCTAT TGCTGATGCTGCGTATAATAGGATGTTAATTAGTAAACAAAATCAATGTA TTGTGATTTCTGGAGAGAGTGGCAGTGGTAAAACTGAAAGTACTAAGTTA ATTTTACATCACTTGACTGCTTTGAGTCATAAAACGAAGGCAACTGTTTT GGAGAAAACGATCTTAGCTGCTGGTCCTGTTTTAGAggtaattttagatt tattctACACAAACAGGATGATTTCTTAGTCATAGCTATGAAAATATTGG TAATCATAATACCTCATTTTCTTAACGCTAATGATATTAGTTTTATCAAT TCTAATTTTTCTCAGGCTTTTGGCAATGCAAAGACAAGCTACAACAACAA CTCCAGTCGTTTTGGAAAGTTCACCCAAATTAATTATAGGGCAGATGGTG TAGTATGCGGGTAAGAAAAATTacaatattcaattttaatcAACTTTAAC AGATTTTACATATCTAAAGTATTCCAGAAATCTCAAAAGTCTTGTTTTTA ACCAATATTGTGGTTTTCATAGTGTCTGTTCTGATGTCATAGCATACTAA AATATAacatatttcttttatattgTAAAATTTAGGGCTGTCCTAAAGAA GTATTTACTTGAGAAATCACGGATTGTCCAACAAGGCATCAACGAAAGAA ACTACCATGTTTTTTACTCAATGTTGGCCGGAGCAAGCCAAACTGAAAGG GAAACCCTTCATCTCTTAACCCCTCAGGAATACTTCTATTTAAATCAGGT ACATGTCATAATTATAAAGTCAAGTTGATCAATTGTATCCAGTTTATATC AATATAAAGTGGCAATTTCATTAGTAAAATGCCTCCACTGAAATAGAACG TGACTTGATTTGGTATTTTATCAGCTTTTCCTGTGGTTttcattttctat aaaaaaagtttaaaaagagtAATTTACAATGTTTTTGGTTATTTCACTTC CTTATTTAGACACAATGTTATACCATTGAGGGGATGGATGAGGTCTACGA ATTTGCTCGGCTAAAGAATTCCATAAAGAATATAGGAATTCCATCAATTA CACAGCAAAGGTAATGTTTGATAAGGTTATTCTTAAATTTGGAGTATCAA TTAACTAATCATATGCCAATCAGAAACTTTTTAACAAATCCAAGGACTTa ccatatttcatttttaaacagATTATggtttaaatttgattttattctaC AGAATGTTTGCTGTTCTATCAGCTGTACTACACATTGGAAATATCACGTT TAGAAAGGTAtcattttaattatattttttatgcaGAACCAGGCTATAAT TTTAAAAGCATCAAAGGCTAAACCCTGGGGAAGGCAAGGGTCACTCAGAC AAAAATAGGGTATTGGGAAGTGCTGCTTGTCAGGGTCACTTTTCCAACGT CTGAAAATTTCTGACAGAGTTGCAGATCTTCGAAATTTCGAAAGTTGTTT CTGAAAGAGTTAACTTTTGGTTATTCCCTCCACTCATCAAGGTTGGTTTT AAGCTAGAACTGATGTTATGtgtcatatttattttttacctaGCGATCTT TCCCAGAAGATTCAGTATCAGTGGCTgatgaaaaaatcattgaaatcatt gcaGAGCTCATACAGGTGCTTCATTTATTTCATCATCCTTATGCCATTGT TTGATTATTATATTCAATACTATACAACGTTCTGTTTCTATGTTACTCTA TCTTATGTTCTTTTTCCATGGTGGAAAGACTCCAATGGCAATGAAGAAAG TTTAATTTTCTAATAATTTATTTCAACATTTAGGTTGACAAACAAGAACT GATCGTACCAATGACAATGAGAAAAACAATAACCAGAGGAGAAGAATTTG TACGACAGTACAAAAAGGATGAGGTAAATACATCATCTTTCAGAGGTCAT CCACTACCCAATAGTATCAATTTTTAGGTAACACGGGTAGatgaaactta aaattttaaatctttccAAATAGATCTTATGCAGTACCAAAATGTGATTT TGTTATTTCTTATTACTTTTCAGGCAATTGCCACCAGGGATTCAATGGCA AAATGTTTGTATGCCTCATTATTTGACTGGATTGTGTTACAGACCAATCA TATCATGGTCAGTAAACAAGGACGAAAGGTTGACAAAAAGGTATCTAATA TTTgattatttaaaagattttctacaCTTGAAAGCCCATAGTCCAACCTT AGCCAGGAGTTTTATTTAAGGCTGACGAACGGCGATTTTTGCAAGGCACA AAACTAGAAATCAAAATTTGGTGGTCTTACACTGGGTTTGATAAGAATTC ACTGGCCTAGATTCTAGAATTCGCTGGAGTCACAGTGGatttttcattcg ccagcctATCGAAAACCAAGCAAAACCTCTGCTTagcatttttttttctg atgcGTACAATATTTCTTGTTGATCTTTCTTTATGCAACTCTACAGCGGA ACCTGTTGAACATTGAAGCATtatactttgaaaattttgattttactttt gtaGGCTTTCTCTATTGGAGTGCTTGacatttttggatttgaagattttg agaggAACAGCTTTGAACAATTTTGCATCAACTTGGCCAATGAAAATCTT CAGTTTTATTTGAATCAACACATCTTCAAAATCCGCCAGGTAAAGTGATT TTGTATGTTAAGCTTGTAAAGCCACAATTTTTAAATGTAATTTTTATGCT TAACTGAATGTATTTATCTAATTAATTTTATTGTTAGAGATGTGCATTTT GAAAGACGTAAGAACTTTAATGAGACGTAAAAACCTTCTATTTTCACTAc caaaaacaataatttttgaGTACTCTAGAAATTTGTAATAGGGTTTTAGA AAGTTATAATTTAATgagtaataaaaaaaatttcgaaatgttttccaata gaaattttttctctttttctcctCAGGATGAATATGTAGAAGAAGGCTTA GACTGGGATCACGTGGATTATGCAGATAACTCAACTTGTCTGAATTTGAT GGTTGGAAAACCCACTGGTCTCATTCTTCTACTCGATGAAGAATGCAGGT ACTGAATGCTTTTCTAGTTTATTGAAAGGGTTCTTCCTTTATTTTGAAGG AGAGAGGTTTGATGGGAGGAAGTCTATTCAAGCCTTTCTTCCCTATTTAT TTCGTGTCAAGAAGGCTTTATTTTAGCAATTCTACTGTACTGGtttgctt aaaatttcttattgtaaaagctcaaaaaattaCGAACTTTTTACTAAAAC TTGAAGGAAGGTGACCGTATTTTGGAGTCAAAAGCGTTAGATTTTAACCC AATTTTGGAGGGttagttatttttttaaattttgtgagaACTAGATTTGA CAAAGTGACAGGGTTAACTTAATTCCTTTTCGCCCATTAAAATGAGTGTT CTAGACAAATTTTTACCTTAAATGTATCTATATATTACCTAATTTAATAG CTTGACAATCGGTACTGATGAAAGTTTGCTGGACAAATTCAATCAACACC ATTCCAACAATACGTGTTATGAGATGCCACCAACCAGAGAACCTGTATTT TCTATATTACATTATGCTGGAAAAGTCAAATATCAAATTGAGGTACGCAT CTTCTTTGTTGTAAAAAAGCAGTATTTAAGCTTAAAATCTGccattatat ttttttcacaaaaacattACTTTGGCtaatagactttttcataaattacg tcacgaacatcacttgcctcgtattcaaacaatttccataaTGATCACAT CTCATGAGACACAtgaaatccgctgggagttaagttatcaccatggcaat aatttcaaaacgaggcaagtgatgttcgtgacgtaatttatgaaaaggtc tattattctTTCATTACAgtcgtttttatttatttgagtcTTAAAATCCC ATGTTCAATTCAAATTCTAGAATTTTCAACTCCTAGAAATAGGCTATATA TTGCATGAGCTTTAAAAATTAACTCTTATAATTATGTTTTTAGGGATTCC GAGCAAAGAATCGTGAGCTGATGAGAAACGATGTTGTTTCAGTTTTCAGA AACAGTCGAATGCTTTTCGTGCGAGAGCTCATGGGTAAGGAATCTTTTGG CGAATTGGTCAACTCATTCGAAACTTTCCAGAATATCTTTACAATTGTAT CATTTTAGCGGTCAAACTACCTATTATATATTAACACCACTCATTATTAA ATTCCCTTCTTTAAATCTTTAGGCTCTGATCCAGTTGCGATCTATTACTG GTCAATTTTGAGGCATACCATCAAAGCAGTTTCCATATTCAAAAAAGCTG GCGCTGCTAGGGCCAAAGGTAACGTGTTACTTTTCTGTATTACTGTTCtg ttactattcaaattttatcaGAATGTTTAatttaaaacaatttcttttcg GAACATCATCTCAAGAATTATTCATATTTTCTAGGACAAAGAATGTTTGA GCCGAAAGCATCAGTCAGCTGGGTAAGTAAAAGTTATTGGAATTTTAGCA TTGGAGTTGGTTAAATTTTTGCACTTACAAATTCTTTGGAACCTAGAGAT GCCTGAAAATATATTAGCTACTTAGTTAAAAAACAATTATCACcagcatt tttatttcaagcagtTCCAACTCAACAGGAAAACTAAGCTCTTTTAATTT TACGTGGTATCCAtaaattaataatttttctgttttatttttcagatgaA GAGCAAGACTCCTCCGAACAAGTAAGCGTTTGAAATATTAATCATAAAGT AGTAGCCTAGTGATGATTTCAACTTATCTAATGATCTTTGGCCTTTCATC ACAATATCCTTAAAAAAACTGTACATATCCCCAGCAAAGTATCACCTTAT TCTGGATTaagataatttttctttaatacCCTGACTGTTAATTTGGCATG ACGTCGAATTGTGATCATTCCCAGGGAAATTTAGGCTAAACCAAAgtgat aatattttattttacttaaaaTGTCATATTGTTTTCGAAATCTTTCTTCA AATCAGTAGAACTTGCTcgttttctttgctttaggAGTAAGGCATTAATG CGACAATTGACTGAAGCAGAGATCGACACCACAGGCCAAGCAATGATGAG GCGAGCTACCAAAGTTATGAACAGGCGGGTTCTGGATATGGCTAAAAGAA TACAGGTTTGTCACTCTCTTATTTAGATTTTCCtatatttgttttatttg ttttactGTTTTCAGTGTCCTTAAAACATAGAACGGATCCTACTTCTGGT tgtgtttttaattttaaattcgttGCACCTTTCGGTCCCTTTCACGTCGG CCCTTTTTACGTTAAAGctcaaatttttctatttttggccCAGGCCTCAA TTTAACTAATTAATAAGTGCCgatgtaaaaagggccgattaaGTATATta tgttttcctgaaataaGTGAAGGAATTCTTGGAATTAATTGAAATCGATT ATTGCtgtcattttcataaaaaatgtgctctaaattttcaataaatgacT ACACATAATGAATCAAGAATCCATCTTTCATCATAATCTCCACACAAGAC CAAATTTGTCTTTGTTTAACAAATATGTCACTGAGCTTTTCTTGAACGAA CGTTCCCTCCTTTAAAACGTACTCACGTAAGTTTCTCACCAAATTCCTTT TTCTATAAAACaaacattgaaatattttactttGGATCGTCAATCCGCTC AGATCCACTAAATCCTAAAATTTATTCTGCTAATCTTTAATCAAACAAAC CGTTAGAGctggaaaaagttttcaaaatttaggaaGGAGAGCGGTTCTTT TCTTTCTATCTTTACAATGGAAGGCAATACTCTTCCTCGTAGATGTTTAA CTTTCGTTCCAATCATAACATCTACTCCTCCTAGGCCAATACacattctt ttataagaaagtaacaattaaaaataatctttgaaccctttttgattttt tatctttaagagaattaaacctaaaaatgcTCTTATCTTCAGTATCCTGG GAGTATTTTGGCGTGAATTCTTACGGAATTGCATGTTCTAGAGTCCGCAA TGCCCTAGAATATTCTCAAATCTTTGGGCTCGAAATTCTTGCTTTGTTCT TATGTATATGTATAATCCTTCTAGTCCATTTAAGCTTATGTCTTCTTAAA ACACGAACGAGAAAAGCCCAATTTGAGAACGGTTTTTTAAACAGAACAGA CGTTTTAAGACATCTTATCTATTCTTGTGTATCCGTTGCTTGAACATGTT CAGTGGGAGGGACTTCCTTCTCGACTCTAATTTCAAAACACTTTTGTGGT CACAGTCCTCTCTTTGCTCGTTCGTTGAGACTTTTTATGTTGTATGTGAT TAATTGGTTTGTTGTGTTATTAGATGATTAAAAATGTCTAGTGAGAAAGT