Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001348 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001348
Unique NameTCONS_00001348
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5465

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001348 ID=TCONS_00001348|Name=TCONS_00001348|organism=Clytia hemisphaerica|type=transcript|length=5465bp
tactgatgtatcatgtaatcaCCGCTGTTGAATTGGatagATATGGTTTC
AGAGAAGAGGAATAAAGAACAAATGGGAATGTCTTTGCGGCTAGATTGTA
ATCAACAACAAAGATAGAAAAAAACATTGGTCccttttgaatgaaaatga
acCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAA
TGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCA
AGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTG
TTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTA
CAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataa
agatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaa
aacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGC
GATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACT
TGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAAT
ACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATG
ACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGA
AAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACA
CAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTC
TTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGG
GAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAA
AACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATC
TTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTT
GAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTGT
TTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAG
GATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTG
TGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACA
GGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAG
CTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGG
TCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGT
GTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCA
TCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCA
TTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACG
GGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATA
GTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGC
TTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTATT
TGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGCT
TGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTA
TTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATA
CTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGT
TACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCA
AACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACA
CCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATT
CGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGT
TCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAA
AAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAAT
GTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATA
TGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTG
GTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTC
AAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGA
GATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATTG
CATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCG
GGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGA
TAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCA
AATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAAC
GTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAAC
GTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCA
CCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATAC
GGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGC
CACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTA
AAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAA
GAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACG
AATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACGA
AgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCT
CAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGA
CGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAG
ATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACC
GGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACT
TTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAAC
CATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAA
TCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGG
AGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGT
TGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGT
AAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAA
TTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTG
TCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGAC
AGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATG
CATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGT
TTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGAC
ATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAG
TGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCT
TCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTG
ACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAATT
GTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGA
TGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGAT
TCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAA
TTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTG
AACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGAT
CTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAA
CATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGC
GTTAGCCCACGGAACAAAAAGAAGTACGAACGTTGTTTGGAAGATATGTA
GTGTTCAAATGTACTAGAAacaaaagttgacaaaaaaatcttttgtggtG
ACAGAATGGTGATGGTGATGGTTATCATGCTTCGCGATACTTACATGATC
AACAGTGGTAAAGATTATTCCGTTGAGAATGTATAGTTTTCCGGAAATAT
TAAAACCAGCCAGAATCAAGCTGCGACTTTACATAGTTGATTTTCACATA
TTGGTCTGATAGACTAAAAGTAACAATGTCTTGTGTGCTTGGCTGAAGTA
AAAGGAATTTAAAAAACAGCAAAAGACAAATACATGTTCAAATGAAATGA
CTAAAATGTGTATATACGGCGAGTGAAGTTCATTAtaccctaaaaatgac
atttttttgtgGATtccttttttagaatttttttaaaccttttttttatt
taatgtaaaaaaattttttctttaagaagCTTGCATTATCTTTCCTCTTC
GACCGCTTTCCTTTCTGCCCAAAAGTGGAGtttattttctaatttgaaAC
ACCctattgtgaatttatttaaaaCGTTATAATTTAATCTAATTCTTGAT
TATCAAGTTGACGAGATTTAAGttcattttcaattatttttgtatcgttt
tccaaaagagaagaaagattTTTCACTGTCGCTGTTTTATGTAAAAGTTG
CAGGCTTTCATATTCTAGCTGGTACAAAATACCCATAAGGGGATTGGCTT
GCGTTTGTCCGAAATTCGAAAATTGTCTCTagaaagatcttcatttttgg
cGGGCCTTTAGAGAGAGTTTTCCTCCGAAATTGGTCGAATTTAGCCATTT
TTAGGTCAATCTTTTTCGGAACTTGTTATCCTCAGAGGTTTTTAGGActc
aaattttgctttttcatattttcctttctccactaatttttagttttact
ttttttatgttttcatgttttcattcatttcattACAAAATTTTATGACA
CACCCTTAATTCTGTACAAAGCAACTTTTTTAATGATGACGTGATGATGA
CGTAATCATGAAAAtatcgaattttttttatattagagTTTATGAATTAT
AATACGAATTCAACc
Run BLAST on NCBI

protein sequence of TCONS_00001348-protein

>TCONS_00001348-protein ID=TCONS_00001348-protein|Name=TCONS_00001348-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1404bp
MKMNHLHENLPGVKPASKCKCRTSLKPIARTLNSRGQGIKSLIQSSFNVA
KHTVADKEEKRKMSRTFSELQYLNGDHTVDSEDDENKDMEKHLSQSISLA
QFKKLQAKRKIKVVAVFPDCDGTQKALEQLNMVCTKLDIELTTIKFENLD
FGEYNVLNMFYNADVCVVDMTVLSEQASLFYHIGVRESTGMKDNVVIVED
DEYTDKKTSVKLAISSLSTFFSYQTNKEGKCVVTSMGNTAKDSCPRTIFS
AFLKQLRNVQGTSKAKCKEIFLRDLRKAMQRLKGVPLKEELDKMKKMLSE
PALFSSDTILNLLYSYRDIQDYESMIQIVEGVPVDHCEIQNRAIQQVYAF
ALNRRGSCQDREKALAVVIKLLNDKELNPPDLLCLAGRIYKDKYYASNFT
DDKCRDEAIKWYKTSFEIQPSDFSGCNLAIMLVAAGHSFLQSDELQRVCM
TLNGLIGRRGHLQDIQQFWIVGRFILISVLARDVSRACLAAERMFLLNPP
PWYLRSIIQDLEVIKHKIHACEESHEEESEVSMKHNYWQECIYKAATDCE
VDDTRFLVLLQDPGNDFIPSYIVVGSDNKDSVPDSAQTFIRLWHAIPPCG
KNHTEKCKKIHSWSFHASDIRGISTFKKDNRCLFLYVHNSDDFQLFFCTP
HHRKRFQDLVGSISAPILDNVDGDDVLVDQDALEYEYEIDHQGNRVVLGR
GSFGTVYAARNLSTNVTMAVKEIPEKDTSQVQPLHEEIALHREINHKNIV
RYIASRSEDGFTKIFMEQVPGGSLSTLIREKWGPLIDNEGAMAFYTQQIV
EGVKYLHEQKIVHRDIKGDNVLVNTYNGCCKLTDFGTSKRLAGINPHTKT
FAGTMQFMAPEVIDQGQRGYGPPADIWSIGCTVIEMATGKPPFFELEPEA
AIFKVGMFKTHPDIPEEASEECVRFLKNCFHPNPAERMSSEKLLLTAFIQ
LRTKRKKKKDHKLKVQIPPPQRIISDPGPSSPHESSDDSGAQSSNTNSVE
SPLDYQDKMDIIRSSKKNSTGAGDTLAKPTDVFMRKLSPTPPLKPHASRI
NSEPLRRVKTMDSPSSGSTESLNSMFFLSQSSHSSIGDEFSQVSQEHERK
MLLLTSMKNHKREICDKWMSKTEELSQHFMLTNTCFNYLLEALIEYIEQG
SNVVDIKNFIGPIQRDFPGDSRVLNEVQLAFHLVAECISEVIRDHMNVLP
HWMFLIDNLIRAAVKRTIDDISKELASTNDETTSVHSGGGGDTTPVLERK
AVRFLSRDNSMGMDDKVPYLTNIQTMSDDNMYLLQELSDLQTNFNKLLRS
LVLMYKLERKDSTTDTDTVDSSNTLKEEPTGDEELLNWLRNLNVPEPDIA
KFCEHYCTYDDVINLFELEDLKDMKISVGPRTRIWTNIRKIRESVNEGPT
EEVR
Run BLAST on NCBI

transcript from alignment at sc0000010:532504..573600+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001348 ID=TCONS_00001348|Name=TCONS_00001348|organism=Clytia hemisphaerica|type=transcript|length=41097bp|location=Sequence derived from alignment at sc0000010:532504..573600+ (Clytia hemisphaerica)
tactgatgtatcatgtaatcaCCGCTGTTGAATTGGataggtaatttttt tttagatatgaTATTATAATACAATCTGGTCACAGAGAAAGTAATGTTAC ATCTCAATAGAGAAAaggaaaacgaaaataaaaataaataaaataaaatt ttccctTGCTACTTACTTATTCATgaagtattttttcaatgaaaaacgaa aaatatatttgagAGAATGTTTTAATAGACTTGAATATATTTCTAAATTA ATGGTAGGATTCTTTTCTCAAGATATCTTTTTATAGCAGGTTGcacattt tcagatttttctttttttgtacaATAAATTGATATATTTTACTCTCagtt tttcctttgttttagTCTATCAGTCATTTCTGATCAATTTTTATAATTCT ATGATAAGCTGGTTATTTTTGTTCATATTCTTGATAGTttacaaaattat gaaaatatttttattttctcttttgtcTTACATAATAGATATGGTTTCAG AGAAGAGGAATAAAGAACAAATGGGAATGTCTTTGCGGCTAGATTGTAAT CAACAACAAAGATAGAAAAAAACATTGGTCccttttgaatgaaaatgaac CATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATG TAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAG GAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTGTT gctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACA ATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaag atatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaa cttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGA TGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTG ATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATAC AATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGAC AGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAA GTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACA GATAAGAAAACAAGTGTCAAGGTGAGTGGCtaagtttgaatttttatgtt caAGGATGAAAAAGTAGCACTTTTGCCAGCAAGTACCAACATCAAGTATA ATTGTTTCAcaaatttctacaaatttctACTTTATTAATGACCTTTTGGT CCAAGTTAACTTGTTTGAGTTtccataatttgttgaaatACGAGTTTTAA ACAGAGTTTTAATCAAGtgttttataaaacaaaatttccCATGAATGGTT GATTGGCCAAAATACTTATACCCCCTATAAGTATTTGACAAAGAACCTCT CAGTTGAGCATAAAAGCTTCTTTTGTCTTATAGCTGGCAATCTCATCCCT CAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCA CCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCT GCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTG TAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAG GAGTGCCTTTGAAAGAGgtttgttaaattttgtttcttgaaaACTAAGTA ATCTATCTATTTAAATATATACAGCATTCTTCATCATTGCAATAGAGTTT TATCTCAAAGAAAGTCTAGCTGCCCTTTGATTATTATTGTTTTTCTGACG CAAATGACTGGAAAATTCACTGGAATATCTTGAAATGAATCATTTAACAC CTCTTTGACATTGATGTTTGTTTTCTTCAGGAACTGGACaagatgaagaa aatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTTAT TGTATTCTTATCGTGATATTCAGGTATTGTTTCTTAAAGTTTACTCCTTG TATCTTCACCATTTTTATGCAACAGAGAGTTCTAAACAGAATAAGTAGGG TATTTAAAGTTTGGGACTGTATGGAGAAAAACCAACAAATAGCTGGGGAC GCTTAGAGGGGAGGTTTAACAAATTTAGGTAAGGTTTAATAAATTAAGGG AAGAACAGATGGGGTCCAAGAAGTGGAAATTTAGCAGGTGAAACTGGGTG AAACAACCCATGAGGACATGTATATCTCATGTTTAgcttttttgtttaaa agaaaactaGTCATTCTGGGGCATCTGATCAATGTGTTTTCCCGTTAAGA TTTTAATAAAGCATCGATGTATTTAAACTCTTCATCTCAAGAACTCGTTT TGTCCTAATGAAAGTTCTGTTTTTAACCCTTTTTCAACAATTTACCATAC GGACAATTATATTTTGCCTATTTCAACTCTTTACAACCATATTATTAGTA CATGCACAATTTGAGATGAAACTTACAATCAAAGTTCATCAAAGTATCCA AACCATAGATAAAGGACAACTTTTTCCTACCCTTAAGgggactactttga aattttctgatttttggaacccttagagagacttgggaaattgaaaaaac cgacccttttCGTTCGAACATACCGACCCTTTTCGTCCGAACATACCCAC CACcgatttttgcctaagtacggACAGTCATATTATTAGTACATGCATGA TTTGAGATGAACTTACAATGTGAGATCTTTAAAGTATCCAAACCatagat aaagaaaataaactcATTCTTTTTGCTTTACAGGATTATGAGTCAATGAT TCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTG CTATACAACAAGTCTACGCTTTCGCATTGAACAGGTATTTCTATGAGTGA AGGTTGAGATtttatcaccatatttccctagtATCCTGCCTGAAGTGgaa gtgcttgggattcgaacacagtctaTTGCGatgcaagtctgtgatcgaaa tcTTCACATtaccaatcggcagaatgttagtgagacaCAGTGCTACCTGC TAGCCTTATCTAGATAGTGAGTGAATGTAACGTACTGAACTTATCGTTCT ACATaatcattttgagcttttttttcTAACTCATTTTACGTCAATCGATG CTTACTCGAACATAATACCTAACTCATTACATAACTACAAATAAGGGATA ATGCTATCAACAAGTCTGGTATTTGTCTATCAGTCGGTTCATCTTAGAAT TTAAAGTATaggttcaaatattttctggaaaCTTCCTTCTTTCATCTGTT ATAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATT AAGGTGAATTGAAGTTCTCCAACTTTCAAAACATAACCCTAGATTAAAAA TATTGACCTCTTTAATGACCTTCAATACTTGAAATGAACTGTGCTTTATA ACATTTCCTTTCTATGATAAAAATAACTTTAATAAAATCCTAAGTCACGT TTCATCTTTGTGTAGTTGTGTCATGTTAACCTTACACAAAGCACCCACTT TTATGGTCCTGTTTTGAAAACCTTATTAAAGCTGGTTAGATGGGAGTAGA AAATCATGTTATTTGCATACATTCGCGCATCGTATATTGGTAGAATTGTT AAAAGAAGCTACAAAGAGGTGGGTAtcaaaaatttgtcagatgagttgga gtttttataagatactttaataattggtcatttaagtaataaaaatgacg ccttttttagaaaaagtaacaaaattgttttattactggttagcgaccaa ccaaatcaaataagagcttttAAAAACTCCATCACGTCCCAAATTTGTAA TGAGGAACTTGTTGTTTCAATCAAATCTCATTGTTTTGTAGGATTTTTCA GTGACATCTGACgagtaattattttttttaaagatttttgccttcaaatg tttttcttgccaatctagaatttttcaatttcatttaaatCTTAATTTCG TTCTCTTTCTAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTT ATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCA CGGATGACAAGTGTCGAGATGAGGCCATCAAATGGtgagaaatatttatt ttattgataTGTCTTATTGGTTAATAtcttgcccgggggggggggaggta AGAGGTTTGCGAAtggacgggtatgtccgagccaaagtttgacccttaga gagacgaaaattttttgacatttttaccaCCTTAGAGACTATTTCCCCAA gaattcagccaaaattttcaaattttagtctgTAAAGAATtcatgaccct ttgagggagtcCTTTGCAAGGAAGCCCTTCTCtgaaaatgccaaattttg cccaaaaatacCCTGTTTTTCCGCAATAGAGACTTTGGCCACATCattta actttcttttttccACACTCTAGGTACAAAACATCGTTTGAAATCCAACC ATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTC ATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTAAGTGCAATGCT GTAGAATTCTTTCTCGTGTACTTATTTGAAGGGGAGTCAATGCACCTATG AACACTTAACGGAGTGGTCAACTTTTGAGAAAACTTAAAATAAGTTTGAA ttaaatgaaacttttttcatataaaagGGTATGAAAATGGTAGGGGTTTG ATTGGTAATGCCATTGTTTTGCAATTTTCGTATGCAATAATCTTTCATGA TCCTGAAAAAACGAAACCTACAAACATTTCTAGAGAAATAAACTCGTCAC ATAATTATCTAAATTCAGGAAAATAATTATTAGACACGCAAAAAAATATT GGCCGATTATTGACCATGCCCAGACAGAGCTTTAATTAATCACGTGATAA ATTCCTCTTCATAACATTGGTTTAACCTTAGGAGCCGTGAAATCTTTTCT ATTACGCAACTGCGTCCAATTTCTTTGGAAAGGTTAACGGATTCAAAGTC TTTTTTGCGTTAAGGCGTGGTAAAAAACTTTATTGGTCAGAGACTGACGT TACACGTAAAACTCCAAACCCCAAATGAGGGAAAATAcccttttttaaca ctttttggaaGAAGTATTATATAAAGTGATACTTTAGTGATGCAATTTTC CATCCAAAGGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTT CAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGT TCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttt tattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGAA GTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAG TGAGGTAATACATCAAAtgtttaaattgaaaaatagtttttcaaGAACTT GTTGTTTGTTGCTGTTTCACTCCCACTTCAACTGGAGTTTTAAAGTTTAA TGTACTGTAACAAAGTGTAACGTGACTACTCGATGTGCAtactgaaaata ataaatttaGTTCAGGGTTTCAGATATAGCTAAGTGAGTCTCACACATAA ACTTCTATTATTTCGCATAGGATCAATTTTTTATTACAGTtgattctcta attcgatcttcaagagacTAGGgattttattcgaattagagaaagatttg aattacagagagtattttatactacTTTCTGACTGAGAGGATCAATATTT TAGTTCCAATTAAAAGAAGATTCTAATAATATAGGTTTGAATGAGAGAAA ATTGACTGTATCAGCTTTTACTTTTGGCTGTCTTCTGTAAAGTAAAGACT GCTAATTGGCATTGCTTAGAAGATGTCGACTGATTTTGTAATAGATGTAA AATCATTACAATCATCGCTCTTATTTAGGTTTCAATGAAACATAATTATT GGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACT CGATTTCTGGTAGGTTTCTTTTTTAATCGATGTCTAACTCCTATGTTGGG AAAAAGCATGAGAGACTTTCCTGAATCGGGAATCaaactgatttttcttt attttacaaATACTTCTTTTCGTTTACAATTGAATAAATTTTCTGTTTAT ATGCTACTTTACAACAAAGGTTTTCCTCGCAATAAAGTACGAAATACATG TTAATTCGTCGGTTTATTGGTGTTTCCCAGCCATAATTCCTCTAAAAAGT CGTCGTTACTATGGAAAATCATTCATTGGCAAAGACTATTCGTCGGTAAA AAGTGACGATTTTTATTGCTGACGAATTTTCTACCAATAAGGTAATAGTT CTCATAATGTTATAATGATGTTATCAACTGAACCTTTTATCGTCGTTGCG CATTTCAGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTAC ATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAAC ggtaaaaataatattttctcgtctattttttctcaatttttagtCTAACA AGCTAGACGACTTATTCAGACATAGtcgaaataaagcaaaaagtaatgga gggaacaaattttagttgattagtagcaataatcgtattatcatataacg ctcatactactgtattacacgcattatgaacgactccagtctactcaATT TTACACAATTTACTCAATGAAATACAAGACATTTATAATTTATAGTTACA TAGTGCTGTTTTACGGATAGTTCTCTCGAGGTTGACAGGTTAATGATAGT GCTTATTGATTCTTTCTTAAATTTACGTGCTTTTAACGAACTTTTCCCTC CAAAATTGTTGTTTGCTGATTTTATGAATAAGCGCCAGGTAACAATATGC TACTTAATAATGACACCTTTTTTATTTCCGCCTTGTTTTCAATCAATCGT CAACATACGATTCCCTAAGGTCAAAAGTtcaagattattttttgtgtatc ATTTAGGgagtaaaaaagttttctttctcaaaaatattACATAAGTGATG TATACTTTTAAAATAAGTGTTAAGCTTACACGATGGAAATATTCTGCCGC TTATTTTACCCGTTTCCATTTATGAAAATTAGATATTTAAGGTTCTTTAC ATATTTTCTGAACTTTAAATCGAAACTTCAAACCCATAAACTATCACTAG TAGACCCAGAATAAGCTTCTCTACTAGACTCCTCTACGTCGATCTTGATG TAACCTAATATGACATAGAGATTTTCTAAGCTCTACTTTGAGTATTATCT TAAGATAAATCCATTTTGAAAAGTATAaaagaaatttatccttaaCATGT ATATCTAGACAACCTACTTTTGTCATATTTCTATAGTTTATTCGATTATG GCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGGTAA AGTGAGATGTTGATTTTTATGTTGAACCTCCAATTTCATCGCCAAAGGTT CATCTTACAAAACGATTCTCAATATGCTAAGAGACTCATTTGCCCTTGGT GATACAAGTGAGAATTTGACTTGACATAATGATTATCATTCTACCTTTTG TTATCTACTAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGG GGTATAAGGTAAGAGAAAGAAAGGGTCGAAATGAACCATGggtaatgggc ttttccagaaaaaaatcgtataccccctgttgaggaggtccatccctctg tggctggaaatgctgtaaccccctggaattccaggcaatttcaggtttaa acccctctggaattctgaattttagtaggatttaaaaagctacccccatg gaattccagttatttttgaccgaTTTTTGTATATCCCTATGGAATttcgc cacatatcaaaccttacccccttggaacggaaatggacctcctcaacagg gggtatacggtttttttctggaaaagcccaatcagGACTCTATTAATGGC TTCCCATTAGTTAGACGCAAAACCTTCCAAAATTTCTGATTAATAGAAAG TCCACgttggtcctgattacccatgattcagtTCGATCTTGTGATAACCT TTTTTATCGGAATTAGAGATTTCGACATTGCACCAACTTACGGTAGAGCT TAGATCCATTGAGGaatattttcccaatttttttggTCCAAGTAGTAGTG GTCTGAGTAGTTGACTTAGCGTAACTCAAAGTGTTAGTTTTCTCAAGTTT TTCATTCAAGTCAACTATGAATATTTATGTTTTAGTACGTTTAAAAAAGA CAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTCT TCTTTTGTACGCCACATCATCGAAAAAGGTACGATTATATATATATAAGG AGGCTTTTAAATACACGTACACCGCCTTACCAGAGTACTGGTATCGAGTt aatatgaaaatcttttttcgatGCACGGCACAAAATCTAAACCGAGCCAT AAATATTGGACCATCCCATCAAACCAACCCTAAACCAGAAAGAAGGGTTT TTTAACTGATGAAAGTTGTCGATTGAGGCAAAATATTAATGGTCAAAAtg catattttttattttgtcgcAACTTCGACGAGATATTACGGGCCAATTAA ATGGTGAAAGATCTGAAATGTAGATGAAGACTTTATTAAAGCAGAACCAT TGAATGCCAGAACATGGATCATTCAAGCCGTCGGTAATAACTTACTATAT AGCACCGAtgtcaattttcttatttttgaaggTTTCAAGATTTAGTGGGC AGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGT TGACCAAGATGCTCTCGAAGTAAGTACTGGTGTTCACAACGGATTCAGTA TTTCGcataatctcataacagatctaccattctgcgcataccatgctttg