Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001349 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001349
Unique NameTCONS_00001349
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4546

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001349 ID=TCONS_00001349|Name=TCONS_00001349|organism=Clytia hemisphaerica|type=transcript|length=4546bp
gaaaaaaatcaaaagaaaaaagtgaaaataatcaGGAAAATTTCTACAAA
GATGATAAATGAAGCAACACAagaaaacaataacaaagaaGTTCGGAAAG
ActCATTTACCAAAAAAGAAAACCATCACCAAAAGGAAATTATTCTTGAG
AAGCATCACCTTGAGTTACTTTTAATTGAATTCAAAAATGGCAGTAGTAG
TCGTGCTGGTTCCAAAGCTAGTGCAAAATCCTCATTGTCTCCAACTGCAA
AACAAATGGATTGTGAAACATTCAGTCAAACATTATCAGAGATTATCAAA
AGAGATGGTTTGATCCAGAATGATGATTTGATCAACAGCAGCTGTCAAAT
GCTGTTCAAAAAGATTGATTGGAGGAAGCGTGGCATTATATCATGGGATG
ATGTTTGTTCATATTTCATTCTTGAAAGTAAAGATTCTGAAGAAGTGATT
GACAAACAATCAGCATTTGTCAGTCAACCTCATATTGTCAAATTCTCTAC
TTTAAAGGACAATATCTCGAAACTTGTACCAGAGAGTAACCCATCACGTT
TTATACTGGTCACTAAAACGGGACATATATGTATGTTCACCTCTGACctt
tgtttatcaaaaaaacttCATATGGAAGATCCACTGGAAACATCACTTGA
TGAGGTCCCGAAAAAGAGACGAACTAAACTATGGGTGACAGACTGTGTGT
GCATCAAAGAGCTGAATAAGCTGGTCATTTGTACCGCTAATCGTGATTTA
CAGATTTTTGATTTGTCAACGCCACATTGCTCACAACAATTTCAACTTTA
TGCTCTACCTAATGCGGTTCTGTGTATGGTCTACCATTATATACCCTCGA
ATCCCTACGATCAGTTGTGGTTGTTCTTCGGTACTGACAATGGTGACgtt
cattggttgaaatttcATATGGCAAATAAAAGTCTCTTTCAAATGCCTTT
CAAAAAGACCGACTCTTGTTGGAAAATACTTTTCAGTGACTTAGCGAACC
AATCAAAATACGTTTCGCATCAATTATTTTCACACATGCATTCTGATTGG
GTGAGACGTTTACAATATGTTCCACAAGGTGATCTATTGTTCTCATGTTC
CAGTAATGGCCATGATTCATTGGTTTATCGTTCTTTGGATGAAACCAAAC
GCAAAGTGTACGTCTTTAAAGTCACAAAGGGCATTGAATGTTTTGCATAC
AACAAAGAACTAGCCTTGATAGCAACTGGAGGTGTTGATCACGTTCTCAG
GCTATGGGACCCTTACGTCACATCTAAACCAATGGCCATCTTGAAAACAC
ATCAAACCTCGATCATTGACGTCATGATTTATGAGCCGTTACAACAAGTT
GTCTCTTATTCGAAAGATGGGgttATTATGACTTGGGACATCAAAGACCA
ATCACCCCTCCAGCATTTAAGTATAAAGTTCCCCTTCACCGGTACTGTAT
TGGAACACGGCGGCTTCCCGCTCTGTCTGACGTCTCATGGATCACTCTTT
GTGGCCGCAGAAGACTGTATCGCTGAATTGAAACTGACCACGGCTGGTGC
ACATCGACAGAACGCATCTCATAAAGGGTGCGTGGTAGCCGTGTACCATA
TTCCACACAAAAATCAGATCATCTCAGCCAGTGAATTTGGTGATATTTGT
ACATGGAGCTTAGATAGCGGTCGAAAATCTTCCACCATACAAACAAACCA
GAAATCGAAAGAGGTTCTGGCGTTTACGATCGATAAAAATGCTGAATTTG
CTGTAACTGGTCACATTGACGGTAGTGGGCAGCTTTGGAATTTGATATCT
GGCAAGCAAGAGAAAACATTAGCAGCATATTCTGATGAAGAAATTACCAA
TTGTATCGCTCTCCCAAACGCTTCAATAATCTTCATGTTGGGATGGAGCA
AAAAAATTCTGATGTACAAGAACACTAACCAGTATAAAAAGTTAACAACT
CTTCGACCCGATACTGGTTGGCTTTCAATCAGCTCACACAAGGACGATAT
CATATCAGCGGCATTTTGGGAACCACATTTTCTTGCCACGGGTACATTCG
ATGGAGATATTTTCATTTGGCATATCGAGCATGAGCGTTTGTGGAGAAAA
ATTCAAATCGGCCGTGGACAACCTTTATTTCAATCGTTGGTTAACCAGTA
CATTATGCCACCGCGGACCGCGCGCAGTGGTCGGAGAAGAGAGAAACAAC
ATCAAGTACTCAGagTATCTGATGAAGAACGCCCACCAACAAATCAACAA
CAAAAAGAGCATGGAGAATACACCATGCCTGTAGATCTGTTGTTATATTT
GGGACATCGAGACCACGAGACTTATGCCTCGCTTATTGCAACAGAAGGTA
ATCGGGTCAATTGGTGGAGTACAACTGCCATTGGAACACCCGTCGCCTCG
TTTACAATCAGTGAAGATACAGAGAAAGTTATCACAGCCATCACATCTGA
TCTTGACAACCGTTACGTCATTGTTGGCACGAATCAAGGTGAAGTATCGA
TCTGGAATATTGTAACGTATGGTGTTTATAGAAGATTCGCTGATGTCGTT
CGAGAGGGGACTCCGTCTACTCCGAAAAGTACACCTCTTACCGAAACTTT
CCGAGAGCGACCGCCTTGCGTGCACACGTGGAGCTGCCGAAGTATGGATA
TGATCGTATCACTATGTTGCTTCAAGCGAGATAAGGAAATGGTTGCGGTT
GGCCTAGAAACTGGATGCATTTCTTTATTCGCGTTGAGCGGTGATTACAT
TGGAATGTTCAGTCAGATCGAACCATGGAACTTAACAGAAAGTGAGAGAA
TTCAAACTAAAAGTCCTAACATCGAAGAGCCTCAAAGAGAACTTTGCACT
GAGAaggacgaagaagaagaagaaaaagttgatttGAATATTAAGAATGA
TGTCCATAATAACGAAGCTGAGAATCTTGTCGGTGAACCTGCTGATGTCC
AACAGAGTCAATCTCTACCAGAGCTGGGTGTGTCCAATAGACCGCCCATC
CCTGCCAGTACTACTGGTAGCGTTGGTGGTAACACAAAAGACAACACTAT
TTCGAATGatgttcaaaaaatgaagaaaactgaATATTATCAAACCATAT
CTTCGATTAATGATGACATCGTACAACAAAAAGCGGCATGGTCACTCCTT
GGtgaaaaatacaattcaaactTCAAACGTCGCATGCAAGAACGTCTATC
CCGACGCCGCCATTTTAGTGACGTGACCGTTGCTAGTGGAGACAAGCCGT
TGTTGCAACATAGCGGTGGCCTTGGTAACCTGTGTTCACCTTTTCAAGCC
CTATCAACAAAGGATTGTGAGGATTTCGTGCTACCCAAAGGCTTACCAAT
AACATCCAGGATGACTGCTCATTCCATTGACCCATACAACGGAAATTCTT
TGGAACAAATGTCTTCATTTGGTCATTAACTTTCTACATTAACATTTATA
GAtaatttttatggatttttggattgaaaatatttttaacttttgataaa
taaagacttggggacacgagaagtttttttcgagTTGGTGCAAcgcaaca
tgctctatcccaccaacacaagaaaaaagtgcgtgtcccatggtttcttt
tttgtttcatggtacaaaaagtgagggaaatacccaaaagacacgctgat
tttgtcccagggtcaaaagtgagatttcacttttaatgatagaaaataga
aaaaatggggtggagatacgagaaagcgtttcaggttggtgggatgaagc
atgttgcattgcaccaacgcgaaaaaaacttctcgtgtcttCCAGTCTTt
atttatcaaaagttaaaaatattttcaattcaaatatttttccttaAGTT
TTGAAATGGAGAATTTTTCTAACGTGTAATTGcttttgtattttgaaatt
AGTTTTTGAACCACATTTTTTCTaggattttttttgatttcgtaGAATTA
GAATTCGCGAGTTTGAGTGCCATTCTTGAAATAAGCCCACGATAGAAATG
TAAAAGTACGTGGAACACGAAAATTATTGGCATATGAGGATTCAATTTAA
TTACCAATATTTCATACAGTGTGTCCCGAAAAAgagtatcgagttcgaac
attATTCTGAGTAGgaggttgttgcgtgtgtttaacaaaatgcacaataa
ttgtttttaccaacagtcattatgattaaaaataattaactctctttaca
attttcatgacgttaaaaTTATTGAGAATTGCTTTTTGccaaagttattc
ataaaagatgtctcgtGACAATTGatatgacacagagagaaactttgata
aacattgcaaatttaagtgaaacacacacaagaactttctttctacgtct
caatactttttttcaggacaccctgtataatgATATTTTATCGCATGACA
TgtaaaatatctgcaatctgattggttacaTTACAGTGCATAAACGTCAT
ATTTTCATTTATTGCACTGATCAATGCAACAGCTTCATTTTTTTAACGTC
AATTTctttgagaaataaaaaaagaaagtagATTTTTCAAGTCTTG
Run BLAST on NCBI

transcript from alignment at sc0000010:586520..625762+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001349 ID=TCONS_00001349|Name=TCONS_00001349|organism=Clytia hemisphaerica|type=transcript|length=39243bp|location=Sequence derived from alignment at sc0000010:586520..625762+ (Clytia hemisphaerica)
gaaaaaaatcaaaagaaaaaagtgaaaataatcaGGAAAATTTCTACAAA GATGATAAATGAAGCAACACAagaaaacaataacaaagaaGTTCGGAAAG AGTAAGTAATTAAagttgtgtttttgtttttcattcaatatttATTTACG ATAACTTCTTTGCTCAAAGCTCATCCATTCATTGCAAAGCTCGGTTTCAT AATGTTTTCAATGTATCTGTCAAATTTTAGTTATATAAGTTTCTTTTATT AGGGATGTTTTTCACAATATTAAAAGGAGGTTCGCCTCTTATTTATGCTG ATAAAACAGAATTaatgaaagaatttttcaaaattttcttgtatGACACA GGAGGGGAAGAAAGTTGTTCTATCTATTGTTTTAAAATGCTAATGGCAGC AGATacgtttttttgtaaataatgtgcttttagaaaaattaataattaaa tattatttttctttaacaatataattgtttttgtttttcaagctCATTTA CCAGNAATGAAGACATACTATTGCATTTTCTAAAATtgcacacacatgta aatagagctttgtgaatgccataatatttttcccctatactgagacctaa aattttatcaggctggggggaccttgttttcaggggggacctaaatttgg caGGGGGACCTtgaaccccagtcggagccatgaaaaagaaagtcgttatt gtaaactttgaacagctttgaacatgcttaaaaTCGAGGTAACTACCACT AACTGGAAATTATCTGCTCCATATTCAGGTATATATTACAGAATTTGTAG GGCATTGCACGAGAAGATTCCCAGTATTATCACGTGCTACAGtaatcaat aaatttgattaacAAAGTAAACGACCATGCCGAGAGACGCACCAGATAGT TTGGTGTTTTGTCCGGTACCATTAAGTATATCTTAGCCACACCATTTTGT CCGGTGTTAGTCCAGTGTTAATTTTCTGGAACTTCTGGACACTGGACACT GGATTTTTGTATGGGGTTATTCTTATGCATTGCAGGTttcagcgaaaata tattcaattcaattgagTAAAAGACTTTAGTTTGTCACTCACTTTAAGGA AAGTATAGAATGTTTCCAAGGGTTTTtctgcaaattttgccattttccag gggttattcacatatttttttcatagaattcAGGCTGGATTGCCTTTTGA TTGGTTAATTATTGATCGATTGATCATCAATTGGCTCTGAGATGATCAAT TGATCACAATTGAAAGCCAATTGATGAAAGAAACCAATGGATCATCAATT GAAACTCAAGACCTTACATTAGAAAACAATCGATCAATATTCAATCAATT GGTTGGTTATCGTTTGGTCATTGATTGGAAAAAGTTATCAATTGTATAAA GTGGGATCTCCGGATAATACTAGTCCGTCAGAGATTCCTTGgtctttttt taacattatttggatagaataaaaacattctatcttgcgtttactctttc cttcccaactaCCTTCGCTTTtacttatgtaggttttaaaatccacaagt