GTAATCACAGAGATGTATGTTTCTTTATGGAGGGAACTTTGGATTATCTT TACGTTGATTgacgaaatatatttttttcatgttATAATTTTCTCTTGCA TCTTTTTTTTCACATATTCCCTAGTGGCAACCTGTGcttcaaattacttt tttttttcggcaatttgtttttaattgcAGTCATCATGCTTAGTATAATA TTCAGTTAATCTGTTTTTTATGATGCTCGTAAAAAAATAGAAGAGttgag ttattttgatttgatttgatgaagattttttcaatGTTAATTTACGTTTC AATCTGATTTTAATTCGTATGGAATCGGTCGAGTGAAAGTGACATTATGA TAGAATTATATATTTGGGTCATTGATGGATGGTTAATTTTCAGTTTAGTT TGGCTGAAAGcttctgttttttatcttcaaatgttttgttttttgttatt ACTTTCTTTTGGCAATGAGTAAGGGGTTAGAAATCAGAGGAAGTTGATAA ATTAGAATATTACAATTTAAAACATTATACTTCAAGGATTTTAAAATTAC ATAACTTGTTTAGTATGGTATATGATGCAGTatatgatgatggaagaaaa cTTTGTTTCAAAATTACGTTTGTGGTTGATAATCATTATAGATATTTTTT CGCAGGTTTTTTCGCAAGAGTGTTGTCTTCTTTCCTCTAAGCTCCCCTTT AAATTTTTCTCAAGTTGCGAACTTTAATTCATTTGTCGCTTTGTATAATT TTGTAAGAAGCTGTGAACGAGGAGTGTCCTGAAgtctttcaaatgaaaaa ggaagACTGGAAAATAAAtgttcttcatttttgaaaaaaatgttatgTTA CTATGAGTCAAGGATATCGGAGAGGATACTAGCGgcaacttttcattttt tcatttgccTTTTTTTAATGCTGTCAATACCATTCGATATCCCTATCTAT TGTACGTTCATTTAAAGTGACATTTATCAGTCAATCTTTTATGTAATCAA AAAAAATGATCACGAAGTTATATCGTTAGTATCATTCTCTTAAACCGTGT ATCGTAATAGCATTTTAGGTATCATCCTGCTATAAtctttttttgtgtgt tttcagCATTATTTGGCGTAATTTCGCTTATATATAGTTGTTCGTTGTGT TTTTTTTCCAGTTAATTGATCTGACGTTCAAATGGATTTTAATTGAGATG CCAAGGAACGGTTTCGTTTCTTGGTTCCTCGTGCTTTATTAATGACAATC TGGTTTTGATCTCTTACTGGCGTGTTGTTTGGATGTCATTTTCGTCTGTT GTTCTTCTCTTCAATTTTCTATGCCGTGGTATATCATttcagttgacgct ctctaattccaTTTCCATggagaattggattttcatcgaatatgTGAGAA TATCAAAGAGTAGAGTCGTTTATTGATGTTTCGTGTTGACAGTGGCTTTC AATGTTATTATCGAATGGAACATATCGAGAAGTAGaatgaataaaattaa agaGCGCTTATTGTAGTCAAGCTATTGCTATATTACGTTCACCCATGCTT TCTTGTGGCTTGGTATCTCTGTTTGCGTTTTTGAGCAACACGTTTAAATA AATAAACCGATGTAATTAATGTGACGGATGCAAACGGAACATCTAATTGG CTACTAAGGTGCAAGCGAAATAATCTTACGTTTGGCGTATTTCTTAACTT TGGGAAGACTAGTCTGCAACACAtgcttttcttttaaaaggttGAATCAA AGTATACAGGCTATAGATACATAGTAGTTGACGACTAAATGTAAAAGAAA GTAGGCAATGACGAAGGTAGTTGGAATAGGAATCAGTATTGGAAAGCCTA GTCAGAAAACAcaattttgttatataaaggttGAAAGTATGCAGGCTAGA TGATAGTCGACAACTAAATGTAGTCAATAATTAGGAATCAGTATGTGTGT TTACACGTTGACAATAACTCAAGCCACTGTACATAGCAGATCTTTATTAG TGCATTGTAGTATTATATtaacgagtttatgtatttgcaacTTTTGGGgg cggtaaagtgactgaagcgattcgGAATAACTcacagttctgacccgcaa aatcgaggatggTAAAAAATGCTGAATTACCGTTGTCCTTAGTCTCCGTC ACAGAAAAACGCTCATACTCGCTTTTGACCAATAAATATAACATAATCTG GTCAAGAAAAAGCAGATCATCAACATATCTTATGGATTTAAGAGTGGAAC GAAGAATTCATTTTAACCACTGATCTTAAATGTAAATTCACCGTTTAAGA ATGAAAACATCGAACATGAACACCTTCATCATCTAGAGTACCGTGATGAT CTTGAGGAAGCAAAGTGTTAGGTCGCCCAACGCCCGAAAGATTTCCTTac aaatatcttacaaaaaTCTAGTAATCATAAGCCTGGATTTGCTTGATAGT ACGTCTAATAAAACCTCTCCCattgaagtataagcccgaagggctagaat cgaatctccttggtaaggtttgaagccaacaaatcctaccaaagttgccc GGCCTAGCGCGGCCCGCCTGATTTTTACACAAAtggcagattgaaactaa aatttaccactaaatttcgaaaaaagtatcacttgaaaacaaaagaattg ctagattcaatccgtcgtcaaagatatggcgcatattttaaggcttcact ttttcttgcctgagaaaggttagagattcgattctagccattcgggctta TACTTATGACCTCTCCATCCATCTTTAAAGATGTAATTTGCAGGTTATCT TGTTTTTCCTGCCCTCCTCGTCATAATctgttttttcatcaaaatctcaA CCATTTTAATCTGCATCTCCAATACAAATAGATCAGACGTGTGCATTATC TTTTACTACCGTCTGCTCTTTTGTAAATGCAACTCTTACTTAAGTTCCTA CTAATATGTTTTTGTTGAGATTTGTTTTTTGATGTTTGGATTTCTTAGCT GATATtctttctttgtgtttttttgtaTGATGTGTCTCCTTTTGTTTACG TAATTGTTTGGTTGGTTCCGTTTTGATTCAGTTTTGAACGCTCTATGGAT GTCTATCTGATGGTTCTACAACTTGTGTCTCTATTCCTTAAACTTTTAAA CAATATTGATCCAAAGTTTTATTCTTGTATCCTCTTGACCATTTGTGTAT CAGTAGTTTTTAGTTTATTTTGTCAActgtttttcttcttatttttgttt GTCACTTTTTACATGTTGTTATAACGTTTTAAGAGAGTTTCGTCACTACA CTGTCTgaacgaaaaaaattgtataGAAGAAGTAACAAGAATTACAACCC CGTCCCCTGCGTATTATCggtttttttatgcttactggaTAGCGCCAGAT AATACTCTGGCATTGTCTGCTTTTtatctggcgtccatcagtaacgtaaa taaagcctgggatacacggagATAAGGTTGCAAGTAAAGTATAATTCTGC ATCATACGAGACGTTCTCTcggaaatttgaaattgaacagaagtagcaaa aaattgtttatttctccttttccaaaatttgttattttgctCTCTACTTG AACTATGAGCCCACGGTAAGACGTCAAAACAGTGTTAGATAGATGTTCAC AGGTGAATGTGTATAATACTATTATTCCTTCGAGGAATAGTATTTCAGTT ATTGAACATACGTGAAAATTTCTTCGTTGAATTTGTTGTTTCAAGACATT CTGATTGACTccaatgaaaaaattattcgtgtttggaaattttttttatt cgagTTTCtgcaaagaaaaaacaaaggtTCGAGTAATAGAGAAAATGTTG TGTACATAGTGTGATACTACGGGAAAtattttattacttttcaaggttga ctgtttttttttgtgtgtaTATTGGTCAGAGTTTATCAAATTGACGTGTG TCTTGGAAAAAGATCGATCAAATTTCTCAATCGATGTGCCAACTAACGAA CGTTTTGTAATTTCAattcattttattattctctTCCCTTTCGATCATGA ATTCTGATGTTTTTGTCGACATGCGTGTTTGTGTGCGAATATGTGTGCAT TGTTTAAGGTCACTTAAACGATAAGCTGTTTTGCTTTCGTGGAAAATATG GCCCGCTCATTCACGTTTATTTTAGGCAATTATGACCTGGCATGGGTCTG GTTTGAAATGTCTTTCTTtttcagtgccgtagcaactgggggggcaaggg ggggggctatgccccccccaataattttttcaaaaatagttattttgcaa aatgcaaagtttttcttttttaatttgtcataattgtctttgaAGTGCAT GTtatgagtgcattttcaagcaatctagagctcaaattttcaaaattccc ccccttgggccaaaccatggttcgccctcgcggtgtcactaaacttcagc cccctcaatatgaaaatgcttcctacggcactgtttttctaggaaagact tctttttcgatgtattttgaAAGCTGGATTTAAGTAAAGGAAGTAAAGCT TCGGCACTTAGTCCCCcgtttatttattattttatatttttttagagTTT TCATTGCCTCTGTGTTTTAAGTAATCTCGGACCTTGTtatattttaatta tcattaagGAAAGCTAAATGAGTCAATTAACCAACTTGCTttgtttgtaa agttttgaTCTCTCTTTTATACTTTATTAATGATTTAGTGGCGTGGGAAA AGTTAGAAATTGAGTTGTAATGTTGTCGAGCTTTGATGATTTTGTTCACT GGACTTTGAAGGCTGTTTTTTTAGATTCTCGTCCTTTCTGTTTAGAATGA ATTTCTCAATTATTTTACCTTCTGATCATAAACTACAATGTTTAGAAGGC TATGaaataatagaaataaaatAATAGAATGGAAGAAATCAGCTCGAAAA TGCAAATTAGTGATTGGAAAACAGACCTAACTACTGTCACTACTGTATTG TTCAGGTTGTAGAAAGTTGTATTAGATTAGGGATCTGCGAATCTCCTTCG TATTTGTGTGTCAGGAGTTTATTTTGCGCAACATTTACATTCAAAAATCT CTCAATTTTTTCCCTCATTACATTGTATTGTATCAGCTATAATTTAtatg aaaagtgaaatttcatAAATAAACATTGTAAAAAAATGTAACCTCACATT GCTGTCATGAGACAAATCATCACAACGGTGGTGTATACAACACCAAAATC ATCGACCATACAAACTACTTGTGGATGTGGAAACCCATCAGATACGGTAA GTGGCTACAATCTGTGACTAATATTGTGACAAGAATTTTCTTCCTCCTAG TATCAGTGTTGATGGGTGGAAAGGCTGCCACCATGCTCAGAAAAAGCTCA CATCAACACTGATATTAGGGTGGaagagatttttcaagaaattgccctat attttgtcactgattgtagatgcCAAAGTCTGCATCACTTCTCTTATGGG TACTATAGTGATGCacagtctccataactcgaacacgcacggggggaaca caaatttgttcgagttcaaggagttatggagtaaggtttataagggaTTG CTAACTGAAAGGACGAGAAAaattgttcgaattaaggagacatATAAGTT ACAGAGGTTCAAGTTAAAGAGAAACTActttatcttgattttttttggat atcGGATCTGGTACAGCAGACAAGCCTTTAGCAGAATTTTACATGCGACT TATATGGATACTTTTTATGCTTTTTTACTTCATGCTTTTAAATTCCTTGG GTAGGTCTCTTATAGTTTTAAATGGTATACACTCtttttacactcttttt tataagaaacagtaTAGTTTTTATGatgctcggctgttcttatttttttg cactttgagcctcaaattgttcttatcctgttcttattaaTAAGTCATCT TGCAGTATTTAATTGTAATTGAGGTACTTTACACCTACTTTTTACTACCC TTACTACGCTACGCTTTACTACGCTTACTTTGATGTGTTTCTGGCAAGGT TTTTACGATATTCCACCATACTTTACCGTTCAACATATACTTTGTGCATC ATGCATACTTTTTACTCACATGTGACTAATGTGATGGGTAAAGACTTTGA GCACTGATGAAAACAATCCGTACTTAGTTCTTAGCTCATAAGCAGATTTC ATTACAAATGCTAATTTCCCTCTATTCTTTCACAAAATACGGCTAATGTA ATAACTTTCGTCTTAATTCAATGATTTACGTGTTTCAATTATCTCGCATT GAAATTAACGCATCTTATCGATGTTTAATTATCTTTCTTGTGAAAAGTTT TACGAGCATGGCTCATAATATGCGTATTTCCTTCAGGGGTGAGTTACGGA AAATCGGGCTTTGGGGTTTTCTATGGTCCTTGATGGTTTTTTAACTGATT