ctctaaagggatatggCGAAGTGGCAACCTGACCTGGTTATTCAACCATA ACAATCAAAACGTTGCGTtgctttttgattgaaaatgaaaataaaagtat cTGGGTTCtgatgtttatgtttatgtttatgtttatgattgGCTTTTGAA TTTGGTGTACAACTATAAGCGTATATTGAAAAAGGCATGTAATGACTTTC AGAAATCTCTTACTcgtttactttttctttttcagtatgAATATGAGATC GATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGT ATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAA TTCCTGAAAAAGACACAAGGTAAGGTATTCAGATTGTGAGTTAGTAACTA CATTCATTCGGTGGCGAAATCGAGAGTGAGGGTCTATCCTCTTTTCTATT TTTGCCTGTTTGCGCTAGACTTGGGAGGTCGAAGCTGAGAAAGAgtcagg ggggggtcggtagtaaaatctcagacataatgaNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttt tataatttgaaaaaattttctgttggaaagttgtttgctgcaaacaaaaa attctcgaaattttttgtcaatataaaaagactttaattctaagggaaaa acgttaatttttgcactacgtgaaaaatgtgtcacagaaataatcNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNgtaaaatacctcttccaagagtctgggt ggtggtatgtaaaaattcgtaaaaatccttttactactcatatatgtctg agattttactaccgacccccccctgaaAGAGTGCCACATCTACTTTCAGC TCCCAGCAACTTACCGCCTAAATCAAATTACTTAGTGTAACAGAGTGTAA GCTACTCAAACGCTGCTTTGGAGGTGAGTTTAGGATGTAAATCCCTGCAA ATCATTGAtatcgttcgttcgttcgtctgtttgTCAGTAGAAGTTACGTA TCTGTAAGGCTCTGTATATCATTGGAAATAACGTCTTCAATTTTCAGCCA AGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACA AAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAG ATCTTCATGGAACAAGTACCGGGAGGTTTGTATCCCCACGATTCCATTTT CTAATTTCACTGTCGGCATTACTGCCTAAAACTactctctgttttttttt ttttttttgcttgagtgTTTACTTTCTTACCCACTCAAACGTTGGTTAGC AGACCCTTTTCTTTATAGACAGGTCTATTATCCATTACAATTTTATGGAC ATATCCAACGTGAATACAATCACGTGAATCAAAAAACCTTAAAAGCAACG ataattttccctaaaatttcTGACTCCCTCACTTTAAACCGTTGCCGAGA CCCATGAACATCATGCTGTTTTTTAACccttaattttctttattcataGG AAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACG AGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATAT CTGGTAAGTTCGACCTGCTTAAAAGCTTATCAATTTGGTCTATTATGTTG CCAGCATCGTTTTTTGACGGTCGAACTAAAggctttttttcataaaattt ctcaTGTGCAACTCTACATGCCttgtttttgagatattttgcctttGCTT TTCTGAGAAATTACAGAAACTTTCATAATTTCCtacaagatttcatcatt tcttctttttgaagCTTGAAGAAACCCTCCGGGTTAAGACTTTTAGAGTA AATGACAAGCTTTGTTGccaattttttcttgaaaatcctTACCCTCCTTT TAAGCCACTTGATCCACTTTCATATTGCTCAACCCACTCGCACTCATTTC TAACCCCTGGGAAGTTTCTACCCCATCCCCTGATGATGAATAATCATTTA CCTTTGTTTTGAAAGCTAAAAGGTCCCTCTCCTTCAGCGAAGATGAAGTC AGTAAGTAGCCCTCTTTATTTTAGCACGAACAAAAGATCGTGCATCGTGA CATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAAC TGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACC AAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCA AGGTCAAAGAGGATACGGACCACCGGTAAGATCATAgcgcgaaaattaat ttttagaaGTAGCAATTTCAAATCGAATAAGCCAGCTGCGCTGGTGTCAG CCCAAAAGGCATAGACGATAAGTACAAATAAAAGATCGAGCTTTGAGAAA GCGCATCTAAGCAGCTTTGGAGAGCACATCCATTTGCTCGGAACATTCAA ACAATATTGGCGCACAGTGAAATCCGTCTAAATCAGAATTCTGTAGAGCA AATTTATCTCGCCTTAGGGAATAAGAATGAAATCATTTTGTCATTCTTTG CTCTTTTTGATAGTTTTCACATGCCCGGATGGTACTAGGATGGCGAGCTG ACGGGTGTGCCGTcagactttcgaccctcggaccttAACGGAactaaaaa ggaggaaaaaaggacaatttttgtaaatttaacgacccttttttggacaa atttgaccaaatttcgatctttctagGGGGCAAAAAATCTTTCCGACCGT TTATGTGACTGAAATTTAAGTAGGCGGTAATAAATTGTAAACACCCAGGG TTTCATATTTCAACGACCGTATAAATTCCTTAAAATGTACTATTTACAGG CTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAG CCCCCTTTCTTTGAGGTAAGTCTGAGAAGTGCAagtttcttgtaaaaaaa ttctaccTAGTCAAGCCATCCATTTGTGTTATATAGATATAAGACCGTAG AACTATTGCAAGCTACCACTTTTGTACCTGACAAACACATTTCTTTTCCG GagtatttcaaaatattcaatataaaaTTTAATGAGAACACTCATTTTTT GGTAACGAGCGCTTTTTTGTGTTAACTTGTTCACCTTACAAACAATAATA TGAAATGTATtcaattaaataaattaaattaatttttgtaGCTTGAACCA GAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCC TGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAGTaagtaaaat caatcaaaagttaGACTTGTGCTTCTCATATGAAAAAAAGCAATACAATA CAGTATACCTCGAATATCTCCTTGATTCGAACAAGTGTAATGGTCCTTTT AGTTAATAATGCCTTTATCAACcttacttcataactcgaaatttccttaa ctcgaacaaatttgtgatCGATGTGCATGCGCGAGTTTAGAGAATATGAT ATTACGAGTTATAGAGAGGTGTTCAGGGGCTTGCTTACTGAAGgtacgag aaaacttgttcgaattgAAGAGAcatattcgagttatagaggttcgagtt atggaaacttGCTGTACTACATGCGGTTTTGAAGAGGTCTATAATTCAGA TTTCAGATTTTAGAAAGAATTACAAGCTTATTAATTCGAAGGCTCCTACA AATCTAATGAACATGTCAATAGAATAAATATCTGTTATCGTTATGAACGA TGATAAGTAGCTATTGGCAGGTATCCTGCTCAAACTGACAaggaaaattt aaacaaaaacattcttaaagtcaaaattaaatACTCTTTGCACTATCCAC AATTTTCTCTGGGAACTAGTCAAAACTGGTTGTAAAGACAGACTGAAAAA TTCGACTGAAAAATTCGCatgaaaagtttcttttttcctAACAAAGACGC CCTGAATAGAGTGCAATTTGCCTTATTTTAACTCGTCTTATGACGTCACA CGGAGGGTGAATTTCTGGACTTTCAGGGTTTTgctgtttaaaaagaaaat aacatattttaaTGTGTGCATTAGGCTGTTCCATAAACAATTCATACAga gtaggggggggggggctacgaACCTTTTCACCTCAAAAAAGATTGTttga aatgtgtggataccccctgaaaaaaaaaaaaatttttaaagtttacattg ggcttttccaaaaacaattcatacagggtagggggggggggggggctacg aACCTTTTCACCTCAAAAAAGATTGTttgaaatgtgtggataccccctgg aaaataacaaaaattcttGTCCTACCTTTTAAGTGAGGGCGGAAGAACTT GAATAAGTCTGTAACACCTCTGGACATTTTAGAATAAGTTTTTACCCCAA GTTTTTACCCCCTTGAATAATAAAATACACTCCTTTAACCCCCTTGGATT CTCGGATTACGTCCTGGAAACGTTAGTCCACCCCCTgtttggatataaaa tggaatggtccATTTCATGAATATCTCCatatgattttgatattttattt ttcttatagttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAA AACTACTTCTGACTGCATTCATACAATTGTAAGTTACACTgagttaaatt aaaatgattttcttaTATACAGTATgcgtactttaatgggataaattttc gcggggattaattttcgttgATCTCGCGGATTTTGGTGttaaccgcgaaa ttaagtccaaATGGAAAAGCgttatccgcgaaatatttttgaacaaaaat aaaaaaatgtcaaataactcCTTTCAAAATGATTAATGGCATCAATAACT ATGCCGAGCATGTTCTTACTCTCTCTAGACGTACGAAgcgaaagaagaag aaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCATATC AGGTAACCCGCATGGCTGTCTTCTTTAATATGCCATGGGTATTTTCCATT GGTATAAAATGTCGTCCATCTACCATGGTTGGGAGATTAAGGAAATGTTT ACCCTCCAAATGTCCAAAATAAGTattttcatgcatttttgatAGCCTAA AAATTCTaacatgattaaaaaaaaccttgcTAATTGTTAGTCTCCTCGCA ATAAATCGAGTTGATATTTCAGAGTTTTTATATCGTAATTTGTCCATTTT AGAAGAttgattttgaaaactcaaattaaaattgagtttttacCACCAAA TGACGGTGTTAAAAAAGGACTTGAAAATTACCATGATGCCATGTCGCTGT ACCGTCGAATTATAGAATGAAAAAAATGGGACCGCGTGATACTTTTTCCT TTATAAATATCGTAGGAAAAGAAAACAGGCGAAGATTTCAGTCGCTTTTA TATTCCCCATTGTCCCAATCAGTCGGTGAAAAGGGACGAGAAAAACACTT GTTGGGGAAAGTACTAAACGATACATTATTTTCTCTTTgctatttattta aaaaaactccaaaacgATAAGAATAATGTAATGTANttattaaaaaaaaa agacaaaaaaaaactataagaataaGTTAATGTAACTCCATtccattgaa atttttctttatttgattttctttcagACCCAGGTCCTTCATCACCACAC GAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGA GTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGA AAAACTCCACCGGTGCTGGTGACACGTAAGCCggctttctttttttatat taaaCATCCTTTAGGCTTTTTAGACCAAGCATccggcctttcattagcat atTGATCTCCGTGGTGCTTTATGTCCGTTTTTAAAGAAGCGGCGTTTCGT CAATTCAAGGCCATTTAGGAAGAAACGGCGCCTCATAACAATCAGTACGA ATAATCAGTAATCACGTGTCTGCATTGCGAACAAACATTCAACTATTGCT ATATCGTTGGACCTTCATGCAGCTTATCTAGTTGGGTTTCCCATAGCCGC ACTCGTCTTCACCCGTTAAACAGTCGGAATGAATCTTTGTCTAAAAGATT TCGATCAGTTTAGTCTTTCGCTAGAAAGCTCGCAGTCCTTGAATCGATAA TAGCGAGCCTATGTATGAGATGAGTGTTTTCCGCGACGGATATGGTTATC TTGATGATCCTGATTAACTAAGGACGACGGTAATTTAGTACTTTTACCAT CCTCGATTTTTCGGGTCAAAACTttgggtttttccaaatcgcttcagtca ctctgcCGACCTTAAAAATGCAAATGCATAAACTCACCATTGACGTCAAG TAGGGATTTTTAGACTTCACGTTTTTTTAAATGGTTTCGGTTTACACAAT CAGGATATTTTTCAAAGCATGGATTAGACTATTAGAATTTTTACTTACAA ATGCAGAATTTTCTGCAAACTTTGCACGAATCAAAAATTTgcatattttg taattttaaagtTACCGATCAAACatttctctttcattttattGAACAAG CAGGAGAATTTTAAATCTGTAAGATCCatagcaaaattttgttttagtgt tatcctttttttttcagactTGCCAAACCGACGGACGTTTTCATGAGGAA ACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGGT TTGTACAGACAGACTTTAACATGTCCCATGTATTTTCACTGGGAGtgttg tttgataaaaaatacatcaaaatctGGATTGATGTTCACAAAATATAAGT GCAACttcgaaaaaaatcaattttatgaTACTTCAAGGTCACTCTAGCAA GCTCATGATTTTAAGGGTCAGTAATGCGggatttttccaaatcgcttcag tcattCCGCCGTCTTTAAAAGTGCAAATACGTAAACTCGCGTCTATCGCG CCTTCGAGTTTATCAAGTGGTTCGGTTGCTTTCAGGCTAGGCCAAAATAT ATTATTTGAGGATTAAGTAAGtcacccgaaggctcctctttcgatagcta tcttccctaaggtaggggagggcgccactttTTCTCCCTAGATTGCTTCA TTTACCCTTGActcttctcttaattgctgagcatcaagtagagagacacc aagtaccatttttgtacTTTAGGTACGAAGTCTTTAGTATGACCCGGGGT TGAAAACCCacgaccttgcgcaccgtagctggaggATTCTCTACCTCTAC ATTACGTTCGATGATTAGCcataatgggctattccagaaatagtctgtac cccctatgttgaggaggtgtgacgtccagggtggtctggaaaatataaaa aatccgGGGTGGTCTGgtttttttgaatgataaaatccagggtggtcagt ataacgaggttgaaaatccagagtggtccaaagaaatgggagaaaaaaat ccaagggggtactgaaaaattggaaaaaaatccagaggggtcaccttttt aaaaatagaCCTCCTCCACAAAGggggtacacgttttttctgGATTAGCC ATAATGACGtaacgtttttttttgttttttttctttgaaactacCAACAG TGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGA CAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGT ATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTT GTTGTTGACATCCATGAAGAATCATAAGCGTGAGGTTAGTCTGTCAAATA AACACTCAATTTTAGCGTTATTGCCAATGAAGTGTTAACCCGAAtagcta gaagcgaatctcctaggtaggatttgaagccggCGCTAAATCCCACCTAA GTTtgcggccttgagcggcccgtgtggtttttaaaaattccaaatgtttt acaaattctggattgaaagtaaaattttccgccagatttgaaaaaaaatt taccacTTGAAGAAATACGGCGTATATTCTAATGTTTCACATTTTCTTgt ctgagaaaggttaaagattcgcttctagcccttcgggcttaaacTTCATT AGCCATAACGCTAGAATTGAGTGTTTATATCCTTGTCCGAGTGTCTGATT TCCTCAAATGCGAAAATTTAGAAAGCAAACTACAGTTACGTAAATTAAAG TAACATAATTCGAGTTAAGGGGGGAAACTTACAGAGGTTGGAGTTATGGA GAGGCCGCTGTAAAATCATATTTATTCAGTAAATAATcaatttcttaaaa atgtttttgttttccagATTTGTGACAAGTGGATGAGTAAAACAGAAGAG CTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTAGA AGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAAAA ACTTTATCGGTAAGGATtttcaagttgacgtcaaattagCCCAAAGTTTA ATTTAGGCTTCAGTCCACCAACTAGTTTTTTATAGAAAGTTTGCGCTTTG AAATTTCTGTCTGATCTTTTTTCTTAGTCCGGGTGGGGGGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNtttttttttgggggggggggggggggggggtacttaggcaag tgaaggtacgggtatgtgccgccctttgCACCTGGCTTTTTGGAACCTgg cagtccctgtaagggttagaaaaatcaaaaaattaaatctcaggtccact aagggtcggaaaaattttttgctcctaaaacattgaaattttttaaatta ttccCAAGAAGGATCATAAAATTTACAACATTTTACGATTCCTCCTTTTT AAGTCCCGTTgaggtccgagggtcgaaagccGGGCTACACCCCCCCCGCC CGTCATCCTGTAAATCTAGTTCCCCCCGGGCTTTTAGTATATCATTTACT AAACATTTTCAATTATTCAACACATAAAGTACTCTTTGGTGGTCGAGGCA CTGACTGATGTATGTGAGATTTTCAGCAAACTTCTTACGGCAGGTTCATT TATAAAGGACACTCCTTCCTTGAACTTcgtaaataattttcaaaaagtac gCTTTGGTTTACAACTGGAGTACTTTTTTAACCCAGCGATAGGGTCTGCT TATATTCCTTATTGGAGAGGAAGAATGCTTTTGACATATATTTTTTCTCG AATCCTCTTTTTTTCATCATGAATGTTTGTCTTTTGAGTTTCGTAAACAA TATGATTAAAAAAGCGCCCCTAGGGTTCAATTGGGTCAATTAtccatgaa acaaaaaacatCTGTTAtcgaaatttaattaaaaaaaacccggggaattt tattttcgtgaactttggaccctttCAATAAGTGAATTGgttttttgtaa cccttagagagaccttCAAGGGTGTAAAATGGAACCTTAATGGCTTGCAT ATACCCAATACCCATTTAGCCTAGTACCCCCTCGAAATAATTCACTCTTT Gaaagggtccaaagttcacgaaaataaaatttcccactcaaagggtcatg atttaaaaaaatatagacCAAAATTGAGTGAAAATCGACAAAGATTTTGG GGAGAAGTCTCGCTAATTTTCGATCGattttttggctcggacatacccgt caccttgcGAAcctgtaaccccccccccccccctggaaaaaaaaaacaag taataGAATAACAAAGCACGTCAGTGTATCCCTTTGTGTATACTTTGATT CCCATTCATTCACTCTCGTTTCATAACAACTCACAACTTTCTCCTTTAAc gaaagggaatttccctttggTAAACGAGCTTCGAAATTCGAATGGTACAT TCGaacattcgaacattcgaatgtttacaaacaaaagaatgacagaattt ttttaagtgtCAAAAGCAGTTCCGTGCTCCTTTTTTTTTATGAGAGCGAG TTGGTGTTGGTAGagatacatttttttttatgaacatgAATTTTTAACTT ATTGTGTATGAAGCTTAGACATTAAATTCATAATTCTAGATGAAACCAAG TAGGCATTGAAGAGTCACATATAATCAAAACACTGAATGGTGAATTAATA gatacagatttttttctgataactttgttgtgtatagaccttttttcaaa gaggacgtcctgttgaataattatgtagtccagccataaaacaATGATAg ggccatgcataattactgtgtcatgcatattgtaataattatgaatggtt ttatcattgtttttctgctggactacataattattctacagggtggcctc tttgaaaaaaggtcttaAAAAAATAGATCTATGGTTTTATAAACCGCAAC ACCTTAACAACACAAGAAGAAAAATGcatcaaagaaaagaaatgGCGATA GGGCATGATAGTTCTTCTACTAAAACAAAATTCTTCCAACTTGGAAAGGA GACACCAGAAGTTACAATGAAACGAAAAAGAAGACCCATCATTGTAGTGT TTGTATTATTGGCATTATTTTATTGGTTGTTTTTGTCAGCTTATGTTAAT CTAGAAACGTGGCAATCTTTGACCAGGCAATTGAAATCAGTCAAAGCAAA ATTTGTTTACAAGAAAGTTCCTAGGTCTTACTTGAGCCTGTTAAAAGCCC GAATGAAGAAGAAGCAAAAAGCAAAGAAGATAGTCGTAGATCGCTGTCCT CACCCTACACTACCTGTAAAAATGAAATCAGAAGAAAGTAACGGACAAGA TATAACATGTAAACCCAATAGGTTGACCGCATCCGCTTGTAATTACGTCA AATCGAGGTATCATTATAATTATCACACTTACAAATGTGGAAAAGGCGAG GGTGAACCAACATTGAACATCTGTACTTTCCAGGAACAATCAACCACATT CAAATGCAATCATAAAGCTTGTGGTGCAAAGTTCAACGGATCAATTTACA TACAGTTGTTTGATACCAATCGCACAGGCTGGCATTACACCATTAAACCT GGTTACAACGATTCACAATCTCTTGAAAGAGCTGTTCTCAAATTCGCCAA ACGATCTACAAAGTTTGCTGATGATTTCATGTTTTTGGTTTGCCAAGGAA CGAACCAATCGCAGCTTTTACATTTCGATGCAACGCACTTCAAAGAACCA AAGGTGATGATAAACGATAAAGATTCGCCAAAAACCAACAACAAAATCAA CATCAATGTTATATGGTTGGATTCAGTATCTCGTCGCCATTTCTTTCGTT CTTTACCAAAGACCATTCATCAAATCAGGCAAATTAATACGAACGAATCG ACCAAAGCTGAAGTCATAGATTTTGAACTGATGCAAGCAGTCCACGGTCA CACCCACTTGAATACTTTCCCGTTCTTCGAAGGGCGTGTCTtcatcatca ttgctcgaccgcagtcgagacaaTGGATTCCNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNATCAGGTTCCATCTTATCTGGAGAGACCCTCCCATTGGGGTTTAAGAT CTCACCTTCATTGGATCCCAAGGTGGAATCAAAGAGAGAAGAATGATCGA GAAAAATGTCTTACCGGAGACGATGAGCGGTAAACAGAAATCGAACACAC TTCCAGACTTGAATAAACTCTTCAATTTTATGAGGAACTCTGGATATAAG AATCTCTACCAAGAAGACTTGTGTTACAAAGGTTTCTATGGGTTAAACGA AATGTTGAATGGCGGAAAAACGTGGAAACAGGTctcaaagaaattgaaaa atctccaaattGATGATTTAGGTATGAAGCACTTCACACATTTCAGTATC TTGTAtaagaaaagttttttcgaTCAAGTGCGTTAATTTGATATGAACTG CTAGGGGATCAAGGCCAGCACACTACCGCCATATAAATAAAATACAGACA TAGTGGGCAGAGGGGTATTAGGCCCCTTAAAAATGGCACCCCCTCTTAGC TCAAACCTcctcttgaaaatgaaaattcctcaACTCCCCTCATTTTATTC ATCCCCCTCTTTTCTGACCTTTTACTCACAAACTCTTATAATCTCTAAGT ATATTCGAAAGgttattaaaatgaaaaatacaataacatgaaTCTACTGG CAGAAATTACTTTTTTAACAGATACAGCAAATATGAAGTCTAATATGTAA CTGACCCTATTGAAATATGTAAAATACATTTTGCAAATTTCCAAATCTTC CAAACCCCCtcaattttcccccccccccgttttttTGCCCAAGCCACCCA ttgtatttgaaattttcacaagtcTTCTTCTGAATTCAATGAAATTCTCA AACCCATGTTTTTTCAAGGGTAATGTGTACCCACTATGAAAGCACCAAAT GGGAATCGGATATTGTCTCCCTGGACGGCAGCTAAGATCGATAAACACCC TACTACTGAACCATGTACCTTATAAGGGAAGAAAACTTGGCGGATAGAAA TTTCGGCGGTCTAGGTAGATTTGGtcaaaatctgccaaattatAAGTTTA CGCGAAATTgatttcccgccaaatttagccATCCGCAACATTGGATTCCC TCTGTAAAAACTTTTTCGCCCACCAAActattagtagggggaaatttgtt cgtttttttgatgtcgctcgacttttttagtcaaagcacttgttatacat ttttggaaagctaaggggtaggggaatcaaaataacttgggtgccaattt tttttcggacactNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNgcacccaagttattttgattcccctaccc cttagctttccaaaaatgtataacaagtgctttgactaaaaaaatcgagc gattttacaaatttccccctactatatatCCCCGCTGAAATTTCTTCCCA TAACGTATTATAGCAGCTTATATACTGCTTGATTTTTTAGCTGATGATTG TTGTCAATACGGGCGGCATGAAACGTAAAGTTCTGAAACAATAAATcaaa gtctctttcttttaatttgaataagCTCTGATATCATCGAGCACTCTCGG CAGATAAGAAGAAAATAGACTTGTATACTGCTTGATATATAAGTAAGCCC TTTAAAatcatatcaaaaatattttttgtttattcttttaAGGTATCACT TTGGCATCATGCAAGATTATTCATTTTTATAAATCCAAAGAAATGAATAC CTTCAACATGCGTTCATTGCCTCAGATATGCCACAATGGCATCAATCTCA ACACGTATTTCCTCCAGCACATTAcgtcaaaactgaaaaaaaccaCACAT AACTTGTTCAGTTTTACCACGTTAAATATCCCTCATGATCAAATCGGTCG GCGTATTCAAGGCATCGACCAAAGCGTTGCCGAATTTTTCTCGGTAATGA GTCGAATGAAAAACACAATCACTTTCTTTTTTGCCGATCATGGCAACTCA TACACGCCTTATATCTATTCAGAATTAGATGTCAGATATGAGCAGCACCA TCCACACTTCTTTGCCATCCTACCGGAAGATGTAGTAGAGAGACTGGGCC CAAAAGTGGTTGCAACATTACGTCAGAACCGTCTCCGTTTAACGAGTATT ATGGATATTCATCATACCATCAAACATATTGCCAACTCCTCACATCCACA CAAAGGGCTATTTGAAGAGATTTCACCTAATCGAACGTGTGATGACATCG AAGTAAACGCCCCTAATTATTGTGTTTGTCAAGGCTGGGATTCTCCAATG ACTAACACATCTGGTGACTGGAAATTTGCCGAATTTGCAGTCGGCCATCT TAATAACATGATCACTAGCGCGTCACCAAGAGGCCATTGTAAATGGCTAC TACCTACAAGTTTTGAGAATCTTATTACCAGGAAACACGATACGATTATC CAACTGACCATGGATATTGTTACAAACCCAGGGCTCGGATCCacaaataa agaagaaaaattttcagttcAAGTCCAATATGATGTTCGCAAAGGCTTGA ATTCGTTTCATACACGATTTTTAACTTCCAACCGAATATCGAAATATGGA GGTTATGCCAATTGTAGTGATACCAGTGAAAAGGATCTACATTTGTGTGT TTGTGATTTGATTGATAGGACATCAAAATCGTCATTACCATTGACCATAA CTTCTTCGCTTAAGTCAGTAGATTTGAAATCTTATAAATCATCCCTCTCA ACAAGAAAAAACAGTGCTTCTTCCAAGAAACTATTTAACACTAGCGATAA ACTTTTCCTCGACTCTAGCAATAGATTGGCAAAATCGATCAATATATCTT CGGTTCTGACCAACTCTAACCTCATGCTAAAATCTCTGAATGTACCGAGC CTCGCACCTAAGCCATATGATCTTGCTAAATTGAGGACAGCCAAAGAATT CAAAATCCAATTTAACCATAAAgagataatatcaaaaattatgATTGATG TCAACCAAACTAAAGGAAATGAAAGAGAAATATACCCGCTAGACTTAATA CAAAGGGGTGTATATGAACGCAAGACTCCAGTTTCAACCACATTTGAAGT GATTAACTATTCACATAATCAAACTTTTGAAGTAACCATTCTTTTTTATT GGCGTAATCAGGCGAAGCGGATGAATACGCGCCCGTGTAAAGGAATAGCG AAACCGAAATCCATGAGATATCTGTGCACTACCGGCAAAGGAATACCGAA TTATAAAGTTAAcgtgaaaacttttttaaatccgtaattgaattgaactt ttattttttttagattctccTGTTTTtattattccaaaaattttttaaat taaaagtttaattttgcaattttgaataaattttcttaaacAGTATTCTT ACAAATTATGCTTGGAAAAGTATTTTCTAGGGTATTGTTTCCATAACATC TTTCGATGATTCTTAAAGATCCCTTTTGCTTTTTAACCCAGTACCTCGAC TACCAACAACAATTTTTTATTAGTTAACTACCCAATAAAAATTGACCTTC GTCTACAGCCTAGTTATTAATCTTGAATGGTCCGCATTTCAGAAAGTTAA ACTTAAGGAAACCAACTTCAGCCAATTTAGGTCAAATTCGGCAAAAATAA ATCTTGCATCAGTCTGTGCGATTTCTTTGATGAAAATTATCAAACCTTGT CTTACACATACCCTTAAAACTAACCATAAAATTGAATCAAACTTTATCAA TTAACAGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAA TGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCGTAAGTATCTCAA CTATAGTTGTTCTTTCGTAAAATTTTGATTTGGTGCTCTGTGACAGACGT CTTCGACAAATTCTGGACATTAATTTTGGAACTTTTGGATAAATTGGATA ATTAAATTCTTTACTGTCCTTATCCTTGTTACTGTTGAAAATAACCGTAT AGGGTTCAAACGCCCATTTCATATATTTGAATATCGGAGGGGTGGAGGCT GGGGTCCGTAAGaatcaaaattctaaaaataattaAGAGAAACAGAAAAA TATACTGTATCTTCACCAGAATGATGaccctgtttttatttttcttgcaa CTCGTTAACCATTCTACCAAAGGGTTACCAAACTATTGTAATTCATATTG caagtcttcataactcgaacacacgcACGGGAATTGAAATTCGTTTGAGT TATTGAAAATTCGAGTAGCCTCTTTATTGAAGGTTTGTTTGCTGAAAGGA GGAAACAAATCGTTTGAGTTAAGGAGTTACGGGGTCACGAAGAGGTGGAG TTTTTTTACCCATTTCTAAAACTCAAATCTCTCCTTAAAACTAGAACATA ATTTCTCGTCCCTTCACTTAGCAATGCCCTATAAAACTTACTCCAcatct cgaaatttccttactcgaaataatttttgttacccatgcttgttcgagtt atggaggcttTGCTATACTTTTATCTTCCTTTCACCAGATATCAGAAGTG ATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAA CTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAGGTA GGCTCATGCGATTTTCTATTCCTTAAACCATTGTTCACTCCTTTGACGAA GGGTCGGTTGTATGGTAGACTAGAGTCTGCTTCTGACTTAAACTTGCTTT CTGAAAAATTCCTGTGAAGTACTTATAAGCACCATCctgtctatcaaaaa gctacaagtgccccccccccctccgagGGGCAATTTGTTTGGCTACTTGT ATATGCCAAGAAGTTACGTTTAAACTTTAAGGTAAAAACCAATCACTTTC GAATAAGTGTTAAAGATTGAAATACTTTTTATATGGTAGGGCTCttatgt gaaaaaaaattgcttaGCATCTATTTCCCTGATGTAAATGATGTTATTTG GTCGTATTTGAAAGTCGAGAATGGAAAAGTAGTTACCAATTTTAGAATGA AAACCCATGCCAAAAGTATCGGGATTCAACAGCCCGAAGACAGGCCGATT TTGACAATTTTACAACGCATGCAGTTTCGCTACTATTTGCATGTAGTTGC GTTTAGTATACTTTGCCAAaaattcaatcatttttgcacgttttattttt caaggaatTCTACCCTATATTAGCTACTAACCAACTCTATTTTCTGTAAT ATGATATTATCCAAACTTTACTAACATTTACTCAGTCCACTTACGTTTTG AGTTTTTGGTTCTGAATTCACGTCACGTTTCCACTCGACAAAAGAGGCAT TCTTGAAAGTATTATAAATTACTCAAGCGGGATAGAATACATTTTCGTTA AACTATCGAAATCCCAACGGGGATAGAATTCTGTTGTTCCTAAGTTGAAA AATCTAGTGGAATTGTTGTACCTAGTGATACTTTAGAGtaccattgaatt tcaaatgaagATTAAAGcaaagtcaatttcctagtggggctgaaattgaa GGGTAATTTCCCATCGGGGCGGAATATGGCTAAATTTTCAAGTGTAGTGG GGGttcagcgggtctgtgacacggttataaaagatatttcttttagAAGA TGAGcaacttttttatatttcagGCTGTTTTGCAAAGTCACTAGACTTAA AgctcaaattttattttttgaagtgcttAGGTCATTATTATCTTAGATGT CACATCTAATTTCAATATCCCCTAACGAAGCTATCCTTTTACAAATGTCC CTATGCAAATAAAAGGCGAAGTGAAGTCATTATATAGAACAGAATAGATG ATAATTGCTGATTAGACGTTTTATAAATTAATGAGTTTACGAATAGGGTC TTTTTTATGTAATATGACGTAAATTAATGCAAGTTGGGAAAGTCTAGTCA