aatgagcctctcttctgtcaggtttcattccgtacgttttttatccacac gGTGAActggtttccccgattttcctataattaaaaattggagcTTTCCT GTGGGAGCGATTGGGCGTACtgccatcgcgaaatatttttcgtaaaaatt tactgtattctaacgctaatataatctagataggaaactaATATTAAATT CTACTCTCTTTtgctcgtatttctaaatttcactatagaaagaaacaata aatttatcgcccggaAGCATGGCTTAGCTAAgggcacctctcttattcat tatctagaAATTGAAGCAGGCAAAGATTACCACTAGGGCggacaaaggtt atttgaagatatttttagtTATAATctaaggtagaacaaactaaacatag aaagggggtattttttaattcaattcgatgatcggtatttttctgaattt tatgtttagatttttctacccagccctgtTCGTAGGTATTGCTAATATAT CTCAAACTGCTTTCTAAATCattcaatataaaaattttagaaaaaaatca aaagaaaaaagtgaaaataatcaGGAAAATTTCTACAAAGATGATAAATG AAGCAACACAagaaaacaataacaaagaaGTTCGGAAAGAGTAAGTAATT AAagttgtgtttttgtttttcattcaatatttATTTACGATAACTTCTTT GCTCAAAGCTCATCCATTCATTGCAAAGCTCGGTTTCATAATGTTTTCAA TGTATCTGTCAAATTTTAGTTATATAAGTTTCTTTTATTAGGGATGTTTT TCACAATATTAAAAGGAGGTTCGCCTCTTATTTATGCTGATAAAACAGAA TTaatgaaagaatttttcaaaattttcttgtatGACACTACACAGGAGGG GAAGAAGGTTGTTCTATCTATTGTTTTAAAATGCTAATGGCAGCAGATac gtttttttgtaaataatgtgtttttagaaaaataaattattatttttctt taacaatataattgtttttgtttttcaagctCATTTACCAAAAAAGAAAA CCATCACCAAAAGGAAATTATTCTTGAGAAGCATCACCTTGAGTTACTTT TAATTGAATTCAAAAATGGCAGTAGTAGTCGTGCTGGTTCCAAAGCTAGT GCAAAATCCTCATTGTCTCCAACTGCAAAACAAATGGATTGTGAAACATT CAGTCAAACATTATCAGAGATTATCAAAAGAGATGGTTTGATCCAGAATG ATGATTTGATCAACAGCAGCTGTCAAATGCTGTTCAAAAAGGTTTCTCCA CGCTTTGTGACTTTTTACTTCAATAGGCCTTTTCATGAATTATTATGAAT GCAACGATTGCCTCGATTTGAAACagttaccaaggtgattaaatcccttg agttttgaagttttactttttgaatAGTGAAAACCTCTTAtgaactcctc tgggaatcaattatcatagcaatattttgaaaacgaagtaagcgttgctc gtgacgtaatttgtGAAAAGGCTATTATCTGGAAGGTTAAAATGCTTTGT GACTATTACTtcaattatctttcaaattgtatctgaaatcaacttttatc tagatttaaaaaatttttaattatatttaCAGATTGATTGGAGGAAGCGT GGCATTATATCATGGGATGATGTTTGTTCATATTTCATTCTTGAAAGTAA AGATTCTGAAGAAGTGATTGACAAACAATCAGCATTTGTCAGTCAACCTC ATATTGTCAAATTCTCTACTTTAAAGGTAACAATTTCTTGACAAtaatca aattacaaaaaaaagcaTAGTTGAGTTTAAATCTAAGTCCCAAAAGATAA GGCTTTATAACATGGATAAAACACTAAAGTATTTAAGTGTTAGAATTATT GGTTAGTCTCGACATaggaataaaatcaaattttatgaaTATAGAACATA TATTTATGCTATGCACCATTGCATTCCAATGtattccacggacccaacag ctgattggttgaaattgacgttttgactgattttacatcactcacaacca atcagctattgggtccgtgatgtaatgtcagaagacattacaagaatgta tatcatgaatagtatacagtctctttaactcgagcctctataactcgaat gtctccttaactcgaacaagttttatcgtcccttcagttaacagcACCTT AAAAAtcatctccataactcgaaattttcttaTGGAACAAATTGGTGTTT CCTGTGCATGTTCGAGTTTATGGACATTCAAATGTAGCAAGCTTAAGNTT GTGTTTCCTGTGCATGTTCGAGTTTATGAAGATTCAAATGTAGCAAGCTT AAATAACATgacataaattttaaatttgccaATACAACAGCTTTTCTGTA CTTTTCTTATACAGGACAATATCTCGAAACTTGTACCAGAGAGTAACCCA TCACGTTTTATACTGGTCACTAAAACGGGACATATATGTATGTTCACCTC TGACctttgtttatcaaaaaaacttCATATGGAAGATCCACTGGAAACAT CACTTGATGAGGTCCCGAAAAAGAGACGAACTAAACTATGGGTGACAGAC TGTGTGTGCATCAAAGAGCTGAATAAGCTGGTCATTTGTACCGCTAATCG TGATTTACAGATTTTTGATTTGTCAACGCCACATTGCTCACAACAATTTC AACTTTATGGTTCGTATGTACCTTTCGAACAAAATCTAGTTTTCATCTTA TTATGTCTCTTCTgccttatttctttttttaatgaataCCCCTGTTAGCC CTTGAACCAGAAGCCACACGAAAGGTTTGGTTTACCTTGGTCAAATATGA CGTCAAGTGGTGGAAGCTATTGcatactctcaggtgcctaataaccCCCC CCCTGCCGAgatctgacaaaaggaagtaaccatcaatttttgaaaattca tatttttgcaaaaatcaactCCTAAGAGTCCAGCTTGTGTTTTCCAGTAG TTGATTTCTAGTAAAAgacttctttttatcaatttttttggactaaagtt tcattttattttctgacaaaaggaagtaagtCACTTACTTCTTTTTatag cctgaaaaattaaagttGCTTGCAATATTTTGTAgtttattttctgacaa aaagaagtAACTCTAAAATTTTTAGCTTGAAAGAGCTTGAGTAGAGTAAA ACTTGTGTGGATTTTTCCAGAATCAAGATGTTAAAACTTCTTTTAACTCC TTCCTTTTAATATTATACTATTCTAGGGTTTGGTCTTTCACAATCAGCAA AAGTTTTGATCTTAAAACGATACCATTAATCTTGAATAAGGTCAACTCAT TTATGCAATTATCTCAAAATAGGAAAAATGcagttacttccttttgtcag atcacggcagcccccccccctattgttaatttttcgatttgttTTTCAAC CAATGTTTCATCTTCCATTTAGTCTAAAATTACCTTATTTTAGGGCTATT AAATAGAGGTATGATTTTCAATCCCCCCGGTAATAAGGCCCCCATTgaac aattttccaaccccctccgTTTATCAGGCACCTGAGAGTATGTGTGTATA TTTAGATATTTTGTTATCGTTCAACCCTGTAAGCTTGAATGTAGAGTGCC CACAGGTTTCTTTGCCAGGCTTCAAAATTGTCTAAGTAGACTCAAAGAAT CGTGCCAATACTCCTCGTTCTAGGCTTGGTAAGATGATTTGAATAGGAAG AAAGACGATCTTAGgttattttcttttcatctttcatttttctagCTCTA CCTAATGCGGTTCTGTGTATGGTCTACCATTATATACCCTCGGCAAGAAA TCtcgttttttttctctaaaaatgaCAATAGTCGACTTCAAAAGTTCTTT TATATTCACCTACTCAATAAAACCGGTCATGTTGAATACAATTTCTCAGT AATTCAtataaaatcgctaaaatataattgttttttggATTGCAATGCTT CATAAAatgcaagtttttttttcattttcaaatgttttttcttaagaGCT GGAAATATATTTTCACAAAATACTTACCAAATTTATTTACATTACAACAT TGATCGGAAAATAGTAAGCAGAGTAAGAGTCAGTGTAAACTTTGTACACC TAGCAATATAAGGTGTATAGTTTTTAGCagctttttaattgttttacgGG GTCCACAGTCAACAAATCTTGGCTTTCTGTGAATTGGAATTGGTAGAAAC TgagctttaaaggttttatttttacataagctGACATAAGCGTTATCGTT TCATattagacacatatttcatatcagggcagCGTCTGCCTTTTGTTATA GTATGCTGATATTATAAGCgaagaaatgtttttcttttcttctttctgac caaacttgctccacatacgtgtcaatccaaatgtgaaaaagcttgtgaat taaaattgatgagtaagcaaacgatatcactcttatttaaaaacaaaatc tttagctagaaagtgttttttttctgacaaaTACACTAATCGGCTTTTGT CCCATAAAATAATAAAACTGTTCCCCTATTTTCTTTCAGAATCCCTACGA TCAGTTGTGGTTGTTCTTCGGTACTGACAATGGTGACgttcattggttga aatttcATATGGCAAATAAAAGTCTCTTTCAAATGCCTTTCAAAAAGACC GACTCTTGTTGGAAAATACTTTTCAGTGTaagaattttaagattttttta caaGGTTTTTAGAGATGTCCTTATTTCATAGTTTCACTAAGTTTGGAGAA ATTTCTTTTActaattcttttgtttattgttAGTAATCTTTTGACATCGA GGGCAATTTATataaactagcaagtagctgtcgctaagaatgccccgcag agcttcctttcgaaatccctaagtaagcaaaataacgaattgtgtagatt ttaaattcgttttatcgataaaatttaagtcgGAGGAAGAAAGtttggtt tcaactttacttttgagataaCACGCGATAGACGGTCGCTCACgtctcaa aaagagaagttatcgctcacatgttatcacagtggaaacgccaaaaattc tgaaattgatttgattcttttaaaatagacactcataataaaaataaaca tgctcatctttttcgctaTACTTTGCTTAAttttaagaactaattacaga aaggcatattgcctttaatcaagagttattgatttgatccttataaagta gatgcttattgAAATCAGCGATTTTCTAAGTTTAGGAAAAGTAAAAGATT CAAAATCTTTGTCGGCCCGCTTAGTTCATTATTTTTACATTGAGTAGAAA TCTGTCATATGATTATTGAGTATTATCGTCCTATTTGTTCTCCAGATTCA TCAAAATATAGTTTGAAACAACCTTTTTCGCATTTTAGAAATCATCTATA ACTGTCCATATGGCGgacaaagtcaaatttttgcaaaatcccTTCATCAT AAACTATCTATGCGATTTCAACGCAATTTTCACCTTAGAAAATGAAGCAG GAcgaaattttatgtttgtggAATTTCTTTGAAAACGTTTAAATTTGTAC ATTTTACTCTGAGCcttaaattttggtcaaaatctgTCCTATTTTGCCTG CTcagtcaaaaattttcaaaataaatcctTATTTGTAATGCAATTTGATC ATTCTCGTATTCGCATCATTTTTAGGACTTAGCGAACCAATCAAAATACG TTTCGCATCAATTATTTTCACACATGCATTCTGATTGGGTGAGACGTTTA CAATATGTTCCACAAGGTGATCTATTGTTCTCATGTTCCAGTAATGGCCA TGATTCATTGGTTTATCGTTCTTTGGATGAAACCAAACGCAAAGTGTACG TCTTTAAAGTCACAAAGGTATCGTACTTTTGTATCTAACAATTCATACTT TAGATTTGAAAGGCGCTCTCGCCACGTGGCTGATTCGCTCGCCACAACTT CAACCTTCCGGTcaggttatctgatattccgatgatggattggcggccgc ccacgttaaaactctaaaggagcgggccaatttcccatcggaaaTGATTG ATAGTTGGCCTAGTTTGAGTAAAGTTGGCCTTTGATGTGCAAGACCCCCA GTAGGGTTCAACTACTCTTACttaaatattttggttggacccgccaatct tcgaaaacgagggctggatTACCAGAACTCCTGCTGTAAAATCCTTcacg cggtcttgcaaaattcgcAATAATCTAAACCTTTCAGATgctgaaaattt tcccgaccctCTGAGCTTTAGCTTGTTgtatgaaaatttctgcatctggg tcCCAGATAACCGGTCACGAGGCGAGTGCGCTACCAATCGACCACACCCT CTTATATTATCCTttaatttcttgtttttgaaTATGTTTTCCCTTTTTTT GATTAACCATCATCATTCACGTTTCAAAAGACACACATGTATAGATACTT GAATGGCTTGGTGGGTGCTCATTTTAAGGTCGATATTTTTCGTTGTTTAT CTGTAATAAGATTACCATGATTTTATGTGCGCGAATTCGCGTTCGTTCAT AACTTTAAAACAGATGTTTTCTGACTCACAGGGAAATCAGATTAGGTGCA TTTTGACTATAAGGTACATTTCAAATAATTCATTTGAATAATACAACCAA AGGGCAAAGTGCAAGAAAGCCCTACTGTACAGTATTGCAAAAGATGAAAC