TTCATCTTCTTTAACAATAAATGCTCTCATGGTACATATATGTTTGGGCC TTCATGAATTGCAATgtcattttaaaaagttttgataatATACTTATGGC ACAGTCTACTTATTCATTTTTCAAGAACTCTTTCGATTCAAAATAGTATC ACAGTTGTGAAATCTTGCGTAATAATGGTAAGACAAcagtaattattttt aaaaaaatctcacaTTATTCTgtcttttaaaaagattttctgattgACAT TGTCAGCATTGCTACTTGATACCTTTTTAAGGCCCTTGTCactctatttt atttttaatctattTCCAGTAAGTTTTTCGAGAGAGGCCAAGTTGTTGCT GTTTTTTAAAGATCCGCCCCAAAAATGAgttgaagttttttttcttaaga TTGCCAAAGTTCTCATCAGGAATAGGGGAAGTAACAATCCTCTTAATATA ATGTAATTTTCTTACCAAATCGAAAAATGAACGGTCTTCAATCAAAAACA AAGGCTGGGATGGCTGGACTACGGATGACTAAAGTGAAGTGATCTCgatg attgaaaaatattttttgcttgcaAAATGAAGGGGCCGTGGTGCAACTCT GTTAagagtttttgtattttgaattgagaattgagaaaaaaaaatcaaaa tcaactaatcattttcttttcagaGTCCCTCAAGGATGCGTTCTGGTTTG GAAGCACGCCGAACAATCTCCGGAGGGATGTCAGAATATGCACGAAGAGG TGGTCTAAAACAACCTCCGACTGTCGTTGCTCAATTTCAGGTATGGTTTT CTCTCACATTGTCTCCCCTTGTCATCCCATGTAGTAGTTGTAGTAAGGTT ATAAATTTACTTGAAAATTATCATTATTGAAGAGACGTTACCTTTTGCTA CCGTGGATCACCAAGTAGACGTCTTCTTCTATTTAAAAATCATCCTTAAA TTTTTCTGCATATTCCTTCGAGCTCATTTGGTATTCTTTATAGCCTAATT AGAATACACGACGGATGTGATGTTGGTGTTGAGGGCGTTACTCTCCTTTT AGTTTAGAGAGTCTTTGTCCAACTTAgtctacacaatatattggcgAACA ACACTTGACAATATAATTTGAGGActgtaatgtacgaagtaaacgaCAGG CTCTATTTTAAAGGGTATCTTTGTGTAAACAACCCCTCCCCCCTATATTG TTGAATTATTGCAAATAATCCAACAATATATTACCGGCACAACTAACCAA TATATTGTTTAACAATATATATNTGCAAATAATCCAacaatatattgccg gcacaATTTACCAATATATTGTTTAACAATATATATTATGTTGTAGCCCT ATAGACTATAATTTTATCATGAGAACGTTCTTTTGTTTCCAGTCTTCACT GATGGAGCTAATGGACGCGTTGAACCAGTCACATCCGTTCTTTGTACGTT GTATCAGGTCAAATGCCGTCAAGGTGAGTTGACGAATCTTATTCTGGTGC ATTTACAACATTGGTTCCCAAACCGTTCCACGTGTCAATGCTCCTCTATT AAAATGAATTTGTTTGGTATCCTCTAATACAatcttcagcaaaattcctc TTTGATTCGAGATTGTGCTTACGATGAACGAATTTCTGACATAAGAAATA AATCTTTTGAGCAAAACCTTTTTCGTTAAAAAACTGAGAGAACTTTTAAA TGAAAGATAACCCTGTACCATGgcctgatgtttttttttttaatttacta CCTAAAGACATGTTTTAAGTACTCATTACTGAAGATGCTCACTGCCCCCA CAACGTGGTAGCAATTGAACCAATtcttattattaattttttttcatagg cACCATTGAAATTCGAGGCGGAGTTAGTTTTACGGCAACTCCGTTATACG GGCATGTTGGAAACTGTGAAAATACGACAGGCTGGTTATCCTGTCCGTAT ATTCGTTAAGGTGAGTCAGAGTTTCGGTTGGAATTTTCACCTTTTAGGGT TTTAGGGTCTCTCTCGAAAaccatgaaaatcaaaaaacggTCGCTCCGAG TGTCCCTTCTTTTACCCATTTTTCCCTGTGAGGGTCACTTTTTCGTTTAA ATTTAATCTCTTTAAAAAGTAAGGGACCAAAGGTCTGACTTTTGCATACC CAACATTTTCATCCCTATACTCCTTCCTCGGGGTTTCTTCTCTAGGGCCA TTCCGAAAAATTGTCAACCACGATTCTATGCCCGATTAAAAGGTGCATGG GTCATGGAGCTCCTAAGTCCCTACTGACGGTATCCAATCAAAAATGAGTG TGACGTAATGTACCCCTTACTCTGGAATGGCCGTCTATCGCTTGGAAAAT TTTAAAGCGATTGCCCctttgaattttgataatggCGCTCTCATCCTGAA CAAAAGTTGTGATCATTACCACCAGTGCTAGCTCTGTCACCACAGGTTTG AAATTTATGTCACGTTAAACTTAGTGTAAGAGTGTGTTAGCAACTATATC TGTTCATCTGTTTCCAGCAATTCGTAAACCAATTCCGTATACTCCTACGT GCAAAAGACCTCGACAGAATATCAGAAGACGAATTAACGCAAATGTTGAC AGACCTTGGTTTAGACACGGACGAGTTCCAAGTGGGCGCCAACAAAGTTT TCATGCGCGAGTCACAATACCAACTACTACGTGACAAAATGCAACAAGCG GTTGACCGCGCGGCCACAACTATACAAGTGTGGTATCACAGGAGATACCT GCGGAAACTGAAAGAGCTGGAAATCTCTAGCGCCATTATTATACAGGTAA TTTTCAAGGATTTCGCTTTATTATGATGTATGAGTAGAGAACGCATTTTC ACGATTCGGGCTACTCTAAAGTCCAACGCAAGAAAAACCATGAAGCTTGT TAAATGTTAGGGAGCACCTCACCAAACGGGATGTTCCAACTCGTTTCttg gtgagttccactttgacgattttctgaaaaacgaACCCTTTCAAGTGTCC TGGCGCAATTCGATTTTTCCCTACTGCAGGAACGAAGCTTAAAGTTGTct cgcaaatcgaacgtttggaGCCCGtaaaaaagtcgcaaagtggaatagat gttaattgcgtagaaagaATGCGGGTGGTGTCTAGTATATGCTAGCCAAA TGCGTCTTTTTGGTCTTCACAATAACAAGTTTTGATCTTCTCATATAATA GATGTATTCACCTTTCTGACACTGCAAATCTACTGAAACATTTCCATATA AACTATTTTATTCGCACCTTTTTCACAAATGTACAGAAATATTGGCGTGG TTTTGTGTGTCGACGTGAATACGTATATTACCAAGAGACGCGGCTACGTA ACAGGTCCGCACGGCgtattcaaaacttttggaGAACTCACGAACAGACT GCAGCTCGGAAACCGAACAAGTTTAATCGATTTAAAAGGAACGTCATCAA ATTGCAAAGCATATGGAGAGGCTACAAGTGCAGGAATGAGTAAGCTTTTT TCACTGGGAAACTTTCCTTGATTGATCAGATTCGGTACGGGTTTCATGTA ACTCTTGACTAGGCTGCTAGCATCATTCTGATTCTAACAAAATCATACCA TGATCTACGAGAAATCATTTCCAATAAAANTCTAGGCTGCTAGCATCCTT CTGATTCTAACAAAATCATACCATGATCTCCTACGAGAAATCATttccaa taaaaaaacttttacataCATACTTTTCTGATCCTTTTGGAATTACTAGT CATTAACTGTTCCTGATTATTCCTTTTTAGCTATCCTAAGTTACTAGCAG AACGTAAGGAAGCCGAAGAGACAAAAGCGATCAGGTACCCTAGCTATTTT AAGAGgaaatttcttctttatttatTCTATTATGTCGTACCATGTTCAGC ACATTCAACACCTCAACTGTACATAGCTTGTTTTCTTAACCAGCACTTTT CTTACCTTGCACCTAACTAAAAAAGAACCAGCAAACTTTCGTTGACAGTC TTGGTGCATATAACCCCAACCATACCATTTAATCTTTAAGTAGGAATCAA TCGCATTTTGATAAATTAAAGACCATATTTTCCGAAagcaaatttcttca aaattatcAAACTTACTTGCAGCGAAAAGTCTGATAAAAGTGATGAGACT CAACATCTTACTAAAGAACCCATCCAACAACCGCCACTACCGCCATCTCA AAGAAGAGATCCGCCCGACCTACCGCCCGGTCTACCCTTCGATTCCACCC ACGCCCTTGAGGGTGGTGTTGTTGATCCACCGACTGTTACCATCACATGT GCTGTTGGCTCCCCTTACTCGCCTCATAGAAAAACCATTACGTAAGGGCC TCTCGTATTTGAACCCATaaaaaacatctaaaattttgtttacTAATTTT CATGCATGCTTCAATCATATAAATACATACAATTATACACATGTTCATTC TTAAGAAagtccaaaaaatttaaaaacacgGATGATGGTACTTCCCGTTC ACATNActcattgggctcttccagaaaaagtccgttcattgggggtggag gatgaagaattgtccaggggtattgaaaaaaagccaaaaaattgcaatgt ccaggggggtaaattccaatgtccaggggtaattttttgtgtccacgggg ttgatttgatgtttgtccaggggttgatttgatgtttgtccaggggtata acccgtgtccagggggttaaaaatcaaaatgtccaggggtaattcatgaa aataataatatatcctccaccccccatgaacagattttttctggaagagc ccattcttaagaaagtccaaaaaatttaaaaacacgGATGATGGTACTTC CCGTTCCCATAACTATTTGGCTATAAGACGGTTTTCCATTGAGCTTAATT TCCTCTCGGGTTGAGTTTTTCTTGGACTGAATTTTCATCTAgttaaattg cttaaaaaagtcaGTTACAAGCCAATTTGTTATGATGTAACATCATCCGA GATAGTAAAGAGAACATATTCCGGCTTTTCACTAAGAAAGCAatacaaaa atgatttgatATTGCAACGAATCAATTCGCCAAAGCATGATCGCATGtta taaaacaacaacaaaaaaacacatTAATGGAATGAATTTAGCCACACACA TACACATACATACAATCTACTAATGGTTAACATTCGATAATCAACAGCAC GCTTCTCTTCACCCACCCTCTCCTATTTTCCAACATGGTGTTATCACAAt aaggccttttcataaataatTTTGAGTGCAACCATTGCCTCATTTTAAAA CCGTTACCAAGGGAATTAAATCCCTtgagtttttaagtttttcttttata aatagagtaaatttctatgaaattgaaaattaatttgaaaacgaggtaaa tgttgctcgtgacgtaatttatgaaaaggtctattataggccatttcaca gtcgcaaagcgtaatgggtaatcagtaccactgcgcgctaataacgactt actattggtctaaagttttgaaaaaaattgaagatttttgcgtctagcca acgggaagccgtaatggaggcgcaatcagtcctgattacccatgatccat ttcgactgtgaaatggcctattctCAGATCGATTGTgctcatattggttt cggaacgtttcgaatcaagaaaacgaaGCAGCTTCGTTCCGAAGTTtata gtggagcgaaaccgttttgatctgttttgctttgtgaCGTCTTCTTTTTT AACGTTTCCAATTTTGACGGTCACactttcggaaccgtttcgtttcggaa caaTATGGAACCgcaacgtctgaacatggtctcatATCGGCTTCCGTTAT CAGAGCGtggtggtcctgattacccataattCCTTTCGACCGTTAAATGG TCTATCGTGCTTGTAATgtaagaaattttcaagaattaGATCATTCGCAA ACTCCCGTGTGATTTGATGGGATTTAATTCTGCGAATTGAATTCATTCAT TTTACGGAAATTAAATTTTCGAAACGTtgtaaaagaagaaatataaGAAT CTGATCGTCGTAGGAAGAgggtttggtcaatttttctgATCGCGAAAATT TCTCACATTAAAAAATTACTCGTTTACATTTTATTAATGTAACGgttata cagttgacgctctctaattcgacgttctattattcgatatgGCCGAACAT TCGATAATTTTGAAGAAACACTCATAAACGATGCTCTGcttttcgatacg ctcccttattcaatgaaaatccaattcttcttaaagatcgaattagagaa tgtCAACTTTAGTTCGATTATGGATTTTTAGAACTCCTTATATCCAAGTT TACCAACCTCTTATTCCAGGGAGAAGGCGGACAATATGATGGGTGATTTA CTGAAAGATACAATGTTCAGCGATTCGCAAAAAGAACCTTCTACCGATGA CGAATTGGAATCAGTTAAAAACGTTGGCGTTAAgctaaaagaaaataaag cgcCCGTAGAAGTGCCTTCTAAACCTCCCTCTCAACCGCCCGTCCAACCA CCAGAAGTCAAAACTGGACGCTCTGACGGTCATTTATATGAAGAGATAGG AAATTTCGAATCTGTATTTAAAACGTCGGACATTGAAGCACCACCGGAGG AAAAGAAAGCAAATTTGGTGAAATTAAGACACAAAGACAGTAACGATGAA AGTCGACGGCAAAAATTCTATAGACGCTTATCGTTCACTCATAAAGACAA AAGTAAATCTAGTATACACTTAAGGAAGTCTAGAGAAGCCGAGGACTTTG AAATGATTACAGCGCCGACCAGTAGTGAACTTTTACAACCTGTCAATGTG GTTAAGAACACGACAACTGGCATTACGACGCCGGCGTCACATTCTAGTGG CCATCACCATGGGTCTTCGAATACACCAAAAGCAACGGGGCTTGCTGGGT TGTTTACACTCACGAGGAAAGGGTCGAGAAGAGATACTCCCAAAGGTAAG TTAATGGACAAGGCTGGAATGGGGGCTCATTTATATTGTCTGTATTTCAT GTTTCGCCATTGTTCCTAGGGCCCCTTGTGACACGGAAATCGTGTATAAA ACGCTAGATGGAGCTTCTAGCTTCCTAGCTGAAGAAAATAATGTGCCATC TATATAAGTAGAAAACAGCTCGATACCGGCCATTTGATCAATCAAGAGCA TTCTCTCCCCTCCCCGTTCCAGCCATGTCAGAAATTCGTGAATGATAAAT TGGGTGTTTTCAGTAAAAGATTCTTTTAGCGAATTGGACCACAGTGCTTG TTTCCTCTCGAAATGACGAAACCTCATTGGTTAAAAGGTacatcaaatgt tttttttcgttGTGAAGAATTCGCCACCTCATCAAACGCTACTCGTCTCT TTCAGACAAACGAAGTCACAGACGATCTTTGACAGCGGCTGAAAATGATT ACGTTGCTAATGGTGAAGTCGAGCTGGAAGCACTTAATGGATTCCTCATG AAAAAGGTATGTATGACACACTGGACACGAcgaaaaacctcaaaaaaccT CAAGAAAACCTCATTCGAGTCTTTATTTCTCAAAATCGaaagttagctaa attatgacttcataaaagtgcaaattatgacgtcacttgaCTCTAGctcg atttttcaaaaaaggattttcgagttagctaactctgTTTCTTTTTTCAC AAAGCCTCGANGAAAAAGGTATGTATGACACACTGGACACGAcgaaaaac ctcaaaaaaccTCAAGAAAACCTCATTCGAGTCTTTATTTCTCAAAATCG aaagttagctaaattatgacttcataaaagtgcaaattatgacgtcactt gaCTCTAGctcgatttttcaaaaaaggattttcgagttagctaactctgT TTCTTTTTTCACGAAGcctcgagaaaaaaatattcgaGTTAATTCTAACT TTAAAAttctaatttaaaatttctaatccttttttaaaaatgaaaaattg agttagagtcgagtgacgtcataatttagctaactcgaaaattgcttaat cgaagttttctaactcgaagattccgGGCCTCCATTTTTGCTTAcagatt tatttgaaaatcaagTCAATAAAAGTTACGGGCCACTGCGGCTGATTTAT GACGTTATCAATGAATAAACGTTGACTTTATTTCAAACATTTACACTTGT ATTCAACtgtaatctttataaattttagGTAGCAGATATGAACAAACCTG ACCCTGAGAAGAAGAACGATTCGGGTGCTGACGTCACTTTCAAACACGCG TTACATAAATATCACGGAAATTTGTTATTCACGTGTGCTAACGCTTCTGT CAATGTAAGAGTTTTGAACTTGGAGTATATTTAAGTTTTTATCAACATGT GATTCGCTTGTCCCTTAAACAGTCAAATGTACTTTGTACTTAGGAGCTGA ATTTGCCAATTTAATCTCAGTCAGTAAatctatgattttttttaatttta agtatTAAAAATCGCCACTGAAATTAAACGATCTAGAATCTTGAATAAAT ATTGTGGCAAGAATTCCCTCCCCCCCTAGTATCAATGTTTATGGTTGGAA AGGCTGCCACCATGCTCAGAAAAAGCTCACATCAACACTGATATTAGGGG GGAAAtggatttttcaagaaaagatTTCTTGATGCTTATACTATGTGATT CCCAATTTCAGCGCAAAGAAGAGATTCTACTGAAATTCAATGACTTGGTT CATGGCTTCCAAGAGACGCTCGAGCAAATCATCAACCAGGCGGATTCGGG TGTCTCTAaagaattttctgtcatggGCGTCAACCTTTTCCGAGGAATTC TGGAAGAGTTCCAAAAGAacaagtaaattttttcaagtgTAAAATTCGAT CCTATTTGAATTTCCATACAACCTTTTCCATTATCGAGATAACTTgattt aatcggattaattttcacgaatttctcgaattttttgccttttttctcAC AAAAGTAAATCTCAAGACATCACGTGAAATTGCTGACTCGCAAAATTTAA CCCACCCTAAATTGCATATTAGATTCTCGGTCAAGAATACACTGtctgtt ttgtattttttacgAAAAATTGCTCCAGAAATTTTTGTAATTGCTATAGT TCGTGAAAATAAATCCAGAAAACTTCGCGAAAATTGAACATCCATTTCGT TTTGAGATCTAACTGACCGAGAAGTTTTTAATTTggatcaaaagaaattt ttatggAGTAAACCCCTTTAAATTATTTCACAGGTAGAAACTACTTcatg attttctgattttaattttcttttgttgttttttaggGATAAACTGGTCG TGAAGACGGTATGTACTATGTTTCACtcaacacgtttttttataagaaca aactatataagaacatctagATTTGGATTTAATAACATTTGAAGGATTCA TGGACTCTTAAAATActcaaattttttagaaaatggcacaaaatactcac aaaatggtgaaacgaagaacattttaagaacattttaaggcttaaaactg aaatgttaagaacatacgaaagcttcaaaaattttggacgttTTTATTAT GTTCTAAATCAAAAAATGTACTCTATCTTCTTTATTGAAAACTACTGGAT TgaccatattttcaaaattgttttgatcaatttttaaatCGTTTTCATGT CTCATGGAAGATGGAAAACATGCGCTGACAGAGATAAatcttatttcttt atttttctcagAGGTCGAATATAAAACATGTAAAGAAAAAACGAAGGAAA ACGGCTGAATTTTACGTAAGTTATGTTATCTATCTGGTTGTATCATCTTC CTTGCTACGTCGCCGGGGCTATACTCCCCAacccagcaaaaaaaaattat tgataccTAATCCGATCGAATggaaattgattgaaattcaatttaacata aatcttttaatttgtattttttatgttgttttttttcaggagCACAAAGG ACACGTTTatacatttcaaaatttcaacataCGCACTTACTGCGAATATT GCAATTCCTACATCTACGATAAAGGCTTGGTTTGCCAAGGTAAAAAGTGT ATAAATtccttgaaaataatatttttacgaAAAAATGGTCCCATGAGAAA AGCATGTTTTGGTATACTTTCTATTATTGAATGGTGGCAACTGggatttt tattatattattctTTTATTCCTTTTTCTTGTAACTTTTAGCTTGCGCGT TCACTTGTCATAAAAAGTGTCATAGTAAATACCCAAAGACCTGTAAAGGG AGGCGACCTTCACTTTGTGGCCCTTCAACGGTAAGCGTTTTGcagtgttg caacttttccgTCTGTAGACGGATATCCGTCCAGTTGAGATACAAATATA TCATTTCCCTCTTGCCAGTAAGAGGGTTTTGGTTCAAATGACCATCTAAT CCTAAGGTTTCCGTCCATATTCACAAAACCTAGTTGCAACACTGATTTTG AGTAATCTTTTTCTTGCTAGAATGTCTCAATGTTCtttcgggtgcctaat aaactggggggggggttcaaaaTAAAAGGGTGGagtaaagattttttcaa atttgaataaacgGAGGATCTTAATTGCCGGAGTGTAATAATTACTTATA TTGTACTTCTGAAAGCCCTAAAATTGGGGTATAATATAAATATAGGCTAG AATCAGGTTGATcagagcaaaataagagacttgTGAGCTAACAAAGTGTT GTTCTTGGCGTGCGATAAATCTAAGATTTGTGTATACGGTTTTAATAATG ATGCCTAATGTGTTTTGATATCCGCTAACATagctaaatatttcaaaaat taaaaaacggggggtcctaataaggtctaCGGAGGGGTGgaataaaatcg aaaaaatattaGGCATCTGAGAATATCTGTATTTAAGAATGGTTTCCAAT CTAACATACCACTCTTCGTTACTTTCCCACCAAACTTAAATCTTTGATAC TCTGAAGAAATCATATTTTTGTACTTTACAATTTCATTTATTATTATACT CATTTACATTCTTTAGCTATTTGGAACGCCCATGTCAGAATTGACTAGTC CAAATAATCCTATACCAGAAACTGTCATAAAACTCATGATCGAAATCgaa aaaagaggtatgaaataaaacttttattatGGGCTTTATATATTTCCAAt tcgtgatatgcaccactgcaatgtcttctgacattacgtcatggaaccaa tagctcattggttggaagtgacgtaaaagcagtcaatacgtcactttcaa ccaatcagctactgggtggaacggaagacattgcaatggtgcgtATCATG AATAAGAAGTTACAGTCAACTCTCACTAATTCGGACTTGTCCAGGAgatc taatttgttcgaattacagaaagattcgaactatggagaggttttttttt taatctcctGCTGATGGTAACCGAAAGTTATATCGAATTATCGAAAGATT CgagaaaagaagtttgaataaGCGACATTTCTCTGCATCACCAGTACACT GTCGATTCGTTTCACAATTTTCACGGGAGTCAAATCACAATGTTCATTCA ACCTATTGTTTTTTCTACCCATTCATTTAGGTCTATACACGTTAGGAATA TACAGAAAACCTGGACCACAAGCAGCAATCAATAATTTGAAAAGCGTCCT GACGTCTACCGGTAAGTGCAAACatttataaaaaaccccggtccggaaag cttttgtttctttctattggTAACAGTTAAGAGCTTTCGTACGTCATAGC TTTGCATATTTTTAATCACGTGACTTGAAAATAAACTAGTCTCAAAAGTC GAATATGACAACGTggtcaaaaagtatgcaaattgCAACTTGTCTTTTAT CGGACAACAGAAAACTTGACGATAAAGTTGAAACAATTTACCAGATCCTG TTTTTTACAATGACTTTCGTTCGGACTTCATTAAATAGCTTGTAATCAGA AGTACCTAAGACAAAAATATTAGACTAGAGTATACTTCTGACTGGAATTG GCTTTGCgtttatttttgatgacgctgtaGCCATGTGTTTATCAATCCTT ACGTCAAAATCCGTGTATGAGATGGGGGAGAGGGGATTGAGTTCGAGTTT AACAGGGTAAAATGATATGAAAAAGTCTGAAGTCGTCACATGAACAGACA TGCTACGTTCAAATCAACCCTTGTTAACTAAAACCCAATCCTCTCGTAAG ATGTTTCACGTGTACAGTAGAGTCTTCATAACTCGCATGTCTCctcaact cgaacaaattttctggTCTCTTCAGTTGATAATGCCTAATAAACAAATCT CAATTACTCGAAACTTCCataccgtaaatcaccgattaagcgccccgctt gaattatcgccccgctcgaataagcgccccccatttagttaaaataattt tataagcgccccgctcgaataagcgcccccctttgaataagcgcccccct ccAGGGAGGGGCACTTATTCGAATTGGTGGCATAGGCTAATTTCCGGGAT AAGAATTTCTCTTCAGATGATTAACAGtcgaaaaaaattaacttgTTATT GAAGAAGATGAAGACGAGGACAAAgatattgttattgattgaataagata ttgtcttaaaaagaaaaaaacgattaagaataaaatgatagaaattgtca attggatttttcttttattNCTTCTCAACTCAAGCAAGACTTGAGCGAAA AGTTTATCGTCGGTATAATTGCAGTATATTTAACAGGAACCACAAGGCcg atttctctttttctttttccagtgACTTCTGCCATCAAATTATTAAGTTA