CCTGCCTTAGGTATTTTGAACTATACTAGTTTCAACCATATaattataaa gcccgaaggactagatgtCTTGATtcagctgaaaagtgtgccgtggttag gtaggaaatcctacccctaggtcacgtgacattgcaataaaatttcagcg cttgaccaatcagaagcttcgtgggttttcgaaaacaatagcaacaatac tATTtctgatattcaattttttttgcctgcgatggcttaaagcacgacat atAGCCCTTCGGGATTTTTAAACATGATTAGGCAAGTGGGTAAAACGATA TGGAACTTTCGTCAGGAGATGGCCTGACATGGTTCGTGTGGCAATCTCGT TATTAAGAACtcatttttttatgacttaTGTTTTATACGCCTTGTCTTAA TAGAATGGAGTCATTTATAATTCATGTAATTCTACTAGGTCAGCGTGTTT CAAACACACTGTTGGCGATCGCTTATTTCCGACAAAATCATCGGAGAAAG AACCTTATGTAGTGTTCactaagaaaataattttcactttGTCCATTTTT TCGTTTATTCGTAGAAGGGCAAGGTTGATGGCTTATTACCTTACACCCTG CGATGCGGATCTGTCTCTGATAAACTATGGCAAGATTAGAGCATCTAGAC GAAATTATAAAGTCGAGTAAAATGGTCGAGTGACCCTTACctctttaaat tttcttattgTTGTCTTATTACAAAGTCCATGCAATTNAGGTAAGCGAGT CAAACATTTAgtttcgatttcaaaaacgagATTTGACTTGTATATCTACA CTGTTAAAATCGCCCTCAGGCGATCGATAATTGCTACGGGATATACCCTA TAAACTAAATATTTAATATGCTACCACACCCCCACCCCATACCATTCGTA TCTAGAATGCAAGactgttgttttgatttaataaaTTCACACATTGATAA CGATAACAGTAAGAAAATAATCTACGTTGCATAACTTCATCAGCGGATGA TTCCCATTTACTGGTGATAgacaacccagctggcacacaacgttgtttca acgtttttctaatgtccataacgtccatataacgttagatgaacgttgaa acaacgttgtgtgccagctgggaaactCCTTAACATTGCAACAAAGCTAT TTGAAATTCCGTGAAAATTATTCTCTAAAGTTTCGGGTGATTCAAACAGG GATTTCATTTGtgtatcttataaaaaacatgccGATGTTGTCCCTTTCCC atactttatataaaaagtgATATGCACAATCAGTTTCTTGAAAACTATGA GCTCAGATTTCAGAATTTCGCTTTTTAAACGAGGGAGACAATTTAAAACT TGCATCATTCAACGAAAACGGCAAATAAGTTTTCAAGAGAAACTGTTGTT AGAAGCTGAGCTGTATAACCAAGTTGAACTATGCCTCAAAGAAGGACTGC TGTCTTCCCCGTAAACGGTCAAGGGACTCTAGTCTATACCGTTCGTAAAA AGAGTCAATTCACCATCTACATAACACCTGACAAACAAAAGGTACCAAAA AGCTTGGATTTTGATAGTGAATTCTCAGAGTTTGAAGAGGAGCAAAGTTT TGATACGGAGAACTACATCTCGTTGACTGTTGGTGAGAATTTTGCACGTT TCAAACTGAAGATGCATAAAGATGATGAAGAGAGAGTGTTGAAAGAAGAA TATGGGAAAAATATTGGAATTGAACCTAAAGAACTGGTAAGCTGTACCAA TCACATCGTTTTTTCTCGTACTTTTATTAACTTTTAACTAATTCAATTTG TAATTCCGTTGCGAAATATTCTTTTAAATTACAAGTCTGTATGTAACATA GTTTTTGGATACCCTACTTTCTAAGATTCCAGCAACGAACATCCCTTTCG AttgtaaaattttcatttttatcaaccCTGATGGACCTTTTTGGACCTCT CCAAGGAGACCTAAAAGTAGCCATTATAGAGTACAAACTTTACGATTTGT CTAAGCCATATAAGTACACCTGCCAATAATGCTGGGTCATTCATTCTGAC TGACTTTTAAAATTACTGATTCAGGGCTGACTCTTTTTCCCAGAGCTATT ATGTTGGATCAAATTTATACTTCAgttacttttttttctttcttacaagT ATTGCTTAAAAGCAATCGATTTTCTTTACAATCAGATCTCATTTTTGGTT GCAGGTCACTTATTGGTTTAGTTACGACCGCGATGCACTGACCTTGAAAT ACGGCAAAGGGCACGTTATGACTCAAACAACACTGTTAGAATTCCCTTTC TTGGAAGGCAAATCGAAAGGCGAAGAAGAACACATCCGAAAGAAGTACAA TATTTTCTTCAACGCAGGTTAGATTTCGAACTCACCAATAATATTATCAA TCAACTTTTGTCTACTTtgttaaaaagtttattttaagTCTGTCCGTCTG TCTACCTGTATGTCTGTATGCCCGAGAAAacctttgactttttttttaca aatcgACACTGAGTTCGAAttattgattttgtattttaatttttcttgaa GAGAGAAAATACGTGGTTACCGAATCAGAGAAAATAATGGAGGACGTGAC AGGAGGACTGGTCAAAATCGAACAGACGTTACAATTCTATTCCAACCCTC TCGTGACTAATTTCTCACCTATCGTTAAAGATAGTTCGAAAGTCACTTTG CTTGATCTTGATCGAGATCAATTCATGTTTTCCAGTAGTCTACCACCTGC CTGTAAAGAACTCTACGATAATATTAAAGGTATATCTAGTTGACTTCCAA TGTCTAATTTTTTGTGGTCTTTAGTTTCCTAATAAATAATACCATACCAG AACCCATAGTATAATTAATGTATATCGTGCTGCTCATGCTCTGTCTTTAT CAAACTGCAATCACCGCATGTCAAATCTTGTTGTCGAATATGTCGTTTGC TCTTCTCTCGTTTTAAAGGCCagagtaagtaagtaagtctaaGACCGCAG TCAGAAGTCTGAAGGCTTCTTTCGACAGCTATTACCCAAAGGTAAAAAGG GTGGGCGCCAATTTTTACTCCCTGGACTGCTGCACTtatccttgatcctt ctcttaattgctgagcatcaaacaaagaagcatcaagtaccattttggga atctttggtattaCCCGCTTGGGGTGGAACCCACAACCtagcgaaccgta gccggaagctctaccactgcactacggtcgctgaaGGCCATAGgtataaa tactttttggaaattaGAAATCATTGTCTTCTGCAGGTCTCCAACTGGAG TTTCCAGAAGATCCTATTACGAAACTTTCAGACGCCATACGGTACAGCAT CAACACACCTGGAATGACTTTAtacgaaaagttgaaagaaaaggaagaac AGTTTGCTTACCTACGTGTAACACTCGGTCCTGACCGCCGNAGCCGGaag ctctaccactgcactacggtcgctgaaGGCCATAGgtataaatacttttt ggaaatttgaaatcatTATCGTCTACCGCGCCTGGTATTCCCTATGTTCT AGAGATCTGGCCTTCAGGTAAGGAGATGGTTCAGTGCAGCTCGCTTTGGC AAGTTAACCGTAGTGGTAGTAACATGTTTTCAATATTTAAGAGGGAGATC ATGAATCGCATTACTCGTTGATGTGTCTTGATGTATACCGGATGGTCCAA AGAAAGTTTccataaattcaaaatttatgattttcatCACAAAGTGTTAG AACAACTATCCACCGCACAAACAGATAGGGTTGATTCTACCAGCGTCGAT GAAtatcaatttctgaaaattttccgATAGAGTGACTTCAGACATCGGTG GTCTCTCGCCCCTGGGAAACTATAACTATACTATAAAAGTAACTTAATTC NACTTTTTCAGATTATACGCTCAtatgttttcttcttttatattaCTAAC TGCGAAATAAATTAGCATGGTCAGGGGATTGTCCAGGGTTGATGAATCTA TATTTGCTTTCTTTCTCAGGAAAAGGAAGCCCTATCCATAATCATGGAGG AGCATGCGCTATCATTAAAGTGCTATTTGGTAGAATCACTTGCAACATCT ACAACAAGATCACACAGCCACCAGAACAAACAGAAATGCAACCTTTGACC AGATTTGATCTCAATGAAGAGCAAATGACCTGGATAGGCCCCAACTGGTA TCAAACGCATCGCTTACACAATAACACTGATGATTTCTGCGCAACCATAC AATGCTATCGATATGACTTCAATGATGCAATTCGCTGCCCAAATTTCCAT TATGTGGGTTTTGTAGAAGGCAAAGAAAAATATGAGTTGGAAGAATTCTA TCCAGATAGCGATTTCACGTTCGTTAATTTGAGACGAACTGTTCTTGACG AGTATCAAAAATTCTTGGAAGGCTGAGTagtgattttgattttatttttt ttctgtaaaagtgttgtttttaatcaaattttatttaGCCCTCTTAGCCG AGGGTAATCTAAAAGATATTTTAGAGCTTCTACagtttaaccctattttt atcagtgGGGGTGTTTTCCATCAGCCTGGCATTTATTTGCTAATAGCTTT GTATTTGTCTGATACTTTCGTACACAAGTCGTTTCTTTTGTCAGTAATGA GTTGTGGTAGCGAACCCCAAATGAACTTTCTGGTGCGAACCCTGAAACAA GATTTTGACAAGATAGTCTACCTGCAGGCTTTTATTGGCACGGCCAGTAA AAGAGTCGCGGTATTTCAGCACGGTAAAATAAAAAGACGCAATTGTTAAA GAGTTAACGACTTAAAAGTATCAAAGAGTTGGACAATAAAAGGCTAtttc atatttaaaaaaaaatcaaatttgtttaaTACCGATTTAGTTGTATGAAA AGAGATTCTCGAAAAACATTATCAGTGATTCGACAAAACATACTTTCACC GAAGTTTCTTTTAAGATAATCCTATAGAGTCTGTGTAAAACATGATAAGG CAAGTGGGTAAAACGATATGAACCTTTTGTCGGGAGATGATGATTCGTAT GACAATCTCGTAATTAGGAACTTATAGTATTTTTATAGACTTAAAAAAGC TTTGTTAGTTCTATGTTGTTTTAATGATCTTTGATGTTTAGTAAattcaa acaaacaaacgaAAATACTAGTAAGGAAATAATTCTCGTTCCAACACaat cttacacgtttttttataagaacaaactatataagaacataaggcttcga tgaccaaaatgttaagaataagttaagaacattttaaggcttcgcggact caaAAACAGCCAATtacttaggaaaatggacaaaaatacataaaaattgg gggaaaataagaacatgttaaggacattttgaaactcaaaaagttaagaa catctgaaggcttcaaaaaatttggatgttcttataaaaaaacgtgtatc tgtttgaaagaaaattagtttaCTGGTAATAGACAAGCTCCTCTTCTTTC CTAGAAAGGTGTTTTACATTCTGcgaaaaaaaaaacctaaaaGTTTTTGC TGACTCAAACAGTGATTTGAATCTGTGACTATCTTGTGACTATCAGCCTC TTTCCAATCCTTTATATAAAGCCGCCATAATGTGTACgaatcttcaaaac tactttactTGTAAACCGCGAGGGAGACAATTTAAAACGTGCATCATTCA ACGAAAACGGCAACTAAGTTTTCAAGAGAAACTGTTGTTAGAAGCTGAGC TGTTTAAACCAAGGTGAGCTATGCCTCGAAGAAGGACTGCTGTCTTTCCC GTAAACGGTCAAGGGACTCTAGTCTATACCGTTCGTAAGAAGAGTCAATT CACCATCTACATAACACCTGACAAACAAAAGGTACCAAAAAGCTTAGATT TCGATAGTGAATTCTCAGAGTTTGAAGAGGAGCAAAGTTTTGATACGGAG AACTACATCTCGTTGACTGTTGGTGAGAATTTTGCACGTTTCAAACTGAA GATGCATAAAGATGGTGAAGAGAGAGTGTTGAAAGAAGAATATGGGAAGA ATATTGGAATTGAACCCAAAGAACTGGTAAGCTGTACTAATCACATCGTC TTATCTTTCGTCTAGACTTTCTCAGTCTGGTTACGTTACGTAGTTGTACT TCTATTGTTTTTACAGCTATATATCCTGTCCTATACGTAGCGTTCTTAAA GCTCGTGATTTTTCTTTAACGTTGGAATTTGTTTTTGGTTTTAGGTCAGT TATTGGTTCAGTTATGACCGCGATGCACTGACCTTGAAATACGGCAAAGG GCACGTTATGACTCAAACAACACTATTAGAGTTCCCTTTCTTGGAAGGCA AATCGAAAGGCGAAGAAGAGCACATTCGAAAGAAGTACAATATTTTCTTC AATGCAGGTTAGACTTTGAAGTCGCTAATATTCTCAATcgacttttgttt tttttccctTGGTTATCAACTTCAACTAAGTTTGGGTATaaatctgtctg tctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtc tgtctgtcttaCAATATTGTCACCGGATTTGTCGTTTTATTGGATTTCTC TCATATAATGTGTATGTCGGATGGAAATGGTTATTTAGGTGTGTGACATT GGGTTGATGGATGTTTACTAATTGGCAGTTTTTACACTAGGCTTGGATAG TGTTagttttttcttttggaaaggtgGGTTTTGGCTTTTATCAACAGTTC