AGTTaagttaagtttaagcagattccgaatttgttgatatacgaatttct gaaataaaaaaataagcgccccgcttgaataagtgccccgcttgaataag cgcctccctcagagcctgaaaaattaaacaagCGCCCGGGTgcttaatcg gtgatttacgCTAATCCGAATAAATTTCTGtttcccgtgcgtgttcgaga tatggagactccactgtattaaGCTCTAACGTCTAAATCTGCATGAAAAG GCTCAACATCCCAGGGTAGAATGATATCCAAACGCCTGAATTCGTCACAG GAACACAATATTGACGTTCGATCAACCCTTGTTAACTAACACCTTCAAAC CTAGTGTCTTAGgtgttttaaacttttaaaggtcttatttttacataagt gttcccgtttcatatcagacacatgtaaCATATAAGGGCAGTATCTGcat tttgttatattatgctgatataaacaaaaaaatgtttttcctttcctctt tctgaccaatcttgctccacatccgtgtcaattcaatataaaaaagcttg taaattaaaattgacgagtaagcatactatatcactcttattcaaaaaca aaacctttagaaTCTATTGTTTATTCTCATTACAACTGTAGAAGCGGAAG AATTAATCTTGGAAGATGAGAAACCACACACGTTAGCGTCAATACTGAAG TTGTTTTTCCGTCAACTACCTCAACCGATTATACCTTTCAATTACTACGA TGACTTCATACGATCTACAGGTAACTACGTTCTCTTTCGTTTGGAGTTCC ATCATTTCTATGAGATATGAGATATGAGATATGAACTATGAGATCATGAT TTTGNTGTTCCATAATTTATATGAGATATGAGATATGAGATATGACATGT ACTTAACTTTCATAAAGATtaaagaaaagttttatttcttttcaatactc gGAGTTGCCTGcttaccccggggggggggcacgcgatttcgaaaattttg ccgcgcaaaatctgcttttcaaaatcgtacccttacaatgcagttcaata tggctaaAAAGATACCCTGTCAGTGCATTTCCTCTTGATTTACCCATCCC CTATAGTGTACtgtatttctcagctgtaaatttgtgtgaaaaaagaagct tgggaaattttctgttttaaataaaaactgagaaaaatattcttgtcagc tgtaattatcatacaatagaaactttttcaaacaaacgagaagtaaaaat ttttttctttatcaaattattttgattttgttttaaaattctacccttgc agtgcaatctcacaggaACACACACTTACAGTGCATTCTGGATGCTGAAA ACCcaacccttaagcgcggcacatgacgtaggccagatcatatgagtgtc CCCCCGGGCTGCTTACGCactcatcagttgattagaaacttactttactc tccataGTTTGCTTGATGATTTGAATTGGGTGTTCATTCATAAGCGATga actttttattcatttttcatttttttagacTTGGAAAACAAGAAAGAAAT TCATTCCACGCTCTACGAACTGATTCAACATTTACCAAAAGAGAATAAAT TATTATTAGAAAGACTTATCGTACATTTAGGAAGGTGAGAAGGATATAAG TtctcatttttttggaaaatagatTCCAAATTTCGGCATTTTtcataaag atataaaaaatggGCTTATCTGTTTgttgttatcttttttccgtCTAAGA AGAAAATACTTAATCACTGATTTTGATGTTCATGGTGAAATATCATTGTA TTCATTTCTATCTTTCGAAAGTAGTCTTCGGCTGGAATTTCAAATGGTCG AAAACAATTCCAACGtttatttcataaaatcttttttctataGACTGGGA CCCAGAATGTTTACATTGAGGCCAAACACTTTTAGTTTTAGAGTTTGTAA CGAAAATAAGTACTACTCAATCCTCAATgattttaattatttgaacaCTG GATTCTTTTTTCCTTTCAGAGTAACTTCATTAGTGGAGCACAACAAAATG TCACCCAACGCCCTAGCTATCGTTTGGGCGCCTTGTTTATTGAGGGCGTC GGAGGATGCAGATCCTTTAGAATCATTAGCTCAGTTGCCAAAACAAACAA AGTAAGAATATCTTAGGTTTTGCATCAGAAATTCCTACATAACCAAATAT ATGCAGTACTTTGACACAAAACTTTCAGCTCTCTTGCCGTCTATCGACTT AACATTTAAAATTAAGGTTCTATAATATTATCTACTCGTTTTTGGAACCA CCCACTCATCCTACAGGTTTAGAATACcttcctaaaatatttttttttct tcattgtaatgaggcccccagcggaccttcaattcacgcaatcacgcaat tttttttcgaaattcacgcattcacgcaaattttcctcgagtttcacgca ataatccgatttttcagaaatcggaaagtattttgtgaaaaatcggggaa acattggaaaatcgagaaaactgcacataattggtggaaaaaagggaaaa ttcacgtattcacgcacaaaatagcccagattcacgcattcacgcaatcg aAAAGTACATTTTcccgttcacgcaagttttttcaattcacgcattcacg ctttttttttttaattttcacgcattcacgcattcgaaaagtacattttc acgttcacgcaagtttttttaattcacgcattcacgctttttttttttaa ttttcacgcattcacgcaaccaaaaatgcccattcacgcaatcacgcaaa ccgcGGGGCCTCTGTAATATCAATCTAGTACCGGTCTCCTTTTTTTAGAT GTGTAGAGATTTTGATTGAATTCCAAGTGAAATCACGGAAAGATATGCTG AATGATATACAAGCTTTGTACAGGGCTGAAAGTACAGCAGGAGAGAAGCT GGACGACATCATTGTAAGTATTATCGATGAATTTGTACTTTAATggttta aattttgcggatttctcggatttgggtgtcatccgccaaattaaggccga ttggaaatttggaaagattGAAATATCTTAaattaaaacttcaaaatgtc aAGTGAGCtcctttttgaatgtttactggcatcttAGGAGCGCTAATAAA GcgaatttcaacaaccaacatgcatgatttggccGTAAAAGGCAAACAAA ATCGTGAAGATATTGTCTCTCAATCGTGCCACcggcgaaattaagtcccc gcggaTGAGCTCAATCGCGAAATCTAATCCCTGTGAAACTTTATTCCATT TAAATATGCGTTTATAAATCTTCTGACTTccacatcaaaacaaacactgC CTCGATTTTTTCAACAAACCTATGTCGATACATAATTTCGGTATATAATT TAAAATCAAGTGAGAACTTTAATTTGCTTTTCTTCAGCAATCGGAAGAAA CAGATGGCGATCCCGAgaagaataaagaaaatgacgaaatgaaagaaatc ttGAAAGCTCAAATACAAAACATGAGCACAGAAAGGTAAGAGTGCGTGCA ATTCAACTCAATTCTAGAGCAAACATTCAATGGACCAACCCCTAATGGTC GATTCAtacttaaaagaaaaaaacgtaccATCTTCATGATGTTACTCGCT ATTATAACTCACTCTGAGGGCATTGTAgtgtatttgacgtcaattttgct GGCATAAATGATAGCTAACCGGGCTAAATACAATTTCAGATTTTGCTTTC TAAAgtcaatattttgttttgaaaagtagaaaaaagcATTCATCTTAATT GTCCATAGAATGGACCCTTTATTGTTAAGTATGCCCTCTTCTTCGACTAA GACATAAATATCACTGGCGGGCCATAAATGAACAATCGCGGGCATAGCGT TATTGGTATATTTAAGGTTGGTTTGTATAATAAGAGAAGGATTTTAAAAC AACAAATGTATTTTTTGAGAACGATAGTTTACTTAGCCTGACCAAAGCCG CTGACATCTCTTAAAATATAGGCAAATGTTGAAAGCTAACTTTGTGAtat attttgcttttatttccGCCAGGGAGAGGATCACAAATAACATGGCCGCC ATTTCACCGCCCAAGACACGCTCTTTAGATTCTGTCGATGATCTAACGGA TATGGACTATCATTTAAGAGATAGTTTTGAAGTACTGCATTTCCCTGAAG GTATGTGCTGATGCTCTGATTTCAGTATTTTGTATTTTAGCTTATTGGCT CTTTTTACGTCGCCCCTTATTAGCATGATTATTCCGTCATTGGTGTAATA ACGGCTGATGTAAGAGATCGGTATTGAATTAGGGCCGggttaaaatggaa aaaatttagCTTTGGTGTAATAAATGCCGCCAATTATGGGGACGATGAGG TATGTAATTAACGCCATTAACCTTGTTTTTCggtcaaattttttggatga aattgttaccttattggtatatattttcgcgtgttacaaattttcgcggg tacttaatttcgcgagttttttggtcaattttcgcgaaatttaatactgt ttaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaatcagtctttttcttgct ttatattccgaatcgcgaaatttaatacacgcgaaaattttccagaagtc tgcaatcgcgaaatttaatacacgcgaagcacgttttttcgaaaaaattt tgcgattcgcgaaaatttgtaacacgcgaaaatatataccaataaggtag tcTAGTATGCTATGCGACATAGTCAGATAAAGTAAGAAATAGGAGAAAGA ACAACAAATTGATATTATTCCTTAACAATAATGGTATAATACATACAATA CCTATATTTCTGTATTACACGATTGATTTACATTGATTTCTCTACCACTT TTAATGAACGAATTTGTTCTGATATTGTTAGCTCGTTTGTGTAAAGCTTC AATTACTTTTTCAAGTTGATGATTTATCATATATACTTATTGATTAATTT CGattttctctgttttttttttctattagatGGTGACCATATTTCTGTTA CACGACAATCTAGCGTTATGGACATTTCAAACGAAACACCGTCGACGCCG ACGTCAACAGAAAAACGACACGTCGACGGCAATTCGTCATCATTTGAAGA TTTGTCGTGTGTTGGTACGTCAAAGTAATCTCCTGCTAAAACGtaacttt aatttttctaaaggaTCTTCTACTCATTTGTCTgtctttcttatattttt tcaaacaatgtgttctttttttaaaagataatttaaattattttagaaat tcTTCTAGTTTACCCTTTCTCTTCTTTTTCGGTCCTTGTTGAATTCGAGT CGagtcatccaaaaaataaaGCTTTGTTACGTCCATTGAGGCACTAGCtg acttttttaaagaaatatttcaaattttttgtcttttgactTTTTTCCAG GGTTTCATCGGGCTCATCTACGGGGTTGGAATAGAAAATAATAGggatat aaaatattttttaacattttaaaaagACATGGCTTTTATTACAAACTTCG ttagtgaatttttaaaaatcaattttttttttcatttttttttttcaaag tcagTCAGAAAGATGTTTTTTATATTGTGAAACAGAAATGATCAAATAAT GAAGCTACATtgtaaagaaatcaaaaagaaagcaAAGGTTGACTAAATGA ATACACGTGTTTCTATGTAAGAATAATGAAAGTTTGAGGCCAAATCATCC TCTCAGGACCTGATTAGTCATCCTATCTATACTCGATTtagaagaatatt ttttgaagaatttttaatgattcaatttAATAATTTAATGATAATAGCAA CAgtaaataaatgtttttttgttattattgttatttttaacagttttttt ttttgctacaaAATCGAAATCAATCTTCTGCCTGTGTACGAAATTTCTGA AAGCTCAATACTCTGAATTCACAGTCTGTGCCGTCATAATGAGTTAAAcc ttttcaaattgaatttgagtttttatttttcttgtaaaatataaatgaaT GTCATGAAAAAGGGTTTTAAAGAGGTACACTTATGGTAGATCTAGAATGT GTTAATATAAAAGATTTTAATTCCAAAATACCTAGATGATTTTCAAAACC AAACCCACTtactttatgaaaaaataattatctaCACACCTTTTTTTTCC TTTGTACATAGCTCAATTTTCATGaggttgtttgttttttgaaacTATAA AGAAAGCGCTCAGTGGGTTTTTATGCGCGATAATAGATAGTCAGTAGGGA AGGCTAGTTCGTGCAGAATGTTACGCTTATACACGCGTCTGTTCTCTTTA ATAGGGACATACGAAACTTATCagaaatttgttttataaagaAATACATT