TGTATTGTTTTCTTCGTGTCTCTCTGTCTGTCTGTCCGTCCGAAGATTTA TGGGTTGACCAATTTTCTTACCATTTGAGGCTAGGTTCGAATTattaatt ttatatttatttttctagaAGAGAAAAAATACGTGGTTGCCGAATCGGAG AAAATGGTGGAGGACGTGACAGGAGGACTGGTCAAAATCGAACAGACGTT ACAATTCTATCCCAACCCTCTCGTGACTAATTTCTCACCTATCGTTAAAG ATAGCTCGAAAGTCACTTTGTTCGATCTTGATCGAGATCAATTCATGTTT TCAAGTAGCCTACCACCTGCCTGTAAAGAACTCTACGATAATATCAAAGG TACGTCTAGTTAATTTCATAACAGATCATCTATTCTGCTCCTAAAGGGAT TTGGCAAATGTGCCGATCTAACTTGGTTGTCTGTCAAAACAATTAAAACT ACGTTGCTTTTTGGTTTTAATGATTATAAGATTGACATATGATTTTGGTG TGATTGCTTTGCTTTAGCCAATAACTGCGCACAAAATCTCATTCCGCAAA CATGAGCAAATTATTTTATGGAACCATGCCCTTTAGAGTGAATACTTGCC ATGCCATGCGTTGAGTAGTAGAATCTGCTCAGAGACTAATGTCTAGTTGA CCTCTAATTTCTAACGTATTTTGATGGTCTAAAATAGACGTTACTGCTTA GAAAAATAGCCTTGACGTTTTAAATATAGGCAAGTTATTCATCAGTAGTC ATTATCATCTGCNGTTGATCTCtaatttctaatatttttttggtTCATGG TCTAGAATAGACGTTACTACTTAAAAAATCATTATCGTCTACAGGTCTTC AACTGGAGTTTCCAGAAGATCCTATTACGAAACTTTCAGACGCCATACGG TACAGCATCAACACACCTGGAATGACTTTAtatgaaaagttgaaagaaaa ggaagaacAGTTTGCTTACCTACGTGTAACACTTGGGCCTGACCGCCGTA CCGCACCTGGTATTCCCTATGTTCTAGAGATCTGGCCTTCAGGTAAGGAG ATTTGATTATGTCCGGCATTGACTAGTTTACTGTagtattaccttaaggg aattaattttcgcgggacttattttcACGACTAACTTCGACTgtaaattt tcgcgaggatttaatttcgcgaattgacgaattttttcagattttcagat ttttccttAGTTTGATTACGAGATTTTGTGTGTTTAGTAGAGTCTTATAT CTTCATAactgaataaaaatttattcgaattacagagacatTCGAGAGTC ATTTAAGAGAGTTTCCATTAGATCAAAAAACTTAGAATTTTTAgcgtaaa aaaattaattttcgagaggatcaaattttgcgaatttagCGAGAGAtgag agtttgaaaattttcgcgagagattatatttcgcgaaaaagttgaaattc gcgaaaattcgcgaaatataatccccgcgaaaatttattcccttaaggta ccatgtttgtaatttttgatagaAAGATCGGGGACCGCCATAGAGCTTGG TGTATGTGGTTTATACTATGATTTTCATTACATGGTATAATTATTTTGAT GTATCCCTCTAACAACCCTAACTCCACAATGGGATTTGGTTTAGGCCTAC CAGGGTCCAATGTCTGTCTTTGTGAGCACGTTAAATGTACTATGTACCAG TGTATCTCTCGCAGTACCTCTAcggcaataaattttgaaattagccgtag atatcgggtctgtaTTTAGACTAATGTTAACGCAATTACACCAGACATTA CAAGTCAATTCTGCCATGCACTTTTTCAAATTATACGCTCAtatgttttc ttcttttatattaCTAATTGCGAAATTAGCATGATCAGGGAATTGTCCAG GGTTGATGAATCTATATTTTCTTTCTCAGGAAAAGGAAGCCCTATCCATA ATCATGGAGGAGCATGTGCAATAATTAAAGTGCTATTTGGTAGAATCACT TGCAACATCTACAACAAGATCACACAGCCACCGGAACAAACAGAAATGCA ACCTTTGACCAGATTTGATCTCAATGAAGAGCAAATGACCTGGATAGGCC CCAACTGGTATCAAACGCATCGCTTACACAACAACACTGATGATTTCTGC GCAACCATACAATGCTATCGATATGACTTCAATGATGCAATTCACTGGCC CAATTTCGATTATGTGGGTTTTGTAGAAGACAAAGAAAAATACGAGTTGG AAGAATTCTATCCAGATAGCGATTTCACGTTCGTTAATTTGAGACGAACT GTTCTTGACGAGtttcaaaaattcttagaaGGATGAGTTATGATTTTAAC TTTCCTGCAAAGATTGCAGTGCTTTcaagtaaataaatattttgttagCG TTTTTTTTTCACAGTAAACAGTAAACCATGTTACATTTTAAAACGTTATA CTGTTGAACCCCCATGTAATTTGTATTTAATAAATTGAAAGACCTATGTG TGAATCGAAAAAAAACTTGATAATTTCacaattaaaaagattttctcaca tttttttgccaaattttcgtTCAAAAACATTACTTCTTTAAAGCGCCGTT TTACAAACCTAGAAACCCTCCCCCATTAAAAAAGCGACCCCATTTCCGGC CTTctattaggcctttgaaatcggacctttacagtgcagagaaaatttag ccaaatttgagtaaattaggGCGAAAAATGGAACCTTACGGTGAATATTC TTGAAAATGTCTGTCcattttaagggctctgaccatagtcggaaaattga ttttagtatttgaacatNtcctcgcaaaagtcttcattttcttcttcatc aaattttttcattgcaatttttgaattttcagattcaggaatagtttgtc taacagaaaatgtatgacatgccatagttttgttggttacatcagtcaga aaatacactatggtcagagcccttaaggcaAAATGGTGagattttccaaa acttttcctGAAAACGCcgtttttatcactttttatacccttagagtgcg ccttttattttcgcttatgtcgacccttacagtgcacttatGGAAGCATC AGAAACAGAAACGCATCCTTAGGGGCTGCACCTACGTTAGGTCGCTTACC TTAAGTCCCCACCGGGTAAACCGCCTCTTATCGGACTAACCTTAATATTG AGATCTGGAATTAGCCCTGGAAATGCCCGAATTACATAcactgttttttt ataagaaccagaagATTTTTGCTGAGCCTTGgccgttctttttttttttg gcactttgagcctaaaattgttcttattctgttctaTGTTTATAGGAtga aaaaaggtatttttaggctttgtacccaatttttactactttgacccctg ttgcttgaaattgagtattcccaggctcagcattgttcttaaattgtttt tactttttggcatttttgagcctcaatgTTCTTTTAATAAACTGATAGGC CAGGTAAATTTTGAGGTGAAAAGTTTCTTATGGTGGTTTTGGATTACCAA TAGGCTATATTTTCAGGTATATGATGGCAAATAGTCTGAGCAGGCCGGTA CCTGAAATGGTATTCCTTCAAAGTAAGAgtgttttttgtgaaaatacTAA TTTGTAAGGGTTTTTCCTTGCGAGTAAAAACGCAATATATTAAAACACAA Tattgttggacctacctggaggtcctataaattagcccgcgttcgttcgt tcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttc gttcgttcgttcgttcgttcgttcgttcgttcgtttgtctgttaccagct tttctctcgagattggctcattagttttttctgattttattgCAAATAGT AATGCCCAAAGTGTTATACGGACCTCGATtttcgagagaaaaaaaatttc cgaaaatgtcggagatatgccggaaaaaaacgatcttttggcattttctc gagattttctcattagatCTTTTGCACAAacatgcgtattagcaatgtcc AATGTGGTCGAGTTGGATTaatgagaaaactttttttccggCCAGAAATG CTGGATAtcaccgtttttgcagattttcattggacttttacctataatat ttctttgtttttcatacaaaaacattattgatagcaatgcccaccataaA ACATGATTCaatttgtcaataaaactgaattttgaagccggaactttttg aaaatcgcTGGAAgagccgagaatcgccggaaaaacggtttcTCTCGAAT TTCTCctgctgtactttatattttacaaTTATGCAAAATcgtaataccta aaatgtgacggagcctgattttttgaagaaaaagaatttccgaccaaaaa tgccggaaatataccggaaaaccgttttttggcattttctggAGATTTCA TAAttagtttttttgaatttttgcacaaagatgtaaTTTAGCAATGAAAG TAAATGTTCCATCTATGTCTGTTGAGTATGGTCGTCTAAATGGTTGATAT GATGGTTAGGTTTTTGTAGAAAGATATTACTTGCGTCTTATGTTCCAAAA TAGATTTTTCTTACTTTATTTAGATATAATATGCCTAAGTCCGATTTTCG AGGAAAATTTctttctggccgaaaatgacggaaatatgccggaaattgtt tccgtttttgcagattctCATTGGGTTTTTTTGTTTAATGATCTTTTCCA TTATCTACAGTCgactttccataactcgaaccaaCTCAATTCAATTATCT CCATTAACTCGAAAGATTCTCAGGCTATTCTGCCTCTCTATAACTCAAAT TTCCGTAACAAGTAAGCGAAAGTTTACTgttcaatcaattttttcttcGG CTAACGATAGAGAATAGAGAATATCGTATACAACgtataaaaaattgata tcAGAAGCTTCTCATGAGCTGAGGGCTCGGGATCGCGAGCTtagattgaa agatttttttggtgCTTTTCGGCTttgctttttgagttttcagctTTTTG TTATAGAAGCGTAACCGATATTTCCAACACCAGGTGTGTATCCCTCGCCT TCCGGTTATATCTCTATGATACTTAGCCTCTTTTATTCTCTCCCACCACA GGGCATTGAATGTTTTGCATACAACAAAGAACTAGCCTTGATAGCAACTG GAGGTGTTGATCACGTTCTCAGGCTATGGGACCCTTACGTCACATCTAAA CCAATGGCCATCTTGAAAACACATCAAACCTCGATCATTGACGTCATGAT TTATGAGCCGTTACAACAAGTTGTCTCTTATTCGAAAGATGGGGTAAGTT GTCGTGGTGTTCTAAATTCagtttagaacgccatggtagGTTGAAGTTGT GGAAAGATTGGTGCAGTACCttgtggattaatttttgcatgGACTTTTTT TCGTGAATTGAGAAATCTACAAAAGTTCACAAATCGTCCTCTTTTTCACC tgaatttctatcattttccTAGGGTTTTCGGCCAACatattgattttaat tttttgcgaGGACTATTCGagaaaagggctaaaatttgagaaaatcgtTT TTGGGTTACAGAGAAATTGGAATGATAGAAATCATTTTACGAAGGTTTCT CTTCAATGGGATCTGGAAATTAATTTGAATTATATAAAAATTCGAATAAG CGAACCTAATAGCAAGGTTTTATGTGAAAGATACTGCTGATTAGGGGTTA AGGTATAAACCCCCCGGTGAGCGACggaaaatcatgattttcaaaaactg ttgGGGTCAAAGCCTTAACCCTTTCTCTATCGAAAACTGCCATTTTTGGC TCTTTGGAAATTCCCCAAATCACCACAAGTGGCTATTACGCTGAACATAC CTACATGCTAGCAAGCGGTCCTTATGACTTTAGTCCATGTGATTTTTAGA CTTCCAAGGACTTGTGAAACTCAGCACACTGGTCGTGGGTGCACCAGGGA ACTTGGAAATGTCATTTATTTGACAAAACCTtctcaaatttggtcaaatt gacAGTCTCTTTGAGaaatttgaagagaaaaaaTCTTGAAACCTCGTTTT CTCGAGGTTttcctagactggagtcgtttataatgcgtgtaatactaata ataccaatactaataataataataatacgggatttagtttgtataaacga ctggaagaatccggtgttccagccttatagataccccggctagctacgca gaaacttgcgtagcgagaaagtaatttatcaagcaacaacaaactctcaa aacgaaatcaactcaaatgaaaaactttcaatatacaaatccacacatat tttttttctcaagaattattttgagcaggaaaaaattataattgcaatat tgacacttttcttttgtttggagttagtgcacaaaggNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNagtgcacaaaggtttctagac gactaaaattgttccattcattactttttgctttatttctactatgtata aattagtcgtctagcttgctagactaaggTTTTCCCCACTTTTCGATCTC GTGGCAAAGATTGACGCTGACCCAAGTGCCCAAACAACACCAAATTTGAA GGTGTCATTCTACTCTAGATTGTCCACAAAATGAGTGGAAGGGATTTTGG