TATTAAATACAATAATTTATAACCACTTTACAATTTACTTTTTGTGTACT TTTTTGCTAATTTTCAACGAGATTGAAAATAGCAAAATCAAGATTTAACT TTATAGGTTAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000735XLOC_000735Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001379-exon-sc0000010-1491911889:749360..750396TCONS_00001379-exon-sc0000010-1491911889:749360..750396Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:749360..750396TCONS_00001379-exon-sc0000010-1510915933:749360..750396Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:749360..750396TCONS_00001379-exon-sc0000010-1575043694:749360..750396Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:750525..750619TCONS_00001379-exon-sc0000010-1491911889:750525..750619Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:750525..750619TCONS_00001379-exon-sc0000010-1510915933:750525..750619Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:750525..750619TCONS_00001379-exon-sc0000010-1575043694:750525..750619Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:750795..750957TCONS_00001379-exon-sc0000010-1491911889:750795..750957Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:750795..750957TCONS_00001379-exon-sc0000010-1510915933:750795..750957Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:750795..750957TCONS_00001379-exon-sc0000010-1575043694:750795..750957Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:751169..751269TCONS_00001379-exon-sc0000010-1491911889:751169..751269Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:751169..751269TCONS_00001379-exon-sc0000010-1510915933:751169..751269Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:751169..751269TCONS_00001379-exon-sc0000010-1575043694:751169..751269Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:751412..751466TCONS_00001379-exon-sc0000010-1491911889:751412..751466Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:751412..751466TCONS_00001379-exon-sc0000010-1510915933:751412..751466Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:751412..751466TCONS_00001379-exon-sc0000010-1575043694:751412..751466Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:751753..751824TCONS_00001379-exon-sc0000010-1491911889:751753..751824Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:751753..751824TCONS_00001379-exon-sc0000010-1510915933:751753..751824Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:751753..751824TCONS_00001379-exon-sc0000010-1575043694:751753..751824Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:751993..752082TCONS_00001379-exon-sc0000010-1491911889:751993..752082Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:751993..752082TCONS_00001379-exon-sc0000010-1510915933:751993..752082Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:751993..752082TCONS_00001379-exon-sc0000010-1575043694:751993..752082Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:752233..752349TCONS_00001379-exon-sc0000010-1491911889:752233..752349Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:752233..752349TCONS_00001379-exon-sc0000010-1510915933:752233..752349Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:752233..752349TCONS_00001379-exon-sc0000010-1575043694:752233..752349Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:752714..752848TCONS_00001379-exon-sc0000010-1491911889:752714..752848Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:752714..752848TCONS_00001379-exon-sc0000010-1510915933:752714..752848Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:752714..752848TCONS_00001379-exon-sc0000010-1575043694:752714..752848Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:753136..753257TCONS_00001379-exon-sc0000010-1491911889:753136..753257Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:753136..753257TCONS_00001379-exon-sc0000010-1510915933:753136..753257Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:753136..753257TCONS_00001379-exon-sc0000010-1575043694:753136..753257Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:753660..753801TCONS_00001379-exon-sc0000010-1491911889:753660..753801Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:753660..753801TCONS_00001379-exon-sc0000010-1510915933:753660..753801Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:753660..753801TCONS_00001379-exon-sc0000010-1575043694:753660..753801Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:754203..754293TCONS_00001379-exon-sc0000010-1491911889:754203..754293Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:754203..754293TCONS_00001379-exon-sc0000010-1510915933:754203..754293Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:754203..754293TCONS_00001379-exon-sc0000010-1575043694:754203..754293Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:754432..754527TCONS_00001379-exon-sc0000010-1491911889:754432..754527Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:754432..754527TCONS_00001379-exon-sc0000010-1510915933:754432..754527Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:754432..754527TCONS_00001379-exon-sc0000010-1575043694:754432..754527Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:754644..754681TCONS_00001379-exon-sc0000010-1491911889:754644..754681Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:754644..754681TCONS_00001379-exon-sc0000010-1510915933:754644..754681Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:754644..754681TCONS_00001379-exon-sc0000010-1575043694:754644..754681Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:754905..754930TCONS_00001379-exon-sc0000010-1491911889:754905..754930Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:754905..754930TCONS_00001379-exon-sc0000010-1510915933:754905..754930Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:754905..754930TCONS_00001379-exon-sc0000010-1575043694:754905..754930Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:755244..755364TCONS_00001379-exon-sc0000010-1491911889:755244..755364Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:755244..755364TCONS_00001379-exon-sc0000010-1510915933:755244..755364Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:755244..755364TCONS_00001379-exon-sc0000010-1575043694:755244..755364Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:763733..763849TCONS_00001379-exon-sc0000010-1491911889:763733..763849Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:763733..763849TCONS_00001379-exon-sc0000010-1510915933:763733..763849Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:763733..763849TCONS_00001379-exon-sc0000010-1575043694:763733..763849Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:764452..764532TCONS_00001379-exon-sc0000010-1491911889:764452..764532Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:764452..764532TCONS_00001379-exon-sc0000010-1510915933:764452..764532Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:764452..764532TCONS_00001379-exon-sc0000010-1575043694:764452..764532Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:764909..765019TCONS_00001379-exon-sc0000010-1491911889:764909..765019Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:764909..765019TCONS_00001379-exon-sc0000010-1510915933:764909..765019Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:764909..765019TCONS_00001379-exon-sc0000010-1575043694:764909..765019Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:765577..765855TCONS_00001379-exon-sc0000010-1491911889:765577..765855Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:765577..765855TCONS_00001379-exon-sc0000010-1510915933:765577..765855Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:765577..765855TCONS_00001379-exon-sc0000010-1575043694:765577..765855Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:766346..766548TCONS_00001379-exon-sc0000010-1491911889:766346..766548Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:766346..766548TCONS_00001379-exon-sc0000010-1510915933:766346..766548Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:766346..766548TCONS_00001379-exon-sc0000010-1575043694:766346..766548Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:766840..766893TCONS_00001379-exon-sc0000010-1491911889:766840..766893Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:766840..766893TCONS_00001379-exon-sc0000010-1510915933:766840..766893Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:766840..766893TCONS_00001379-exon-sc0000010-1575043694:766840..766893Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:769429..770054TCONS_00001379-exon-sc0000010-1491911889:769429..770054Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:769429..770054TCONS_00001379-exon-sc0000010-1510915933:769429..770054Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:769429..770054TCONS_00001379-exon-sc0000010-1575043694:769429..770054Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:770465..770565TCONS_00001379-exon-sc0000010-1491911889:770465..770565Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:770465..770565TCONS_00001379-exon-sc0000010-1510915933:770465..770565Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:770465..770565TCONS_00001379-exon-sc0000010-1575043694:770465..770565Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:771288..771413TCONS_00001379-exon-sc0000010-1491911889:771288..771413Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:771288..771413TCONS_00001379-exon-sc0000010-1510915933:771288..771413Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:771288..771413TCONS_00001379-exon-sc0000010-1575043694:771288..771413Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:771771..771931TCONS_00001379-exon-sc0000010-1491911889:771771..771931Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:771771..771931TCONS_00001379-exon-sc0000010-1510915933:771771..771931Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:771771..771931TCONS_00001379-exon-sc0000010-1575043694:771771..771931Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:772396..772417TCONS_00001379-exon-sc0000010-1491911889:772396..772417Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:772396..772417TCONS_00001379-exon-sc0000010-1510915933:772396..772417Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:772396..772417TCONS_00001379-exon-sc0000010-1575043694:772396..772417Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:772821..772874TCONS_00001379-exon-sc0000010-1491911889:772821..772874Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:772821..772874TCONS_00001379-exon-sc0000010-1510915933:772821..772874Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:772821..772874TCONS_00001379-exon-sc0000010-1575043694:772821..772874Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:773049..773148TCONS_00001379-exon-sc0000010-1491911889:773049..773148Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:773049..773148TCONS_00001379-exon-sc0000010-1510915933:773049..773148Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:773049..773148TCONS_00001379-exon-sc0000010-1575043694:773049..773148Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:773301..773389TCONS_00001379-exon-sc0000010-1491911889:773301..773389Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:773301..773389TCONS_00001379-exon-sc0000010-1510915933:773301..773389Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:773301..773389TCONS_00001379-exon-sc0000010-1575043694:773301..773389Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:774126..774216TCONS_00001379-exon-sc0000010-1491911889:774126..774216Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:774126..774216TCONS_00001379-exon-sc0000010-1510915933:774126..774216Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:774126..774216TCONS_00001379-exon-sc0000010-1575043694:774126..774216Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:774690..774770TCONS_00001379-exon-sc0000010-1491911889:774690..774770Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:774690..774770TCONS_00001379-exon-sc0000010-1510915933:774690..774770Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:774690..774770TCONS_00001379-exon-sc0000010-1575043694:774690..774770Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:776551..776679TCONS_00001379-exon-sc0000010-1491911889:776551..776679Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:776551..776679TCONS_00001379-exon-sc0000010-1510915933:776551..776679Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:776551..776679TCONS_00001379-exon-sc0000010-1575043694:776551..776679Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:777438..777543TCONS_00001379-exon-sc0000010-1491911889:777438..777543Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:777438..777543TCONS_00001379-exon-sc0000010-1510915933:777438..777543Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:777438..777543TCONS_00001379-exon-sc0000010-1575043694:777438..777543Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:777929..778060TCONS_00001379-exon-sc0000010-1491911889:777929..778060Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:777929..778060TCONS_00001379-exon-sc0000010-1510915933:777929..778060Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:777929..778060TCONS_00001379-exon-sc0000010-1575043694:777929