ATTGACTTTTATGGTGGCCCATACGGGTTGTCTAAAATTCTTGTTTTCTG ACgaaattttaacatttagacGAAAAATCGAATTACAGGGTACGGAAGGA CTTTATTCAAAAACTGCTCCGCTTATTCCATAGAGACACTCTTTAAGGAA TCACATGCACAATTTCACCTTGAAAAACTTACTTCTCTTTTCTGAATCTT TGCCAGGGTGAACCGCTTAAATCTCAGAAACCGCTGTCTTTGTGGCCCAC CATaatgagaaattttcaaaaaaagttttaggCTAAGGACTTCGAAActa aataaaaattgtttttgaaacatttgtacttcttaaaataattttctcgg GGGTTTAGGCCTTAATGCTTGCAATCACTAACTCGTTTTTTGGATGAAAG GAATGAATTCTGTCcagcatttatttttctaaaatatttcaaatattttg attgatttaGCCCCTCCCCTGACTCGTAGATACTGTTTGCcggtttttca aaaatggtcggtTTTTGAGAGATCACTTTGTAGCCCCTTGCAACTTACAG GGTATTTTTTTCTAAGACATAATTTTTATAATGAGCAAACAATATACAAA CTTATATCGAtgtaaaaatacataaaaatgtCCTTCTTGCGTTTCTCTGC ACAATTAAGAGTGCTCTTGTTACATAAAGATTAAAAAACGGTGCATTTCT TCTCAATACTTTAGGTTTCTTGCTTAAgtattcatcagttgattagaaaa atatcctccacttgaaaatattttcattttgaaggttATTATGACTTGGG ACATCAAAGACCAATCACCCCTCCAGCATTTAAGTATAAAGTTCCCCTTC ACCGGTACTGTATTGGAACACGGCGGCTTCCCGCTCTGTCTGACGTCTCA TGGATCACTCTTTGTGGCCGCAGAAGACTGTATCGCTGAATTGAAACTGA CCACGGCTGGTGCACATCGACAGAACGCATCTCATAAAGGGTGCGTGGTA GCCGTGTACCATATTCCACACAAAAATCAGGTAATTATGTGATTAGGTAT TATTCCGTTTCCGATTTCGGCAGCTTCAGAATCTCAAATTTTATCCGATC AAAAATTTTTCCGACCATCTTACGATATTTCGACCATAAAAATGATATTT CGACCATAAAAATGATATTCCCCGACCATTACGCGAGGATATTTCCGACC AACAAAGATATTTCCGTCTCtctaaatggaaaaaaaatacgcATCGGCAT CGATCAAACTGACagtaaaaaagaaaatggaaaGTGCTCATGTCGGCAAA TGCCAACATTGACATGGAAAGGGTTTTCTAATTTAAAGATAATATCTTTA TGACGACAAAGTTTAATTAACAgaagaattttcttttcaaacttgTGCCT GCGTGGCGTGCTTGCATTAAAATGCtctgtaagcaaatggtaggagatac gtTGAACTATGTTCTATGAATCACTATTTATCCTTCTTTTAGATCATCTC AGCCAGTGAATTTGGTGATATTTGTACATGGAGCTTAGATAGCGGTCGAA AATCTTCCACCATACAAACAAACCAGAAATCGAAAGAGGTTCTGGCGTTT ACGATCGATAAAAATGCTGAATTTGCTGTAACTGGTCACATTGACGGTAG TGGGCAGGTTTGTATTCGTTTATCTTTTATCGGTCAAAGTACACTAAAAT CCATCATATTCATGCTATGCACCTTCCGCGGAAGGACCCAACAACTGATT GGTtacaagtgacgtattgactgattttacgtcacttacaaccaatcagc tgttgggtccgtggaagacatcgcaattgtgcatatcatgaattcgcTCT AACTTGATAAAAGGAAATACATCGACTTTACTTTGATGATTTAATTTGat gatttaattttgatttattatgCCTTAGAGAATCTCGGTAGTCTCTCGTA ACTCGAATGTCTAGGAGGGCATCAATCGCTCGAAAAGTGAAGAACTCGAG CTATATTAGAGCTTTGCGCGTGAGACAACTGAGACTAAATAAATAAGCTC CAAGAAAGCGAAAAATAGCAGTAACCATTTTCAGTGCCCATTTTAAGAGG CTTTTCAAGAAAATAACCGTATACCctctgttgaggaggtccatttccgt tccaagggggtaaggtttgaaatgtgGCGTAATTCCATAGGGGTATAGCT TTTTAAGTcatactaaaattcagaattccagaggggtttaaaactgagat tgcctggaattccaggggatTACAGCATTTCTAGCCACAAAgagatggac ctcctcaacagggggtatacggtttttttctggaaaagcttaATGTGTTT TGAATATAACAAATACCTTGTTCCATCAGCTTTGGAATTTGATATCTGGC AAGCAAGAGAAAACATTAGCAGCATATTCTGATGAAGAAATTACCAATTG TATCGCTCTCCCAAACGCTTCAATAATCTTCATGTTGGGATGGAGCAAAA AAATTCTGATGTACAAGAACACTAACCAGTATAAAAAGGTACCCTatata gaggtttttcatgtttaagttacgtaacttccgccattatggaagcaaac gttcgaatctgtagaagCGCTCcattcactgacctttatataccctggac aaagcttctcaatcccagccaagcaaaatctttgatcggagttttttgaa aattggtaccctaatgtcggcactactcgNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN cctaatgtcggcactactcgatagcggtgtaaatgcatcgagagagctag gtctactttccctcaaattcttttgatgatgtagcggcgtaagacgttaa tttttagcattgcaatggcttctccttgggtaccaattctaaaaaaactc caatcaaagatggcagatattgcttggtccattctaaaaaaactccaatc aaagatggcagatattgcttggtccagggttatataaaggtcagtggttc cATTACACAAATCGAAAGTtcgcttccataatggcggaagttaCATCACa tgaaaaacctttttaaaattCTTGTCGAGGAAAATTTTAGGGTTTTAATT AGTCgggaaaaaaatttgacgttgAAAATTTCGACACATAGAGACGTTAG CGTATTTATGTATGtctgtttttctgcgacggagacggtaagtttctaat ttgtctacatcctgatcaaatgaggacgacggtaaattaGCACTCTTACC TTCCTCGATTTTGCAGGTCAAAACTGCGTGAGTTATTCCAAATCGGTTCA TTCACTTCGCCGTCCACAAAGtgaaaatacataaactcgcttcgTTTCCA TAATTATGGAAGTTACATagcatgaaaaacttttataaaattattgTCGA GGAAAAATTTAGGGTTTTAattagtcggggaaaaattcgacGGTGAAAAT TttgtctattgttatatttcCTGGCTTTTCATTTCTCAAAACCTCAGTTT TCCCCGTAAAACTTCACTGAATTAGTCATGAAACCTTTTGAAGTGATatt attttcgttttttagTTAACAACTCTTCGACCCGATACTGGTTGGCTTTC AATCAGCTCACACAAGGTAAGTAAGACAAATCCTGATGGTCTCTATTATC ATGATATACAGTAATAACTTTTTGGCAAGcaaatacacaggttgcaaaat taagtctgaagacaaatcacacTTTTACTTGAgattttatgtgcttgtta catgacatttatttctgattggttcgaatttattgacacaaGTAATAAAT TAATTAGACCTGTTGTAATTAAAAGTTGTAAAGCAAGCAACATGGGAATA AAACCAcatgaactttttcgagtaatcgcatgttttgactgcaccgATAT GATTTTGCGATCCGTGTATTGAATAGCTTTATTCCTTTGTTTGTAGCGCG GTCTTTGCAGTAAGAAACCGGTAGAATGGGAACATTCTTTTTTGTGAATC AAGAATTTACATTGTTTATTTGTTATAATATTTTGTTTACAATGCTTGTG TATAAGTGCTACAAGGTGAACATGACAAAAAAGATAACTTCCTAATTAAA GAAAGATCGTTGTTGAACTTAAGTCCATTTACAATACGTATGCActgatt tgaatgttttgattttataacaaattatataccgttgaaaagatcaTTCA GAGTACTGTAACTTTTGAGAATATTGTAGTTCCAAGAAACGTcagaaaat gaagataaaaagtgaaaaagaaaatggaaaatttttgtcttttagTGCTA GAGACCTCATTCTTAATACTGAGGTACTTTTAAGTATCCTTATTTCAGTT ATATCGGTTATATTTATCACATAAAATTATTGTATGTACAGGTTCTACAA AGTGGGAAACAAAACATGCAAAAGCAGGGTTTTTCGACTGAAACGAGCAA CCTGCAACTTTCGATATAAGAGTTGCAGAGGCTTCTAGCACCATGAAAGG AGAAATAAGTCGTTCCTCTTTTCTGTATTTCATCTTAATCTCCAAAACCT CATTTTTTCAACGGTTTATAATTGTTTCTAATTGATACTGGTaagtttca taaaatttataCATAAAATGTTTAACTTgtcaaaaagtatttttaattgT TCAAACTTTCTGTTAAATTTTCCCCTGAAATATAATTCGTTTAGCTACGA GTTTAAGAGAACCTCGAATTTACATTATAAAATTGTTATAAAATATTAAA CTTACTTGGGTCATGAACATCATGAAAATTCTTACAAAGAGATTTTAATT TCCATACAGTGTATTACTGTCCACATTTTTGTTTGTAGTATGACATACTA CTAGACACATAATATTTGATCAATTTCTGCTGCTCATCATTCAACCGGTG GGTGATTTCCACGCCATGTTGTAATAACTTATCTAAAACCTTGATCGAAT CGTTATCTCTTTCCCTCATAGCCCGATCTCTAAATATGGCTAGTTTACTA AAGCTCTCACAAAATTGTTCTTTATTTATGTTAAAGAACTCTTCGCTGAT TATTCGATAGATGCAATTGATCAAGTGGTCTCGCTCGTTCTCGCCCTCTC GCAATTGTCGTTTTAGAATGTTGACGCTTTCTTCTATTTCTCGCTCAACT TTAAGAAAGTTTTCAGCCTCTTCTTTTTGCTTGGCTTGGTATCTCTTGGA CGCGTGATTATTTCTCTCTaaacgttttttctttttcaagtcaaCCATCG AATTACCATGTTTTAGTATATCTTTATATTTTCGTCTGGTGTTTCCTGAA TCATCTGATGAATTAGAATGTGATCTTGAAGCTCTTCTGAATTGAGTAAA AGTACCAACGTGCTCGGGCGAGGCCACAACACCTTTTGGGCCATTTTCAC CACGGTGGAAATCCGCGGCAATTGTTTTACATTGGTTAGATGTAATACAT TCTGTTTGGGTTTCCACGCTACACTTACCTGAACTCATTCTGCAAATATT TCCATCACCAGCAACATAACGATAAATTATATTGCCTTGGTTATTAACCT TAGTACTAGCCATTCGATTGCTTGATAGATTATTTGGATTTTCTTCTTCA CAAATAACCATTTGATGAATGTGAACCATTTCATCCCTACAAGGAGGTAG TTCAGCTCTGGATAGTAGATTAGAATCAACTTGACCATCCTTTGTTGGGA ATTGGAGACCTTGatcaaagttttttctttcgtCAGTTTCATCAATTTCA TCAATAACCAGCTGATCATCACTATCACAATCAGAATCAACTTCAACTTC ATCCAAATCATTGTCATTGTCAGTTCTTCCAACAATAGATAAAGCCATTT TCAAACAATTCAAACCGTTGAAatgattttccaattttataAGTTTACAA CGTTTGTTGTTTAGTATTTGAAACAAGTAATCTTCTGTTAAAATGGTGTG CCAAAAATGATAGTACTTCAAACACGTTTCAACATTTCAGTAGAAAAACT TCTCTCTCTTACTATACTCTAAGTACTCAGAAGCGACGTGCTGTCGTTAG GGCTTTTTCATTAGTATATGCCAacaataataaaatataaatgcactttt ttattagaacagtGATAATGTAAGAGTTAGAATGTATGATAGTTAATAGA ATCTTAAGCAGTGTTTATCTTAAAATACATCAAtatattttgtttctttt aaagctttttttatcattctacaACCATTTCAATTACTCCACGTTACTAT GtaataaaaaagctttttaaagaaaatgcaTAGATTCTTATAAAAGGAAT GAATAAATCTTTCACCATAGAAGATCATATGACAGATActatttaatctt tttaaatcACATGATAGAAATTGTTCTTCTGGGAATCCCCACTTATTACT TCATCTCAGATGGCTAAACGATTATACCCTACCCACGTCAAATACTAATA TTAACATAGAAATagagaaatagaaaaattatttgGTAGCTATCAAAGGA catctcctaccatttgctttcacagcattttcaaacaaaagaaagaactt tTTCCCCTTTCGACGTCGTGCGAGCAaaagtttcttttctttgttctGCT TTGTCAGTATAGAGGAATGCCTCCTTTTTTCATATATCATAAAAAGATta tctttaaccctttaacgactccttctatttatttttccgtGCCCAAGATA CCACGCCCTTTTGAGCTGActcttcttaaaatttcgaaCCATTTTTTGGA GttggttggtaaaataccgcGGATTTTTTAAGAGTCGTGCCAAAAAGACT GAATGgcgaaaaaaaatcagtaaaactCATTGTTAAAAGGGATTTCTATt aacatttttgattttcatatcaTTTGCACATCTTTTAGGCGAgaccaaaa aataaaattgatgttgTCAAtacatctttattttcattgctttacagact gaccaattctcaaaatttcggtggtagtttttccaaggtttttcaatttt tcattttaaccatgaatttgaccttttttgtgcctttttattttctaatt cccatttttgtcaagatgtagtattTTTTATGCCTTTTTAGGTGAACTTT TGGGTAGCTTGCCTGTAAAACAACACATTAAATTGGCCTAGCCTCATTCT GACATCAGTTTTTTTATCtgactgcaaaaaaaaaagtatacaactgaAAA AATTGATAGAGGAAATTACATCGAGAAAATGGTCAGGAAATCATTAAAAG ACTCGTATCAGCATGATTAACATTATATGACACACACGAAACATCTCTTC CTCGCTTGTTAAAGGCTCAGCCCCCCTNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNtcccccccccccccccctttcttaagggagatgacacctt ccgaaaaaattgaagaagagggggtcagaaattttcatgaaaaagaggGG GGACTATGTCATTTATTGTGGCACTTCTACAATTCAGCTGTTAAAAATTA CAGTTATATATCACAGCTCATCAAAATATTTCTACATCAAGTAGGGAAGA GTCCTTAAGCAAATCCACAAAAGGGACGAAAAATTACTGATGTCATGCCT CTAAAAAATGTCGATTTGATATGTCCGATATATTagcaagtaaaaaaaat ttggattttgcgTTTTGTTCTTAATAAAAAAGATTACTATCTATtgaatt tacacgtttttttaaagaacaattttataagaacacgaggctgaaaattg accaaattctaagaacaatctgagcctcagttTTCAGAAATTACTAACCA ATATAAAGTACTAATTCTAACTGGTTGTAAGAGATTTTAAACCCAATTTC AGTTTTAAGTAAAGAAGCTAAAGCGtaataagaacattctaagaactgAA GCTTTCAAGCTTGAAAATTGcgtgtattttattttttctgcaATCATAGG ACGATATCATATCAGCGGCATTTTGGGAACCACATTTTCTTGCCACGGGT ACATTCGATGGAGATATTTTCATTTGGCATATCGAGCATGAGCGTTTGTG GAGAAAAATTCAAATCGGCCGTGGACAACCTTTATTGTAAGTTTGGTGta gtcggggggggggggatattATTGAGTCTACTTAATTGGGGTTTTAACGT TAGTGATATTTAGAGAGATCCCAGAAAACGCTTGATATTGATAATGAGAG ATTGCTCAATTTCGTCTTTAGAAAAtattagaaaatttagaaatcatGAC TAATAGATTCGGTTCTGTGTTGAATAAGAATAATTTCCTGACAACGGGAG ATGTAAACTTTATTCATAAAACATAGCCAGTAACGTGGGGGATAAGGGGC AGTTTCATATAGCAGGGTTTTTGGGGTTTTTTAATGTTCATCCAAACACT GGCTGCTCCGTTTACTCTCTTTGGGTAGGTCTCCCGTtgagaaatttgaa taatttgCGGAGTTCTTTCACGGTGTCTTCTTAATCAGCTGGACTAACTC TCTAAGTACGTGTACTATTTTTCTAGTGATTGTTCTCATATATTGGTTTA AGAGCCCTGCCCTCAATGTTTACGTTTGAAAGCACaatgaattatgtttt tgttaTACTTCTAGTCAATCGTTGGTTAACCAGTACATTATGCCACCGCG GACCGCGCGCAGTGGTCGGAGAAGAGAGAAACAACATCAAGTACTCAGGT AACAATTCGaatattttgactttatttCACTCAAGCTTTATGAAACAAGA TCATGTTTTGCTTTCAAAATCAAATACTTTGAGAAGTGTCGAATGAAAAG AATGACTCAATTGAATCTCGTTTGCTCATTTGAAAGTCTCAACGAAATGT GAATAAATTTTGATAGCAATAATCAAGTAAAAAGACATTACTAATTTACC TATCGGTAAAACCCTAGTACAAGAAATTGAACATTCACTATTTCCCAGTT CTCTTAAAAAGAAATCAATCAGAAATTCTCAAAATACACACTCTGACAGT CTCTCGTGTTTTGTTAAtgttcatcatcatcatcattctACTCCCGGTTA CCGGTTACAGATTCCTTTTCAATGATTTCGTACATTGGGATAGATTATAC AGTGAAGtgaactcgaacctctattactcggatgtttccttaactcgacC AAGTTTGTTGATCACACCATAGTTAACAAAACCGTATAAGCCgcaagtct ctttaactcgaattttCCTCAATTCGAATAAATTTCAATTCCCTCTGCGT GTTGGAGTTATgaaaaaaagcttgtgaatcaaaattgatgagtaagcaaa cgatatcactgttatttaaaaacaaaacctttaagtgaaAAATCGTTCAT AGAATTTGGTAAGAGAGGAATTAACATCATGTATTTTATTTCATCTAATA TTCCCCTTCTTCAGGTCTCCGTACATTTTTTTGCGTCATTAAAATCTTCA CCAATCAGTATAATAGCATTCTTCTATAGCGGAAATCTGAGAAACTCAGG GGAAattcaaaaacagtttttttagaATCCCTCAAATCATGTGATTTATA TGggaaacacatttttttataagcatgtcCCTtagtcaggctcgtgtatg cttaagttctcaaagtaTCCCTTATGCTTattatgcttatgaatcatgct tatttttcaccccgagccaagtttttagtgaaatgaccgtaattttgtaa aaatgtgttctgattttgggagcagtggaatgtagcaaGCCGTAGaatgt atttttttacttgatccctaccaaacctttttaaacagacaaaaaatgac aactgaaaaatatttaagGCTGGCATATATGCTTATGCTATGCTTATGAA TTCTGCGAATCTGAGCCTATAAGcgctatgcttataaaaacatgtaagtg gcttcatttcctatCAAAGAGATTCGACTCCTGcccttttctttattaaa agagTATCTGATGAAGAACGCCCACCAACAAATCAACAACAAAAAGAGCA TGGAGAATACACCATGCCTGTAGATCTGTTGTTATATTTGGGACATCGAG ACCACGAGACTTATGCCTCGCTTATTGCAACAGAAGGTAATCGGGTCAAT TGGTGGAGTACAACTGCCATTGGAACACCCGTCGGTAAGAAAGGTTCTTG AACTGAGATAGACTGCTTTTTCATTCAAacataaaattgatttttactgC TCTTAACCTAATTTTTTTACCTGGGAGCAACTGGCCAGGATTTTACAACT TTCTACAAAGTTTTGTTTTCCCTTTACAACAGGGATAttttatacacctt ttcaaccgtagccgccaattactgcgcgggcatttttttatCCGTTCCAC CACCCTAAAATCTTCTCAGTCTTTTTTTGtgcctaaagacaatagaaaaa agtgttaaaaaaaagttggatcaagtttagggtggtaaatgaaataataa agcGCCTGACGACCGtgtgactacggtcgaaaaggtgtattctgcTGGAA AGAATCACTTTCTCTTTTCTAAGTTTAGTAGTATAAATTATTTACTTTAT ACTATATTATGTTTCGTATACTTTGTCGATCAAACTTAACAAATGATCTT GATTGTTCAGCCTCGTTTACAATCAGTGAAGATACAGAGAAAGTTATCAC AGCCATCACATCTGATCTTGACAACCGTTACGTCATTGTTGGCACGAATC AAGGTGAAGTATCGATCTGGAATATTGTAACGTATGGTGTTTATAGAAGA TTCGCTGATGTCGTTCGAGAGGTGTGTAGcatttaaaagcttttttctgg ctggttctTTCGGTGGGGAAAGATTACATTTTTCTTAAGATGAGAGCAGA ATGAGCTCTGTGCTCTTGACACTAAATATTACTTTTTTAGTAATTCTGAG TGTGACTACCATCAAAGAAGAATAGAGATAAAACAAACTGAGTTAAGCCG ACAACCACTGAAATAATAACTGCTCTTCCAGAATGCCTTTGACAATTGTG AATTAAATTGGACCCAAAAACCATACGTTAGACCAAAGAATGGCTTTAAA GCGTAATAATTATCTTTTGAGGTATTAAGTAAATAAACAGTGTTCATTGG TTAGAATAGCTCAGGGGTCATCTGGCACCCAGatacagaaattttcatcc taCACGCTAAAGCTGTGAAGgtcaggaaaattttcaacatctggatgGTT CAGATTACGGGATGttgcaagaccgcgtcaaggattttgcagcgggaggc ctAGTAACCAATTCcttgttttcggggattggcgcgTCCAACTGAAATAT TTTGAGCTATACGCGCAATGGTAGTTGAACTGGACTGgagatgcggcaca tcaaagacCGACTATCATCCCGCTCCGATGTGAAATTGGCCCGCCAGATA ACTCAGGAGTTACCTTCATTAGATTTATAGAtgctctttcatttttcttc atagGGGACTCCGTCTACTCCGAAAAGTACACCTCTTACCGAAACTTTCC GAGAGCGACCGCCTTGCGTGCACACGTGGAGCTGCCGAAGTATGGATATG ATCGTATCACTATGTTGCTTCAAGCGAGATAAGGAAATGGTTGCGGTTGG CCTAGAAACTGGATGCATTTCTTTATTCGCGTTGAGCGGTGATTACATTG GAATGTTCAGTCAGGTGATGTATTTAAGATTCCACTTTCCGCGCTAAGAT TCTCCTGACTTTTCCGGAATTCTTCCACTAGATTAGAAAGAGTTTTTATC TAAATGTACtaaaaatcttgtgtttacttacGAAACTACCTAACTTTCAC CCGGAGTCCTGGTCTTTTTGGCTAGAAAAGTAGCagtggaatcttagtgc ggGAAGTGGAATCTTATGTAAAACGACGGTACTTATGTTACCTCCACATT AGAAACCCCTATGTATTGGTTCCAATagagtaaaaattgaaaattcttta tattttctattctttttcaaaatctaaaatattgaCTCCCCATATCATTG GCTTAAAATCAGCATTGAAAATTTCagatgaaaatctcaattattTCTCA CAAAACTCTTCaaattaaaggcaaaaataattgtgattttttcaattgtt CTTTCTTTCTCAGATCGAACCATGGAACTTAACAGAAAGGTTGGATTACA TTAttcacccccttctcacagacctggtgggATTATTTTTCAgctagtgg gggtaaaaataacggactgagacacgatggggattgatattcccacaTTT TTTTTGGCTGGGGGTTTAAAATACCATTGTCTTCAAGCCAGAAaactcag tggggatggaaaaaaacaTGACGtcttgcagtgaggattggttcatttga tttttttcagtggggacaaaattggagtacaatttttttcactaGACGAT GTTTTGGGCAATTTTACCAGTATGAAGACCGAGCCCAGTGGGTttttgag aagggggtgtattattttcaaatactttatatatttaaattttacaAACC GAGCTGCTTCAAAATGGCTATTTAGTATTTTGAGAGGGGATTCTTGCAAT AAGGTTTATCCCTGAATccctagactagagtctacttcttttggatgaac tttgctttttgataattttttatgacgctgagtccagtgaagtagactag gagcatttggcgaggtcgccattttgaaaaaatatgtttaaaatccaaat aacaataaaactacttggagttgaaaaatataatcaaataCGAGAAACAA ACACGAtgaacagatttgcaatcccttattctcaaataaaaacattgctt catactgtttttaccttccaaaagcAACTAAAATCTGNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNGGACTGTTTTACAgcccgcctaagca aaagcatattaccatatactaccgggccacttaatcgcgccatccagtct ataaaaaaagctttaagtagACCCCGGGCTACTGAATCCCTGAATTCGGT TAGATAAATTGATAAATGGCTGACCATTTATCAATATAACACCCTAGTTA ATTATATTGGTAACTTTGGGTTAACTTTAACATATCTCAACTCATCTCTT TCAAGCCAATTACCCTCTTTGAAATCCATATCACTAGCACTTGAGCATTC AGAGATTAAGTCTCCCGCCTAAATTCTaaacaaaatattgataaacTTGA CGAGGTGATTGAAATTATGATTGAAATTGTGATTGAAATTTGCACATCTC TAGGtatatttgaaatttaaaccttaatttttcctagatttttgataata ttttgttcttgtgtacttattctttatttttctttcaatttgttTCAGCA GTGAGAGAATTCAAACTAAAAGTCCTAACATCGAAGAGCCTCAAAGAGAA CTTTGCACTGAGAaggacgaagaagaagaagaaaaagttgatttGAATAT