..778060Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:778758..778872TCONS_00001379-exon-sc0000010-1491911889:778758..778872Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:778758..778872TCONS_00001379-exon-sc0000010-1510915933:778758..778872Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:778758..778872TCONS_00001379-exon-sc0000010-1575043694:778758..778872Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:779347..779444TCONS_00001379-exon-sc0000010-1491911889:779347..779444Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:779347..779444TCONS_00001379-exon-sc0000010-1510915933:779347..779444Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:779347..779444TCONS_00001379-exon-sc0000010-1575043694:779347..779444Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:779982..780109TCONS_00001379-exon-sc0000010-1491911889:779982..780109Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:779982..780109TCONS_00001379-exon-sc0000010-1510915933:779982..780109Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:779982..780109TCONS_00001379-exon-sc0000010-1575043694:779982..780109Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1491911889:781139..782620TCONS_00001379-exon-sc0000010-1491911889:781139..782620Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1510915933:781139..782620TCONS_00001379-exon-sc0000010-1510915933:781139..782620Clytia hemisphaericaexon
TCONS_00001379-exon-sc0000010-1575043694:781139..782620TCONS_00001379-exon-sc0000010-1575043694:781139..782620Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:749360..782620 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.62059 2.93046 2.1961 2.38233 39.7795 28.5571 25.846 27.9586 16.4704 18.2464 15.9549 10.7045 12.4545 12.2719 11.8705 16.1564 13.896 12.7264 10.6843 13.9277 12.0768 12.4051 9.77807 13.4292 9.04507 9.74783 21.9411 19.2413 21.568 18.3278
Blast
BLAST of TCONS_00001379 vs. Swiss-Prot (Human)
Match: MYO9B (Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 413/937 (44.08%), Postives = 607/937 (64.78%), Query Frame = 3
Query:  618 LYREKTDIDDLVALPVLNETVLLDQLCTRFCKGRIYTYVGGILIAINPFKYFPIYNPKYVNAYQNKKLGELPPHVFAIADAAYNRMLISKQNQCIVIXXXXXXXXXXXXXLILHHLTALSHKTKATVLEKTILAAGPVLEAFGNAKTSYNNNSSRFGKFTQINYRADGVVCGAVLKKYLLEKSRIVQQGINERNYHVFYSMLAGASQTERETLHLLTPQEYFYLNQTQCYTIEGMDEVYEFARLKNSIKNIGIPSITQQRMFAVLSAVLHIGNITFRKRSFP-EDSVSVADEKIIEIIAELIQVDKQELIVPMTMRKTITRGEEFVRQYKKDEAIATRDSMAKCLYASLFDWIVLQTNHIMVSKQGRKVDKKAFSIGVLDIFGFEDFERNSFEQFCINLANENLQFYLNQHIFKIRQDEYVEEGLDWDHVDYADNSTCLNLMVGKPTGLILLLDEECSLTIGTDESLLDKFNQHHSNNTCYEMPPTREPVFSILHYAGKVKYQIEGFRAKNRELMRNDVVSVFRNSRMLFVRELMGSDPVAIYYWSILRHTIKAVSIFXXXXXXXXXXQRMFEPKASVSWMKSKTPPNK--------SKALMRQLTEAEIDTTG---------QAMMRRATKVMNRRVLDM-AKRIQS----PSRMRSGLEARRTISGGMSEYARRGGL-----KQPPTVVAQFQSSLMELMDALNQSHPFFVRCIRSNAVKAPLKFEAELVLRQLRYTGMLETVKIRQAGYPVRIFVKQFVNQFRILLRAKDLDRISEDELTQMLTDLGLDTDEFQVGANKVFMRESQYQLLRDKMQQAVDRAATTIQVWY----HRRYLRKLKELEISSAIIIQKYWRGFVCRREYVYYQETRLRNRSARRIQNFWRTHEQTAARKPNKFNRFKRNVIKLQSIWRGYKCRNDYPKLLAERKEAEE 3332
            L R++ D DDL  LP L E  LL  L  RF + +IYTY G IL+AINPFK+ PIYNPKYV  Y+N++LG+L PHVFA+AD AY  ML  + NQCIVISGESGSGKT+ST  ++H LTALS K  A+ +E+TIL AGPVLEAFGNAKT++NNNSSRFGKF Q++Y   G+V GAV++KYLLEKSR+V Q  +ERNYHVFY +L G S+ ER+   L  P++YFYLNQ      +G D  ++F RLK +++ +G    T++++FAVLSA+L++GN+T++KR+   E+ + V   ++++ +++L++V ++ L+  +T RKT+T  ++ +  Y   EAI  RDSMAK LY++LFDWIVL+ NH +++K+  +      SIGVLDIFGFEDFERNSFEQFCIN ANE LQ+Y NQHIFK+ Q+EY  EG+ W ++ Y DN  C++L+  KPTGL  LLDEE +    T ++LL KF Q H +N  +   P  EP F I H+AGKVKYQI+ FR KN + MR D+V++ R S   +VREL+G DPVA++ W++LR  I+A+++ ++AG  RA+     E  A +S   +++ P +        S+ L R L    I +           +++++  +++   R   + +K I+     P  +      +  IS  + +   +  L     K+PP++ AQFQ+SL +L++AL ++ PFF+RCIRSNA K  L F+ ELVL+QLRYTGMLETV+IR++GY  +   + F  QF++LL  KD     E  ++ +L  + +D   +Q+G  KVF++E++ Q L++ + + V R    +Q W+     RR+  ++K     +A+ IQ  WR +  RR          R ++A  +Q  WR + Q   RK   +   K+++I+LQS+ RG+  R  + ++++E+++AEE
Sbjct:  141 LPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAGSILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPEDYFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRATGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDSMAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYANEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFPHATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIVALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERA---EKAAGMSSPGAQSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKSKGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLEALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTEQFQVLL-PKDAQPCRE-VISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKILLLQSWFRMVLERRHFLQMKR----AAVTIQACWRSYRVRRALE-------RTQAAVYLQASWRGYWQ---RK--LYRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEE 1056          

HSP 2 Score: 234.187 bits (596), Expect = 2.393e-61
Identity = 159/497 (31.99%), Postives = 250/497 (50.30%), Query Frame = 3
Query: 4038 ELEALNGFLMKKVADMNKPDPEKKNDSGADVTFKHALHKYHGNL--LFTCANASVNRKEEILLKFNDLVHGFQETLEQIINQADSGVSKEFSVMGVNLFRGILEEFQKNKDKLVVKTRSNIKHVKKKRRKTAEFYEHKGHVYTFQNFNIRTYCEYCNSYIY--DKGLVCQACAFTCHKKCHSKYPKTCK---GRRPSLCGPSTLFGTPMSELTSPNNPIPETVIKLMIEIEKRGLYTLGIYRKPGPQAAINNLKSVLTSTEAEELILEDEKPHTLASILKLFFRQLPQPIIPFNYYDDFIRSTDLENKKEIHSTLYELIQHLPKENKLLLERLIVHLGRVTSLVEHNKMSPNALAIVWAPCLLRASEDADPLESLAQLPKQTKCVEILIEFQVKSRKDMLNDIQALYRAESTAGEKLDDIIQ----------SEETDGDPEKNK---------------------ENDEMKEILKAQIQNMSTERERITNNMAAISP 5414
            EL+ L+ FL+ K+ D+      +   +  +  F  A  K+  N+  +++  N  ++      + + DL+  +Q     + N A     K+ +++ +NLF+ +L+EF +   K   +     K  KKKR++     EH GHV+     +I   CE C SYI+  DK L+C  C  TCHKKC  K    C    GR+         FG  +  LTS    +P  + KL+  +E  GLYT G+YRK G       L+  L  T+   + LE+   H +  +LK + R+LP+P++ F  Y DF+R+ +L  K+E  + +Y +++HLP+ N   LERLI HL +V  L + N+MSP ALAI++APCLLR  +++DPL S+  + K T CVE+LI+ Q++  K  + +I  L  AES A  +L  + Q          S   +G   K+                      + D  KEIL  +IQ++  E+E IT  +  + P
Sbjct: 1510 ELKYLDEFLLNKINDL------RSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIH------VGYKDLMENYQIV---VSNLATERGQKDTNLV-LNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKKRKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQAL-QTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDITYRLPELDP 1989          
The following BLAST results are available for this feature:
BLAST of TCONS_00001379 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MYO9B2.393e-6144.08Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B... [more]
back to top