TAAGAATGATGTCCATAATAACGAAGCTGAGAATCTTGTCGGTGAACCTG CTGATGTCCAACAGAGGTTTGTTTTCTAGTATCCAGCTAGCTTCTAGACA CCCCCAGCGGTACCCTTCATCGCATCATCGCGCCAAACTTTATatgtaat gggcttttccagaaaaatattgaatatgggtggtggaggatataacatgg ACAGTGTGACTTTTGACTCCCGGACAGCAGCAACCCCCTGGAaaagcatt agttgacccccttgacattcaaaattaccctcaaagagagcaaaaTTACC CATAAACAGAGCATCCTCACGCAAAAAGTTAACGGGTATTATagatatgt ttttgtttttatgggTTTGTTTatagtttgttatttttgtctCGATACGA TCAATGCAAGGTAGTAGCCCAAATCGGAATctcaatttccttatttttct tatttaccAGTCAATCTCTACCAGAGCTGGGTGTGTCCAATAGACCGCCC ATCCCTGCCAGTACTACTGGTAGCGTTGGTGGTAACACAAAAGACAACAC TATTTCGAATGatgttcaaaaaatgaagaaaactgaATATTATCAAACCA TATCTTCGATTAATGATGACATCGTACAACAAAAAGCGGCATGGGTATGA AACAATTGCTCGACTCTCTTTTTCCAATGTGATTTTCCATAAAATTGTTT TACCCAACATTCTGTAAATTCTAGGAAGGCCAAGACCCCACCCTTTTTTT GAAAGAGCCCATTGTGTCGTCTAGATGTTCTTTACTTCTCCTCTACAAAT TTCAAAAGGTCAATTATTCGTTTCACGAGTATAAGATGTCAAGATCTAtt gtatttttcttaatttcaaaGTCCTGACTTTTTTCCAAACTGTAATTCAG CATGATTTTTATGGGTCAGCAAGTTCAGATGCTAGCCATTAGACCCCGAT TTACTTATACATATGTTTGAAAGTAGAAAAACACGTGTTTAATTCTCTGC CAGCGATCATGGAATTCTGAGACAGTTTTTAGCTTGACCTGCCCTACGTG GACGCTTTGACGCCCTGACATTTACATTGTGCGTACGAAATACGTAAGAA atctgctttgtcagcaaaaCATTTTGACCCAAGTGTGTGTCTAAGTAAAA GCAATACTTTTCAAACACTTTTTTAACATCTTTTAAAGTCACTCCTTGGt gaaaaatacaattcaaactTCAAACGTCGCATGCAAGAACGTCTATCCCG ACGCCGCCATTTTAGTGACGTGACCGTTGCTAGTGGAGACAAGCCGTTGT TGCAACATAGCGGTGGCCTTGGTAACCTGTGTTCACCTTTTCAAGCCCTA TCAACAAAGGTAACGATATATCTTTTTCTTCGTTCAGCTCTGCTGTCTGG TTTTTGACTGTAAAACTTTTATTATCAATATCTAGTTTCTATCTAGGGCC TATTTGTTGCATCACTATTTTTGCTATATTTACTATAAGTGCactcattt taattttttctgtcgAGAACtttagcactttttgtaaatcaACTTGCAAA CTCTTATTAGCAAAAATGGTAAAAACCTCAACGTTCTGCAAGCAGAGCCA AATTAGGACAATTAAATTAGGATCCTGCATTGATATTATGACCCTAAATG TCTTAACAGTCGTTTAAACGTACGGCCCACAGTATTGCCCGAACACTTTC GGGTCATGCTCGGGTCAAAATAGCAAATCatcttttttttcacaaaatct tGGATTTTCGCCTCCGAAGACCTGACCTGAACATTCACAGGCAAgttcgg gtcatgttcgggacTATTTCAAGCTCAAAATCGTCAATACCGTGTACACT TTTTACTAGGATTGTGAGGATTTCGTGCTACCCAAAGGCTTACCAATAAC ATCCAGGATGACTGCTCATTCCATTGACCCATACAACGGAAATTCTTTGG AACAAATGTCTTCATTTGGTCATTAACTTTCTACATTAACATTTATAGAt aatttttatggatttttggattgaaaatatttttaacttttgataaataa agacttggggacacgagaagtttttttcgagTTGGTGCAAcgcaacatgc tctatcccaccaacacaagaaaaaagtgcgtgtcccatggtttctttttt gtttcatggtacaaaaagtgagggaaatacccaaaagacacgctgatttt gtcccagggtcaaaagtgagatttcacttttaatgatagaaaatagaaaa aatggggtggagatacgagaaagcgtttcaggttggtgggatgaagcatg ttgcattgcaccaacgcgaaaaaaacttctcgtgtcttCCAGTCTTtatt tatcaaaagttaaaaatattttcaattcaaatatttttccttaAGTTTTG AAATGGAGAATTTTTCTAACGTGTAATTGcttttgtattttgaaattAGT TTTTGAACCACATTTTTTCTaggattttttttgatttcgtaGAATTAGAA TTCGCGAGTTTGAGTGCCATTCTTGAAATAAGCCCACGATAGAAATGTAA AAGTACGTGGAACACGAAAATTATTGGCATATGAGGATTCAATTTAATTA CCAATATTTCATACAGTGTGTCCCGAAAAAgagtatcgagttcgaacatt ATTCTGAGTAGgaggttgttgcgtgtgtttaacaaaatgcacaataattg tttttaccaacagtcattatgattaaaaataattaactctctttacaatt ttcatgacgttaaaaTTATTGAGAATTGCTTTTTGccaaagttattcata aaagatgtctcgtGACAATTGatatgacacagagagaaactttgataaac attgcaaatttaagtgaaacacacacaagaactttctttctacgtctcaa tactttttttcaggacaccctgtataatgATATTTTATCGCATGACATgt aaaatatctgcaatctgattggttacaTTACAGTGCATAAACGTCATATT TTCATTTATTGCACTGATCAATGCAACAGCTTCATTTTTTTAACGTCAAT TTctttgagaaataaaaaaagaaagtagATTTTTCAAGTCTTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000728XLOC_000728Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001349-exon-sc0000010-1491911889:586520..586620TCONS_00001349-exon-sc0000010-1491911889:586520..586620Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:586520..586620TCONS_00001349-exon-sc0000010-1510915933:586520..586620Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:586520..586620TCONS_00001349-exon-sc0000010-1575043694:586520..586620Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:589099..589360TCONS_00001349-exon-sc0000010-1491911889:589099..589360Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:589099..589360TCONS_00001349-exon-sc0000010-1510915933:589099..589360Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:589099..589360TCONS_00001349-exon-sc0000010-1575043694:589099..589360Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:589702..589845TCONS_00001349-exon-sc0000010-1491911889:589702..589845Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:589702..589845TCONS_00001349-exon-sc0000010-1510915933:589702..589845Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:589702..589845TCONS_00001349-exon-sc0000010-1575043694:589702..589845Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:590484..590778TCONS_00001349-exon-sc0000010-1491911889:590484..590778Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:590484..590778TCONS_00001349-exon-sc0000010-1510915933:590484..590778Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:590484..590778TCONS_00001349-exon-sc0000010-1575043694:590484..590778Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:591865..591911TCONS_00001349-exon-sc0000010-1491911889:591865..591911Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:591865..591911TCONS_00001349-exon-sc0000010-1510915933:591865..591911Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:591865..591911TCONS_00001349-exon-sc0000010-1575043694:591865..591911Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:592659..592796TCONS_00001349-exon-sc0000010-1491911889:592659..592796Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:592659..592796TCONS_00001349-exon-sc0000010-1510915933:592659..592796Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:592659..592796TCONS_00001349-exon-sc0000010-1575043694:592659..592796Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:593795..593986TCONS_00001349-exon-sc0000010-1491911889:593795..593986Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:593795..593986TCONS_00001349-exon-sc0000010-1510915933:593795..593986Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:593795..593986TCONS_00001349-exon-sc0000010-1575043694:593795..593986Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:606721..606912TCONS_00001349-exon-sc0000010-1491911889:606721..606912Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:606721..606912TCONS_00001349-exon-sc0000010-1510915933:606721..606912Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:606721..606912TCONS_00001349-exon-sc0000010-1575043694:606721..606912Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:609154..609399TCONS_00001349-exon-sc0000010-1491911889:609154..609399Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:609154..609399TCONS_00001349-exon-sc0000010-1510915933:609154..609399Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:609154..609399TCONS_00001349-exon-sc0000010-1575043694:609154..609399Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:609862..610026TCONS_00001349-exon-sc0000010-1491911889:609862..610026Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:609862..610026TCONS_00001349-exon-sc0000010-1510915933:609862..610026Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:609862..610026TCONS_00001349-exon-sc0000010-1575043694:609862..610026Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:610749..610907TCONS_00001349-exon-sc0000010-1491911889:610749..610907Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:610749..610907TCONS_00001349-exon-sc0000010-1510915933:610749..610907Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:610749..610907TCONS_00001349-exon-sc0000010-1575043694:610749..610907Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:612435..612485TCONS_00001349-exon-sc0000010-1491911889:612435..612485Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:612435..612485TCONS_00001349-exon-sc0000010-1510915933:612435..612485Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:612435..612485TCONS_00001349-exon-sc0000010-1575043694:612435..612485Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:616969..617105TCONS_00001349-exon-sc0000010-1491911889:616969..617105Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:616969..617105TCONS_00001349-exon-sc0000010-1510915933:616969..617105Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:616969..617105TCONS_00001349-exon-sc0000010-1575043694:616969..617105Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:617634..617717TCONS_00001349-exon-sc0000010-1491911889:617634..617717Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:617634..617717TCONS_00001349-exon-sc0000010-1510915933:617634..617717Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:617634..617717TCONS_00001349-exon-sc0000010-1575043694:617634..617717Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:618972..619153TCONS_00001349-exon-sc0000010-1491911889:618972..619153Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:618972..619153TCONS_00001349-exon-sc0000010-1510915933:618972..619153Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:618972..619153TCONS_00001349-exon-sc0000010-1575043694:618972..619153Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:619630..619790TCONS_00001349-exon-sc0000010-1491911889:619630..619790Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:619630..619790TCONS_00001349-exon-sc0000010-1510915933:619630..619790Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:619630..619790TCONS_00001349-exon-sc0000010-1575043694:619630..619790Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:620474..620683TCONS_00001349-exon-sc0000010-1491911889:620474..620683Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:620474..620683TCONS_00001349-exon-sc0000010-1510915933:620474..620683Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:620474..620683TCONS_00001349-exon-sc0000010-1575043694:620474..620683Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:621133..621158TCONS_00001349-exon-sc0000010-1491911889:621133..621158Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:621133..621158TCONS_00001349-exon-sc0000010-1510915933:621133..621158Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:621133..621158TCONS_00001349-exon-sc0000010-1575043694:621133..621158Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:622571..622735TCONS_00001349-exon-sc0000010-1491911889:622571..622735Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:622571..622735TCONS_00001349-exon-sc0000010-1510915933:622571..622735Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:622571..622735TCONS_00001349-exon-sc0000010-1575043694:622571..622735Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:623130..623313TCONS_00001349-exon-sc0000010-1491911889:623130..623313Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:623130..623313TCONS_00001349-exon-sc0000010-1510915933:623130..623313Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:623130..623313TCONS_00001349-exon-sc0000010-1575043694:623130..623313Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:623858..624028TCONS_00001349-exon-sc0000010-1491911889:623858..624028Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:623858..624028TCONS_00001349-exon-sc0000010-1510915933:623858..624028Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:623858..624028TCONS_00001349-exon-sc0000010-1575043694:623858..624028Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1491911889:624529..625762TCONS_00001349-exon-sc0000010-1491911889:624529..625762Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1510915933:624529..625762TCONS_00001349-exon-sc0000010-1510915933:624529..625762Clytia hemisphaericaexon
TCONS_00001349-exon-sc0000010-1575043694:624529..625762TCONS_00001349-exon-sc0000010-1575043694:624529..625762Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:586520..625762 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.703744 0 1.94885e-06 2.09708e-09 1.72941 0.512889 1.49696 1.14481 0.774644 1.72512 0.673888 1.82012 0 0.0154249 0 0.293026 0 0.368812 0.290081 0.171062 0.173019 0.778943 0.0687906 4.59586e-09 0.201926 0.0420088 0.208522 0 0 0.000108975
Blast
BLAST of TCONS_00001349 vs. Swiss-Prot (Human)
Match: WDR49 (WD repeat-containing protein 49 OS=Homo sapiens GN=WDR49 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.370e-41
Identity = 129/479 (26.93%), Postives = 219/479 (45.72%), Query Frame = 1
Query: 1120 LVYRSLDETKRKVYVFKVTKGIECFAYNKELALIATGGVDHVLRLWDPYVTSKPMAILKTHQTSIIDVMIYEPLQQVVSYSKDGVIMTWDIKDQSPLQHLSIKFPFTGTVLEHGGFPLCL----TSHGSLFVAAEDCIAELKLTTAGAHRQNASHKGCVVAVYHIPHKNQIISASEFGDICTWSLDSGRKSSTIQTNQKSKEVLAFTIDKNAEFAVTGHIDGSGQLWNLISGKQEKTLAAYSDEEITNCIALPNASIIFMLGWSKKILMYK--NTNQYKKLTTLRPDTGWLSISSHKDDIISAAFWEPHFLATGTFDGDIFIWHIEHERLWRKIQIGRGQPLFQSLVNQYI-MPPRTARSGRRREKQHQVLRVSDEERPPTNQQQKE-HGEYTMPVDLLLYLGHRDHETY---ASLIATEGN-RVNWWSTTAIGTPVASFTISEDTEKVITAITSDLDNRYVIVGTNQGEVSIWNIVTY 2520
            + +R   + +  +  F + +GI  F Y+  L LIAT G+++ + LW+PYV SKP+ +L  H  S+I V  +   +Q+ S+SKD V+  WDI+ Q  +Q ++  FP +           CL     +HG LF++  + +A L + +  + R   SH+  V  V +     Q+IS+     +  W +D+G+K         + E+    +D N    +TG  DG+ ++W+  +G    TL    D  +     L     I + GW + I +++  N NQ+     ++P+  W     H DDI+ AAF  P  L TG++DG+I +W+   E     +      P +Q L+   +   P+   S  R +  H +      +   T  +  E   E    V  L +L  R +      A+L++  G+  V +W        +A F        +I  +++D  NRY+  G   G + IWNI  Y
Sbjct:    1 MAWREKSKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQDF-------RCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVK-SHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCHGNAEISTMALDANETRLLTGSTDGTVKIWDF-NGYCHHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQNFNQF----FIQPEE-WKGGIQHHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVL-----HPDYQRLLKSKLDTKPQKLLSAGRSQPSHPM-----ADHSTTGVRNFEIDTEGKNAVMRLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYK-KQLLAEFLAHSGVGSII--MSTDKMNRYLTTGDLDGWLKIWNIEEY 452          
The following BLAST results are available for this feature:
BLAST of TCONS_00001349 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
WDR491.370e-4126.93WD repeat-containing protein 49 OS=Homo sapiens GN... [more]
back to top