TCTGCGAAATCTACACTGAATCTGTTAAAAACCTGCCTGATGACGCAATA TTACGTAAATAGATTGATTCTCTTTCCTAAATTATAGTACACAGTAAGGG TAATCTAGAAATACTTTGAGCGTTTTCACGGATCAACGGTCTGCAAACTC CGCTTTCTATGAAGTGAAACAGGTTTATGGCACTGACACCATAGACATGA ATTTTACAGTACCTCTGTTCCCCTTTGAAAAATTGAGACACCTCTGTCTC AGTGACTTAGAGAATACTATTTAGGGGATTTTGAATTCGATTGTTTACAG GATGAACAATCCATTGGGGTTCTTAAAATTTCAGTTTCTTCTCCAGACTT AAGTGTGGTTTTCCAAGATTAAATCTTTCTCACATGGAcgattttttgac tgatttttatCCAGTTAAGTGAGCAGTTATTGATTTTTGCAAACCTTTAC CACTGTATTATAGAACGAGgagaaaacaacatttttttgaGGGTTTGGTC AAAGAGAATTGGAGAAAAGTAATTGATATcttaaatttcaaccaatgcTT GCATTTTTGTTAAATGTTGATATAAGCATTACTTATTAATCTGACATACT TTGACCTTTTCCGCTTAAACTTTCGTGACCCGTTTTATAAAGTCTTAGGA AAAATAGTTTTATTGATTGACATATGCTGTGCGATAAAATACAAGAATTA GGTGAGTAAGGTTAATTCAGCAAAATACGATCACAATTAATGACTAGTGT GCGATTAGTCGAAACCCATAGACCCAGTTTAGGTTACTCTCTTCATTTGA GTTCAGAATTTATTTAAATGGTTAACTTAATAACCTTACGTTAGATAGTT TATGTATACTAAGTTTTCTGAGACAGAAACggctagaatttcttttgcct tGGTCCTGGCTGATAAGGTAAATCGACCCCTTTCACCGTCCTCGATTATG CGGGTCAAAATGCGGATTGCCCTAAATGGTTTTAGTAACTACGCCGTCCT CAAAAGGGGAATGCAAAAACTCGCTTTTTGTCCTTAGTCATCTGTATTAG CATGTTAGACTAATCattttgaggattttgctaCGATGCTTGGTCATAGG AAGGATATCATAAGTGAgggaatttttgtgtgatttctCTTCCTTATTAC CTACTTCCCTCGCCTCTTCATTATAGAATTTCTTGATTTGTTCAGCATGA TTTTCCTTttggttggaaaaatttttttggaagtTTTCAAATCATCTCAT CATTGTATAAAATGTtaaactacaatcatggtcgaaatagaatgagaatt ccggttattttaacgttttttcaagatttaaagttctggcgagaaagtcg attttgggctatctttttaacttaatcgaatatttcaatttgggaggggt tggcagacttccaggctatattctgagtcttattgggctatttttgaact tttggatcctgagatcctaaacCATAGGACGAATAAAAGAAATTCGAAAA TGAAATAGAACTACTATCTTTTGGCGCAACATCGCTCCGGTCTTTTGAAT GAGCTGTCAGCAAGAAAAGAATGATTTGTCGAGCAAGGCAACGTTAGGCA ACATGATATCGACTTCGTTCAGAGCTTGCAATTGCTTTGACCTTTGGCCG AGACTAgactatacacgttttttcataagaacattgaaaacttttgaagc cttgggatgttcgtaacttaagcctaaaaatgttcttaacatgttcttat tttggccatttttttagtatttttgtccattttcctaagaaattcggTGT TTTTAAGAATCagcaaagcctcaaaatgtccttaacttgttcttaacatt ttggctgcggaagccttgtgttcttatatagtttgttattataaaaaaac gtttatgtAGTATAGACTTAGAAGTATATGATACGATgagaaaattggca aaatgtaGCAAAATAGAATTGCAATTTCACGAAATTTGAACGAAAGTGAT TTAACAATAGTTAGCGACTATTTACTAACATTTTAACATGTCGTTTCAAT TTTTCCCAGAACACAAATAAACGCGGTAAGATTAAAAAAATGCATTCATa agcattttattttatttccctTAATTTGGATATAGGAATTCCCATAAGTT ATGAACAGCAGCGTTTGTCCACCCACGCAGAGATCACCAAAATACCTTTC TCAATTATCAAGCTTCCTACCTTTTGCATAACTGTGATTCCTCTTTATGT ATTTAACAATCTTTTCCAAAACAGTAGATTAGATTGTAAGATCGGAAAGC AATAGTTTGTCCTCGTTTAGCTTTTTGTGCagtcagcaaaaaaattttta gcaTTTGATGACAGCGCAACTATGTCATCATGTAAGAATActatagaata aaaaaaataaaaaaagagctttttataTTGTGTTGCTTTGATAGATTGTG ATAAAatagacaatttttttttcaaatgcagAGACGTATCAATTAAAGTA GGGGAAAGTTGACAAGACTTTGGAAATAAGAAACATTCATTAATCCAATA TTTCTTAAGATATAGAGTTGTATATGAGTTGAGACGCATCATATAGAAGA AATCGGAAAGATGATGAAGCCAGACTTAGCGAACGAAAAAATAGGGATGT TGAACTTAAAAACACGATCTTGGTATTTCTTTGAACACCATTCCTCTGAT TTAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGG AGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGA GTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAAT ATACAGACGATGTCGGATGATAATATGTAGTAAGtatactttttcatgat tttgaaattatgaatgACTATTGCTAAttctgttattcgaatctttctat tattcgcctataactcgaacaaatttaaaGACTTTCCGTTCTGATTAAGC AAGAGTCAATTGTATTCTTTATGAGATTTTTAGATTTAGTGCACAGATCG GTCAGGCTATCTACGTGGGCGGGCAACTGAATAGAAAAGGGTTGCACTTT ATGGTTTGCACTACAGGAGCCACATTGTATCCTCATATACCTGTTTAAGT TGGAAATTTCTCATTTTAAGCACCACAGAATCTTTGTTGAACCAAAAACT TCATTCGGGTTGAAAAAGTGTCTTTGGCGAAATCCAACTTTGTGCAAGCT CTGCACAAAGACATTTTTATTAGCCTAAATAAATGAGCTAGACCACAAAG GTTATCGATTCCTTTTCAAACGATAGCGATAAGCATGCTGGGGAGGATAA CATCTTTATATATACCAACCATGAAATTCCTTAGATTTTAACCTTGGTTA CAGAATGACTAATTCGTATATTCAGCTCTTTTTCTCGAAAccattatacg tttttttataattgaacatccaaaaatttggaagctttcggatgctctta actttttgagttttaagccttcaaatgttcttaacttgttcctaacattt tgaccatcgaagccttatatagtttgttcttataaaaaacgtgtatctct TTATTACTGATAAGATTCTTTTTGCATTTGCGATCATATAAGTACATTCG CGGTTTCTTTTTTGTCTCGTAAAACCTTTTTTCCCCGGAATTAAGTTACA CTGTTAGCAGTATGTTGGAAATGAACAATATTGTAAGACAACTAACTTCC TTAAAGGATGAAAAAACCCATCATAATGAAATCCTGGCGACCATAGACGT GCTAGTGGTTATAATTGTCAGCACTAATTATAAAGTTCAAAACAGCCAAT TAAGTTAAATCGAGGAAAAGAATATTagatttttgcttggttaagcaaca ttttttttatctagTGATTTCACTCCACTCGATATGTTTGCCAGTCAGCA TGGCTTTTTACTTTCGTTTGCTTTTGAACAGTTTCTATTGTTTACGAATG GAACGAGCTCTTccttttcaagattttcaatgtacttttttctttgattt ccaCAACCATATACaattgactctcgctaattcgaactcgaacgagAATT CTTATTTGATCGAACTGCAGAGAGATTCTAATTATAGAAAACATTTTACC CGAGGGTTTCTCATTAACGGGGACTGGGAATGAGTTAGAATTATAgaaaa ttcgaataatagaaacttcgaataagagagagttTACTGCATGACGTAAT TTTTCAGAACAATGTCATCTCCGGTTGTTTAATGTATCCGACAGATTTTC ATGCAATAGTAAaccaggcacgacggaagctttttatatctggtacggcg aatgaggaaatttaagcgattttatagcgatttgaccgacgaagaggaaa acttcgggtatttttgtgaaaatctggtacggcggccGCCCTACCTGCCG TACCCGACAGATTTTCATGCAATAGTAAcccaggcacgacggaagctttt tatatctggtacggcgaatgaggaaatttaagcgattttatagcgatttt accgacgaagagaAAAACttcggttttttttttgaaaatctgttCCGGCG GCCGCCTTACCTGCCGTACCCGACAGATTTTCATGGAATAGTAAACGCTT AGAACAGTAGGAGTAATTGGGTATTCTCAACAACactgtttcaacgttca tctaatgttcacaacgtctatataacgttTGATGAACATTGatacaacgt tgtgtgccagctgctGTGGTCCAATCACTTAAGTGCAGGTGGCAATTGAG GTAGCAATCACTCAATTTGTAATCTGTTCCAATTTTCCCCTTTTATAGCT TGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGA TCTTTGGTTTTGATGTATAAGTAAGTATCTATTTCCAGTTTCAAAGTACT TGTCTTCGGAAAAGAAATTGTCTGCTATTTGAGGAGTAAATCTTTCATAG CTACAGCAAATTTACTAATCAAGCCAAATTCTGATCGAAAAGTTTCTGTG TGTCGTTAAGCCAAGGTTGCGCTCCCGTTGTAACTACATCATTAAAGTAA TATTTGTTTGCATAAAATGTACCTTGAATAAACGCAAAGGCCTTAGAGGG TTCATTCAACTTACGTTAAATGTATGTTGAAGAAATATATTTGGTCTGTC AATATTACATTAATGGTTACTTGATAAGAGGGCTTTGGCGAAGGGTATCT CAAATTTCTGCAAACCAAAGCGTAATTTGAACCATTTTGCAAGGAAAAAA GTAGTTTAGAAGTATGAGTATTGTTTGCAAAGAGATCACTGATATCTAGG ATAGGTCAAGACAGATATAAGAGGTCATACctattctttaaaaaactttt gcttCGCAAAAATTATACTTGCCCTTCTTCCTTAAGCCGCTCTCTGCCTT AATCTTCTTCATACCTCATTCCTAAAGGAAAGTGACTTTCATCATAGTTA TTGGACACTTTTCTCACTTCCCGGAGTTATCCCATGATGGCGAGTTGAAT AGAGTAATTCCTATAGATCGTTTTTACCCTTTTTTATTGAACGAATGTTC ATTTTTAAACGAACAGTAACCCTGTAAAATTGcgtcgttttgcataagat ttCATTTCCTGCACCATGATTTCACTGACTTTTTCGATATCTTTCCGCTA TTTTCCCGGGATATCCGGTATGAGATTGGAAAAGGTTTTTATCTAAAgat acggaaaatcttgtgtctACTTACGAAATAGCCTAATTTTTTGAAGCTCA TTTTTAACTACACGGAGTtctggtctttttccgctagaaaGGTGGCAGTA GAAGCTAGAAAGGTGGCAGTAGAAGCTAGAAAGGTGAATCTTAGTGCGGG TAAGACCCTAATCAATCAGACTCGCGGACTAACATACCCTAGAAATTTAT AATAGAGATCTGAACCTAACAATTGATTTTGTTATACTCTGTTTACGTTA GATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCA AACACTCTAAAAGGTACGTCTAGACAAAAAGTTGTAGATGTTTTACTCAG AACAATGAAAGGAATCTACAATCAAAATGTCTCGAACCATCTGATTATCA CTTTAAGTTTCAACACAAAATGATTCTTTCCGGATACACCTTGTTTCGGA ACAAGTAGTCTCCGaatccattgagtttcaagcgaAACGCCAGAGGCGAA TCGTCAACTTTTCCTagacgagaaaaaaaattatgcctTGAGTTTCATGT TGTATTTCGGATAACGGATGGAACCTaacactttttttgttttcgcgtct cacatttttagaattttgacgTGATTGTTCTCGTTCTGCTGATAGTGGTC CTCCATGGAAACAATTCTTTAGCTGCAAAGCTAATAAAGTTTTCGGAGCA TGCCACTCAAAacatattatattattttgtcaTTATTATCTTACTCTAGG CTTTAAGAAAGATCGCATGCAAGcttgtcttttgggaatttccccggcgt agagtttttgttgattagtCTCGcaagcttagggaaattcctCATTCCTG AAGGTCTTAAGTAAGATTTTACGTACATTTGAAATAAGCTTAAGGTTTAA AAAACAAAGTAAGCTTATGGAAATTCCCCATTCCTGAAGGGCTTAAGTAA ATTCTACGTACATGTGGAAAAAGCTCCAGAAACGCATAAAGTAAATAACG TTCAAATGAAATGATTCGGTCATTTTCTTTCTACAGAAGAACCAACCGGA GATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGA TATCGCTAAGGTATTTTCATACAATCCTCGAAATCTACCGTCGTTTTGCA TAAGTTTCCCTTTCCTACACTAAGATTCCTGTGACACTTTACTACCGGAA AAAGGCCAGAACTCCGGGTAGTCGAGAAATGAGCTTCGGAAAGAAagtca gaaaacagaaaaatccCGGAAAAGTGTCGAGGATCTGTGTTATGGGAATC TTTCGCAAAAAGACGGTAGTACTTGGGAAACACGTTTAGTATCCGAGAAA ATATATACACTTAAGAtgtcgaaagaggagccttcgggtagCCTCCGACT GCCGTCGCAGatgttgaataaaaaaataattttaaatattttgtttatac TTTTCTTCAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACT TGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGGTAACTAATTTTT GATACCACATCATTTGTGATGTGAGAAAAAAGTGGCTGTGTTCGGGTGCG AGGCTAATTTTCACATTAAAAGATATAGATACAACAAACTATTTGAGAGG TGTGGTACCTCAGGGTTTTGCTGTGTGCAGAAAGGATCTTGGATTGGTGA ACTGAATATACCTTTCAAACCTAAAGTAATGAGAGGTTGGGTTCTATTTA TCAACAAGGTATACTGTCTGCCTTAGTGAACGCGATTTGAACAGAATGGC ATTTGACGCTATGCGATAATGCGGTTATTTTCAACGTAGTTCAATTCAAA CATCCCTATCTCAGTGACTGGAACTTTTCttcattggaacttttcttcat tggaacttttcttCCACATGAAAATGTCTATcgaagcaggggggggggta cagccgcagggtactaacccatagccgggtggtggtgtctaatttggaaa ttcaaaaaagttagtacccggtactaatttTGGGCTGGGGGTGGGTATAT CTCCAATTttaagttagtacccggtaccaATTTTAGGGTGGGGTGggtat catttcaatttttcttcaagtactCAGGCCCTGAATATGGtacatttgtt taattttttgtcttcaaattTCTGGATTTTGATGAGAAAAGATTTCCTTG TTATGGCTTACAGTATCTGACAGTATTGAAAAGTTCCCCCTTCCAATTGA AGGTACTTTCCCAAGAGGAGAATTTTATGACCACTAagttataaaaatat tgaaatagctAATGTAAAGAAAGCTATTGTTCAAAATCAGTATTGTTTTA ATTAGTGAGAAGGATAGTTCGTCTTTGATATCTCAAGTTAGAACGAGGTA TATGTTTGTCATTGCCTTCTGATGAAATGAATTACAAGCTGTTGCATCCA AAGTGATACAATCTgtcttttaaacaataaaattcttaTCCAAACTGATG ATTCTTACAGCCTGATTTTTGTTAGAGGGGTTAGTTTATTTTAGTTTATT ACAGTTTATATTATACCCTATAGCTTATTtgtgtttatatttgtttgttt gtctgatTGTTTCTTTGTTTATGACAATTAAGACGGAGGCAGGTCAACTA AGCAAAGTCAACCAGAACCAACAATGCAACTATTTTCTATTTCAACTTCT TTCATAAGATTGACacagttttgaataatttgaataaattaccaatctat tgaagaaaaaataaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCAACTTGATTTTTAC TTCTTCTGATAGATATATACTTTTATTGCCGTTATTAcagctatataata ttttacttttgccaaGGAATTTCCTTGTTTTACCTCTGTAATCAAAAGTT GTGTTCgatttaaagaacttttaagAGGATCTGAGATAAAAACATGGTAT ATACAAATCATAATAACAACAAAGAGCTGCTTTTGCTGGCTTTTGAAAGA TTGAGAANNACTAAAAGgggggtgggggtccctttttccttaagaaaaag taagtacccggtactaaaaagggggtggtggtacctaagacaatttttct tgaaaatcaggttagtaccctatgggttagtaccctgcggctGTACCCCC CCCCTGATCGAAATCCAAATAGGGAAAGATATTCCATatccaatggggat ggttttgagtGCTATTAtttccattgaatttcgaatggggatgcgTGGCT GATAACTGTATGGAAACACTTTCATTACTTCTTTGTTTTATTAAATCTTC AGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGA GTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGCCCACGGAACAAA AAGAAGTACGAACGTTGTTTGGAAGATATGTAGTGTTCAAATGTACTAGA AacaaaagttgacaaaaaaatcttttgtggtGACAGAATGGTGATGGTGA TGGTTATCATGCTTCGCGATACTTACATGATCAACAGTGGTAAAGATTAT TCCGTTGAGAATGTATAGTTTTCCGGAAATATTAAAACCAGCCAGAATCA AGCTGCGACTTTACATAGTTGATTTTCACATATTGGTCTGATAGACTAAA AGTAACAATGTCTTGTGTGCTTGGCTGAAGTAAAAGGAATTTAAAAAACA GCAAAAGACAAATACATGTTCAAATGAAATGACTAAAATGTGTATATACG GCGAGTGAAGTTCATTAtaccctaaaaatgacatttttttgtgGATtcct tttttagaatttttttaaaccttttttttatttaatgtaaaaaaattttt tctttaagaagCTTGCATTATCTTTCCTCTTCGACCGCTTTCCTTTCTGC CCAAAAGTGGAGtttattttctaatttgaaACACCctattgtgaatttat ttaaaaCGTTATAATTTAATCTAATTCTTGATTATCAAGTTGACGAGATT TAAGttcattttcaattatttttgtatcgttttccaaaagagaagaaaga ttTTTCACTGTCGCTGTTTTATGTAAAAGTTGCAGGCTTTCATATTCTAG CTGGTACAAAATACCCATAAGGGGATTGGCTTGCGTTTGTCCGAAATTCG AAAATTGTCTCTagaaagatcttcatttttggcGGGCCTTTAGAGAGAGT TTTCCTCCGAAATTGGTCGAATTTAGCCATTTTTAGGTCAATCTTTTTCG GAACTTGTTATCCTCAGAGGTTTTTAGGActcaaattttgctttttcata ttttcctttctccactaatttttagttttactttttttatgttttcatgt tttcattcatttcattACAAAATTTTATGACACACCCTTAATTCTGTACA AAGCAACTTTTTTAATGATGACGTGATGATGACGTAATCATGAAAAtatc gaattttttttatattagagTTTATGAATTATAATACGAATTCAACc

Coding sequence (CDS) from alignment at sc0000010:532504..573600+

>TCONS_00001348 ID=TCONS_00001348|Name=TCONS_00001348|organism=Clytia hemisphaerica|type=CDS|length=143310bp|location=Sequence derived from alignment at sc0000010:532504..573600+ (Clytia hemisphaerica)
atgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAG
CAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATA
GTCGTGGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCT
AAACACACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTT
CTCAGAATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACg
atgaaaataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCG
caattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATT
CCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCT
GTACTAAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGAT
TTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGT
TGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTG
GTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGAT
GATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCT
CAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCA
CCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCT
GCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTG
TAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAG
GAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAA
CCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCG
TGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAG
TGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTC
GCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGT
TGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTAT
GTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACG
GATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGA
AATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTG
CAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATG
ACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACA
GTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATG
TGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCA
CCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAA
AATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGA
AACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAA
GTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTT
CATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGG
ACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGA
AAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGC
GTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGT
TTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCA
CATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTAT
TCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCG
AAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGT
GGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTAC
AATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTT
TGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTA
CGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGA
ACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCC
CATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTT
GAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAA
AGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTG
ACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACG
TTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCA
AAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTA
TCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCA
GCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGA
AGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACC
CGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAA
TTACGTACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAAT
ACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACG
AGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAG
TCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAA
AAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCA
TGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATT
AACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGG
GTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACA
GCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAA
ATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAA
GTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACA
CATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGA
TCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTT
TCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAG
TGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCG
CATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTAC
CATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTA
GCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAG
GCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGT
ACCGTATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGT
TACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCT
TTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGA
CACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAG
AATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCT
AAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGA
GCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCA
TCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACG
GAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGG
AGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCG
CAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatccaatcc
TCATTCAACGTGGCTAAACACACTGTTgctgataaagaagaaaaacgtaa
aatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAG
TTGATTCTGAAGACgatgaaaataaagatatgGAAAAACATTTAAGTCAA
TCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAA
AGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAAC
AGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAA
TTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAA
TGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTT
TGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTA
GTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCT
GGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAG
GGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCA
CGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAAC
GAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTA
TGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaag
aaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTT
ATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAG
TTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAA
CAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGA
AAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATC
CACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTAT
GCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTA
CAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGG
CGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTG
CAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCT
TCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTG
TTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgttt
ttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGA
AGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGA
GTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCG
GCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGA
CCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATA
AAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCC
ATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAG
TTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAG
ACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTC
TTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAG
CATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTG
ACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGC
GTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCT
CTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAA
GCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAAT
CACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCAC
CAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCC
GCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTAT
ACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGT
GCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGAT
GTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAAT
CCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGT
GATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTA
TTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAG
CTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCC
TGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAtt
GTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTG
ACTGCATTCATACAATTACGTACGAAgcgaaagaagaagaaagatcACAA
ATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTC
CTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAAT
ACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTAT
CAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAAC
CGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCT
CACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGA
CAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGA
GCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAA
GAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCG
TGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATT
TTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAG
TATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCC
AATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAAT
TGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCAT
ATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGC
TGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTA
ATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCC
GTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGG
GATGGATGACAAAGTACCGTATTTGACCAATATACAGACGATGTCGGATG
ATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAAT
AAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAG
TACCACCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAAC
CAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCA
GAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGT
CATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTG
GCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTT
AATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCA
TGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACAT
CTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaa
tcactcatccaatccTCATTCAACGTGGCTAAACACACTGTTgctgataa
agaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGA
ACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaagatatgGAA
AAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGC
TAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCC
AAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAA
TTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTT
GAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGA
GTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGT
ATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAA
AACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATC
AAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCA
AAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACG
CAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGG
ATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAA
CTGGACaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGA
TACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGT
CAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAA
AACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAG
TTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACG
ACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTAC
AAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGA
GGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCT
CAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTC
CAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGG
TCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTT
TCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCA
GCAGAAaggatgtttttattgaatcCACCACCATGGTATTTGAGATCGAT
CATACAAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGA
GCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAA
TGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCT
GGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTG
TTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATT
CGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATG
CAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAA
GTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCA
GACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCA
AGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTG
ATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGAT
CATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATA
CGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTC
CTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTG
CACCGGGAAATCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAG
TGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTT
TATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGA
GCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCA
CGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGA
ACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGA
TTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATT
CATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGG
CTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAG
CCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAAT
GTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCA
GATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCT
GAAAAACTACTTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaa
gaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCA
TATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGT
GCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGA
TAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTG
ACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACG
CCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCG
AGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACA
GCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTC
TCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCAT
GAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAG
AGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTA
GAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAA
AAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTC
TTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAA
GTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGA
TAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAG
AATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGC
GGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCG
AGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAATATAC
AGACGATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTT
CAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATT
GGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCAAACA
CTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGT
AATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTG
TACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATA
TGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAG
ATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaa
aatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGT
GTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGT
GGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACA
CACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAG
AATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaa
aataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaatt
caaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTG
ATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACT
AAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGG
TGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTG
ATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTC
CGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGA
ATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTA
CCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGT
ATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATT
CCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAG
AAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTG
CCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGC
ATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATA
TTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGAT
CATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATT
GAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTA
TTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTG
GCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGA
CAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCC
AACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCT
GGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTT
GAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCT
GGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCC
AGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATG
GTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATAC
ACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACAT
AATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGA
CGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATAC
CAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGT
GCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAA
TCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAG
ATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTA
TACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCA
TCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTG
ACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtat
gAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTC
ATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGG
CTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCAC
GAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTA
CATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAG
TACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTG
ATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGG
TGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTG
ACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTT
GGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGC
TGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAG
GATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAA
ATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCAT
CTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCAT
CAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCG
GAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACG
TACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCAC
CACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCC
AGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACC
ACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACT
CCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGG
AAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAG
TGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGA
CAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGT
ATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTT
GTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGA
TGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGT
TTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAA
TGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAG
GAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCT
GAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTG
GATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTG
ATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTT
CACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGT
TCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGT
ATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAG
GAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGT
TTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTG
TAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTA
TTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTT
CTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTG
AAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGG
ACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGA
AGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAA
AACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGA
ACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatccaatccTCATT
CAACGTGGCTAAACACACTGTTgctgataaagaagaaaaacgtaaaatgt
CAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAGTTGAT
TCTGAAGACgatgaaaataaagatatgGAAAAACATTTAAGTCAATCCAT
AAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAG
TTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTG
AATATGGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAATTTGA
GAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAG
ATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTT
TACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGAT
CGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAA
TCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAA
TGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTAC
AATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTA
AAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAA
AGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaat
gttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGT
ATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAG
GGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGT
CTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAG
CACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCA
GACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTC
CAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAA
CATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATT
ATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAG
AGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAG
ACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTT
GCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttatt
gaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCA
TCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAG
GTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCAC
TGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTG
GGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGAT
TCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACC
ACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGA
GTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAAT
CGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTT
TTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATAT
CAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAA
GATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGT
ATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAA
CAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAA
GTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAA
AAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGA
TCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAG
AAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACA
GCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATC
GTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGT
AAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCA
CACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTG
ACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGG
TGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGA
ACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATA
TCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTC
CATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGC
ATTCATACAATTACGTACGAAgcgaaagaagaagaaagatcACAAATTGA
AAGTACAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCA
TCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAA
CAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAA
GTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACG
GACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGC
TTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTC
CATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAA
TCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCA
CGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGA
TTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATG
CTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATAT
TGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCC
AAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCT
TTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAA
CGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTG
TCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGAT
GAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTT
AGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGG
ATGACAAAGTACCGTATTTGACCAATATACAGACGATGTCGGATGATAAT
ATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACT
TCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCA
CCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACC
GGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACC
TGATATCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGTCATCA
ACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCA
CGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGA
AGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAA
ACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTA
AAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcact
catccaatccTCATTCAACGTGGCTAAACACACTGTTgctgataaagaag
aaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGT
GATCATACAGTTGATTCTGAAGACgatgaaaataaagatatgGAAAAACA
TTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAAC
GAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAA
GCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGAC
TACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATA
TGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAG
CAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAA
AGATAACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAA
GTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACC
AATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGA
TAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATG
TTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTA
AGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGA
CaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCA
TTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATG
ATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCG
TGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTC
AAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAA
GAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGA
TAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCA
TCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGA
TGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATC
AGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCC
GTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATA
TTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGA
AaggatgtttttattgaatcCACCACCATGGTATTTGAGATCGATCATAC
AAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCAC
GAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTAT
CTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTAC
TCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGT
TCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATT
ATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGA
AAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACG
TTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGA
TTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATT
TAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGAT
GTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCA
AGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTG
CACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAA
AAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCG
GGAAATCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAG
ATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCA
ACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAAT
GGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAAC
AAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACG
TACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGC
TGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGG
CGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGAC
ATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCC
TTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTA
AAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTC
CTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAA
ACTACTTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaagaaga
aagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCA
GACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACA
AAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAA
TGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACa
ctTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACC
TTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGA
AAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATG
TTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCA
AGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGA
ATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTG
AGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGC
ACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACT
TTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAAT
GAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGAT
TCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACT
TGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTG
GCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGA
TACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACA
ACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAATATACAGACG
ATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAAC
GAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAAC
GAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCAAACACTCTA
AAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCT
CAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACAT
ATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAA
ATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGATTCG
AGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatga
acCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAA
TGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCA
AGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTG
TTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTA
CAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataa
agatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaa
aacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGC
GATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACT
TGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAAT
ACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATG
ACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGA
AAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACA
CAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTC
TTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGG
GAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAA
AACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATC
TTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTT
GAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTGT
TTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAG
GATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTG
TGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACA
GGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAG
CTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGG
TCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGT
GTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCA
TCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCA
TTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACG
GGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATA
GTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGC
TTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTATT
TGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGCT
TGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTA
TTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATA
CTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGT
TACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCA
AACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACA
CCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATT
CGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGT
TCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAA
AAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAAT
GTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATA
TGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTG
GTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTC
AAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGA
GATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATTG
CATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCG
GGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGA
TAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCA
AATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAAC
GTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAAC
GTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCA
CCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATAC
GGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGC
CACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTA
AAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAA
GAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACG
AATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACGA
AgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCT
CAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGA
CGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAG
ATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACC
GGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACT
TTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAAC
CATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAA
TCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGG
AGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGT
TGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGT
AAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAA
TTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTG
TCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGAC
AGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATG
CATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGT
TTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGAC
ATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAG
TGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCT
TCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTG
ACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAATT
GTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGA
TGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGAT
TCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAA
TTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTG
AACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGAT
CTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAA
CATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGC
GTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCT
GCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCT
CAATAGTCGTGGTCAAGGAAttaaatcactcatccaatccTCATTCAACG
TGGCTAAACACACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGG
ACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAGTTGATTCTGA
AGACgatgaaaataaagatatgGAAAAACATTTAAGTCAATCCATAAGTT
TAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCT
GTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATAT
GGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAATTTGAGAATC
TAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTT
TGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCA
TATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTG
AAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCA
TCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGT
TGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCT
TTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCA
AAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTT
GAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttga
gtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCT
TATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGT
ACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACG
CTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTG
GCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTT
GTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATT
TCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCG
TTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTT
GGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGT
GTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATT
CAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAG
AGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatc
CACCACCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAA
CATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTC
AATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACT
GTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAAC
GACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGT
ACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTT
GTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTT
CACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATG
TTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTA
CGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCA
CCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGC
TCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAG
GTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAAT
GTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACA
ACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATA
TCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTC
ATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATG
GGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGA
TTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGAC
ATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACT
GACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCA
AGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAA
GGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTAC
TGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAG
AAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCT
GAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCC
AAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCA
TACAATTACGTACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTA
CAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACC
ACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCG
TAGAGTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCC
AAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGT
TTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGA
GAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCC
TCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTC
ACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAAC
GTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGT
GACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAAC
CAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAAC
AAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGA
GATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCA
CCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCT
TGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAA
CGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGAC
AACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAAC
GAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGAC
AAAGTACCGTATTTGACCAATATACAGACGATGTCGGATGATAATATGTA
CTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTC
GATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGAT
ACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGA
TGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATA
TCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACTTG
TTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGAC
ACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGAC
CAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTG
CCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCC
AATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatcc
aatccTCATTCAACGTGGCTAAACACACTGTTgctgataaagaagaaaaa
cgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCA
TACAGTTGATTCTGAAGACgatgaaaataaagatatgGAAAAACATTTAA
GTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAA
ATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTT
AGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGACTACTA
TCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTT
TATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGC
CTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATA
ACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTC
AAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAA
AGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTT
GTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAA
GGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAA
AGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaaga
tgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTA
AATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCA
AATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTA
TACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGAT
AGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCT
GAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAAT
ATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAA
TGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAA
CTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATG
AATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGG
CATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGAT
TAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAagga
tgtttttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGAT
TTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGA
GGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACA
AAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTA
CAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGA
CAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGC
ACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATT
CACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAA
AAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTC
AACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTG
GGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCT
TGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAA
ATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGT
AATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGA
CACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAA
TCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGT
TTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTT
GATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTT
TTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAG
ATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAA
TGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTA
TCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCT
GAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTG
GAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCT
TTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACG
CATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAA
AAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTAC
TTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaagaagaaagat
cACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCAGACCC
AGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCT
CCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGAT
ATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGC
CAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGA
AACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACA
ATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTT
CTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCA
GTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCAT
AAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCA
GCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGA
TCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATC
GGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGT
CCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTG
ACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATT
CGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTC
CACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAA
CGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGC
ATGGGGATGGATGACAAAGTACCGTATTTGACCAATATACAGACGATGTC
GGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATT
TCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAA
GACAGTACCACCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGA
AGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATG
TTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACATATGAT
GATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAG
CGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGT
CTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCAT
CTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAG
GACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAA
ttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTGTTgct
gataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATA
TTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaagata
tgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaactt
caaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGG
AACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATA
TAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAAT
GTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGT
GTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTA
CTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACAGAT
AAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTC
ATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACA
CAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAA
CTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTT
GAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAG
AGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCA
TCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTA
TGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAA
TACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGA
GGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTT
GAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAA
TCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGA
GATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGA
TTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTT
TCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTT
ATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGG
TCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTC
TTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTATTTGAGA
TCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGA
AGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGC
AAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGA
TTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACAT
TGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgT
TTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAA
AAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGG
TATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACA
ATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGg
TTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGA
TGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGA
TCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACG
GTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGA
AATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTG
CGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATTGCATCG
CGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGG
AAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACG
AGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATAT
CTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTT
GGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCA
AACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATG
CAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACC
ACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCG
GAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTG
GGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATG
CGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGT
CGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACGAAgcga
aagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCG
GATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATT
CTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTAT
CAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGC
TGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGC
CGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTG
CGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTT
AAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACG
AATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACA
TCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAAC
AGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACC
TGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGAT
ATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCG
CGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATAT
CAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTG
ATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAG
CAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCG
GAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTG
AGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAA
TATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTG
ACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTAT
AAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTC
AAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGC
TTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACAT
TATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAA
AGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATAC
GAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAG
atgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAG
CAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATA
GTCGTGGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCT
AAACACACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTT
CTCAGAATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACg
atgaaaataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCG
caattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATT
CCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCT
GTACTAAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGAT
TTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGT
TGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTG
GTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGAT
GATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCT
CAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCA
CCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCT
GCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTG
TAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAG
GAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAA
CCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCG
TGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAG
TGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTC
GCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGT
TGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTAT
GTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACG
GATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGA
AATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTG
CAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATG
ACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACA
GTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATG
TGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCA
CCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAA
AATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGA
AACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAA
GTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTT
CATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGG
ACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGA
AAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGC
GTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGT
TTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCA
CATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTAT
TCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCG
AAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGT
GGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTAC
AATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTT
TGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTA
CGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGA
ACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCC
CATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTT
GAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAA
AGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTG
ACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACG
TTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCA
AAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTA
TCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCA
GCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGA
AGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACC
CGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAA
TTACGTACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAAT
ACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACG
AGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAG
TCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAA
AAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCA
TGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATT
AACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGG
GTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACA
GCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAA
ATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAA
GTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACA
CATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGA
TCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTT
TCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAG
TGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCG
CATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTAC
CATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTA
GCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAG
GCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGT
ACCGTATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGT
TACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCT
TTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGA
CACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAG
AATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCT
AAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGA
GCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCA
TCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACG
GAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGG
AGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCG
CAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatccaatcc
TCATTCAACGTGGCTAAACACACTGTTgctgataaagaagaaaaacgtaa
aatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAG
TTGATTCTGAAGACgatgaaaataaagatatgGAAAAACATTTAAGTCAA
TCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAA
AGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAAC
AGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAA
TTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAA
TGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTT
TGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTA
GTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCT
GGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAG
GGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCA
CGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAAC
GAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTA
TGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaag
aaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTT
ATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAG
TTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAA
CAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGA
AAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATC
CACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTAT
GCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTA
CAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGG
CGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTG
CAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCT
TCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTG
TTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgttt
ttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGA
AGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGA
GTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCG
GCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGA
CCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATA
AAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCC
ATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAG
TTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAG
ACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTC
TTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAG
CATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTG
ACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGC
GTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCT
CTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAA
GCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAAT
CACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCAC
CAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCC
GCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTAT
ACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGT
GCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGAT
GTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAAT
CCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGT
GATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTA
TTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAG
CTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCC
TGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAtt
GTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTG
ACTGCATTCATACAATTACGTACGAAgcgaaagaagaagaaagatcACAA
ATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTC
CTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAAT
ACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTAT
CAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAAC
CGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCT
CACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGA
CAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGA
GCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAA
GAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCG
TGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATT
TTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAG
TATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCC
AATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAAT
TGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCAT
ATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGC
TGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTA
ATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCC
GTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGG
GATGGATGACAAAGTACCGTATTTGACCAATATACAGACGATGTCGGATG
ATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAAT
AAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAG
TACCACCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAAC
CAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCA
GAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGT
CATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTG
GCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTT
AATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCA
TGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACAT
CTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaa
tcactcatccaatccTCATTCAACGTGGCTAAACACACTGTTgctgataa
agaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGA
ACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaagatatgGAA
AAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGC
TAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCC
AAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAA
TTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTT
GAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGA
GTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGT
ATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAA
AACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATC
AAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCA
AAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACG
CAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGG
ATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAA
CTGGACaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGA
TACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGT
CAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAA
AACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAG
TTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACG
ACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTAC
AAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGA
GGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCT
CAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTC
CAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGG
TCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTT
TCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCA
GCAGAAaggatgtttttattgaatcCACCACCATGGTATTTGAGATCGAT
CATACAAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGA
GCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAA
TGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCT
GGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTG
TTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATT
CGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATG
CAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAA
GTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCA
GACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCA
AGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTG
ATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGAT
CATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATA
CGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTC
CTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTG
CACCGGGAAATCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAG
TGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTT
TATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGA
GCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCA
CGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGA
ACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGA
TTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATT
CATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGG
CTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAG
CCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAAT
GTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCA
GATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCT
GAAAAACTACTTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaa
gaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCA
TATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGT
GCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGA
TAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTG
ACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACG
CCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCG
AGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACA
GCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTC
TCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCAT
GAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAG
AGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTA
GAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAA
AAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTC
TTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAA
GTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGA
TAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAG
AATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGC
GGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCG
AGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAATATAC
AGACGATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTT
CAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATT
GGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCAAACA
CTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGT
AATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTG
TACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATA
TGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAG
ATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaa
aatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGT
GTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGT
GGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACA
CACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAG
AATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaa
aataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaatt
caaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTG
ATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACT
AAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGG
TGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTG
ATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTC
CGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGA
ATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTA
CCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGT
ATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATT
CCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAG
AAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTG
CCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGC
ATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATA
TTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGAT
CATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATT
GAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTA
TTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTG
GCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGA
CAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCC
AACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCT
GGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTT
GAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCT
GGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCC
AGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATG
GTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATAC
ACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACAT
AATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGA
CGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATAC
CAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGT
GCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAA
TCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAG
ATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTA
TACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCA
TCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTG
ACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtat
gAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTC
ATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGG
CTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCAC
GAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTA
CATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAG
TACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTG
ATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGG
TGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTG
ACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTT
GGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGC
TGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAG
GATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAA
ATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCAT
CTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCAT
CAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCG
GAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACG
TACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCAC
CACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCC
AGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACC
ACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACT
CCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGG
AAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAG
TGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGA
CAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGT
ATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTT
GTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGA
TGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGT
TTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAA
TGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAG
GAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCT
GAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTG
GATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTG
ATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTT
CACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGT
TCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGT
ATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAG
GAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGT
TTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTG
TAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTA
TTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTT
CTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTG
AAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGG
ACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGA
AGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAA
AACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGA
ACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatccaatccTCATT
CAACGTGGCTAAACACACTGTTgctgataaagaagaaaaacgtaaaatgt
CAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAGTTGAT
TCTGAAGACgatgaaaataaagatatgGAAAAACATTTAAGTCAATCCAT
AAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAG
TTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTG
AATATGGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAATTTGA
GAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAG
ATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTT
TACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGAT
CGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAA
TCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAA
TGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTAC
AATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTA
AAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAA
AGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaat
gttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGT
ATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAG
GGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGT
CTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAG
CACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCA
GACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTC
CAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAA
CATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATT
ATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAG
AGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAG
ACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTT
GCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttatt
gaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCA
TCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAG
GTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCAC
TGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTG
GGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGAT
TCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACC
ACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGA
GTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAAT
CGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTT
TTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATAT
CAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAA
GATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGT
ATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAA
CAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAA
GTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAA
AAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGA
TCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAG
AAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACA
GCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATC
GTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGT
AAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCA
CACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTG
ACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGG
TGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGA
ACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATA
TCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTC
CATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGC
ATTCATACAATTACGTACGAAgcgaaagaagaagaaagatcACAAATTGA
AAGTACAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCA
TCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAA
CAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAA
GTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACG
GACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGC
TTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTC
CATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAA
TCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCA
CGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGA
TTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATG
CTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATAT
TGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCC
AAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCT
TTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAA
CGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTG
TCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGAT
GAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTT
AGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGG
ATGACAAAGTACCGTATTTGACCAATATACAGACGATGTCGGATGATAAT
ATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACT
TCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCA
CCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACC
GGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACC
TGATATCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGTCATCA
ACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCA
CGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGA
AGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAA
ACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTA
AAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcact
catccaatccTCATTCAACGTGGCTAAACACACTGTTgctgataaagaag
aaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGT
GATCATACAGTTGATTCTGAAGACgatgaaaataaagatatgGAAAAACA
TTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAAC
GAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAA
GCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGAC
TACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATA
TGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAG
CAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAA
AGATAACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAA
GTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACC
AATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGA
TAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATG
TTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTA
AGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGA
CaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCA
TTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATG
ATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCG
TGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTC
AAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAA
GAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGA
TAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCA
TCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGA
TGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATC
AGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCC
GTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATA
TTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGA
AaggatgtttttattgaatcCACCACCATGGTATTTGAGATCGATCATAC
AAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCAC
GAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTAT
CTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTAC
TCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGT
TCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATT
ATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGA
AAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACG
TTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGA
TTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATT
TAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGAT
GTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCA
AGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTG
CACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAA
AAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCG
GGAAATCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAG
ATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCA
ACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAAT
GGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAAC
AAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACG
TACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGC
TGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGG
CGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGAC
ATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCC
TTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTA
AAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTC
CTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAA
ACTACTTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaagaaga
aagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCA
GACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACA
AAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAA
TGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACa
ctTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACC
TTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGA
AAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATG
TTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCA
AGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGA
ATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTG
AGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGC
ACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACT
TTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAAT
GAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGAT
TCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACT
TGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTG
GCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGA
TACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACA
ACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAATATACAGACG
ATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAAC
GAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAAC
GAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCAAACACTCTA
AAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCT
CAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACAT
ATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAA
ATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGATTCG
AGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatga
acCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAA
TGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCA
AGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTG
TTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTA
CAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataa
agatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaa
aacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGC
GATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACT
TGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAAT
ACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATG
ACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGA
AAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACA
CAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTC
TTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGG
GAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAA
AACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATC
TTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTT
GAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTGT
TTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAG
GATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTG
TGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACA
GGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAG
CTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGG
TCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGT
GTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCA
TCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCA
TTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACG
GGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATA
GTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGC
TTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTATT
TGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGCT
TGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTA
TTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATA
CTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGT
TACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCA
AACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACA
CCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATT
CGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGT
TCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAA
AAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAAT
GTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATA
TGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTG
GTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTC
AAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGA
GATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATTG
CATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCG
GGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGA
TAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCA
AATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAAC
GTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAAC
GTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCA
CCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATAC
GGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGC
CACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTA
AAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAA
GAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACG
AATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACGA
AgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCT
CAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGA
CGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAG
ATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACC
GGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACT
TTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAAC
CATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAA
TCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGG
AGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGT
TGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGT
AAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAA
TTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTG
TCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGAC
AGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATG
CATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGT
TTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGAC
ATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAG
TGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCT
TCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTG
ACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAATT
GTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGA
TGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGAT
TCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAA
TTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTG
AACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGAT
CTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAA
CATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGC
GTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCT
GCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCT
CAATAGTCGTGGTCAAGGAAttaaatcactcatccaatccTCATTCAACG
TGGCTAAACACACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGG
ACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAGTTGATTCTGA
AGACgatgaaaataaagatatgGAAAAACATTTAAGTCAATCCATAAGTT
TAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCT
GTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATAT
GGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAATTTGAGAATC
TAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTT
TGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCA
TATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTG
AAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCA
TCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGT
TGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCT
TTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCA
AAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTT
GAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttga
gtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCT
TATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGT
ACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACG
CTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTG
GCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTT
GTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATT
TCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCG
TTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTT
GGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGT
GTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATT
CAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAG
AGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatc
CACCACCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAA
CATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTC
AATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACT
GTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAAC
GACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGT
ACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTT
GTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTT
CACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATG
TTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTA
CGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCA
CCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGC
TCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAG
GTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAAT
GTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACA
ACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATA
TCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTC
ATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATG
GGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGA
TTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGAC
ATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACT
GACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCA
AGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAA
GGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTAC
TGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAG
AAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCT
GAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCC
AAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCA
TACAATTACGTACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTA
CAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACC
ACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCG
TAGAGTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCC
AAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGT
TTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGA
GAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCC
TCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTC
ACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAAC
GTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGT
GACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAAC
CAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAAC
AAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGA
GATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCA
CCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCT
TGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAA
CGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGAC
AACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAAC
GAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGAC
AAAGTACCGTATTTGACCAATATACAGACGATGTCGGATGATAATATGTA
CTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTC
GATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGAT
ACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGA
TGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATA
TCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACTTG
TTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGAC
ACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGAC
CAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTG
CCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCC
AATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatcc
aatccTCATTCAACGTGGCTAAACACACTGTTgctgataaagaagaaaaa
cgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCA
TACAGTTGATTCTGAAGACgatgaaaataaagatatgGAAAAACATTTAA
GTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAA
ATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTT
AGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGACTACTA
TCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTT
TATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGC
CTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATA
ACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTC
AAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAA
AGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTT
GTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAA
GGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAA
AGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaaga
tgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTA
AATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCA
AATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTA
TACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGAT
AGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCT
GAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAAT
ATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAA
TGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAA
CTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATG
AATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGG
CATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGAT
TAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAagga
tgtttttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGAT
TTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGA
GGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACA
AAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTA
CAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGA
CAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGC
ACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATT
CACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAA
AAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTC
AACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTG
GGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCT
TGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAA
ATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGT
AATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGA
CACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAA
TCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGT
TTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTT
GATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTT
TTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAG
ATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAA
TGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTA
TCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCT
GAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTG
GAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCT
TTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACG
CATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAA
AAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTAC
TTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaagaagaaagat
cACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCAGACCC
AGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCT
CCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGAT
ATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGC
CAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGA
AACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACA
ATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTT
CTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCA
GTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCAT
AAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCA
GCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGA
TCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATC
GGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGT
CCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTG
ACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATT
CGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTC
CACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAA
CGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGC
ATGGGGATGGATGACAAAGTACCGTATTTGACCAATATACAGACGATGTC
GGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATT
TCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAA
GACAGTACCACCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGA
AGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATG
TTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACATATGAT
GATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAG
CGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGT
CTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCAT
CTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAG
GACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAA
ttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTGTTgct
gataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATA
TTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaagata
tgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaactt
caaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGG
AACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATA
TAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAAT
GTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGT
GTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTA
CTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACAGAT
AAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTC
ATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACA
CAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAA
CTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTT
GAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAG
AGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCA
TCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTA
TGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAA
TACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGA
GGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTT
GAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAA
TCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGA
GATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGA
TTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTT
TCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTT
ATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGG
TCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTC
TTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTATTTGAGA
TCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGA
AGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGC
AAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGA
TTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACAT
TGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgT
TTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAA
AAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGG
TATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACA
ATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGg
TTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGA
TGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGA
TCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACG
GTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGA
AATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTG
CGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATTGCATCG
CGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGG
AAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACG
AGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATAT
CTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTT
GGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCA
AACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATG
CAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACC
ACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCG
GAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTG
GGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATG
CGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGT
CGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACGAAgcga
aagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCG
GATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATT
CTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTAT
CAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGC
TGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGC
CGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTG
CGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTT
AAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACG
AATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACA
TCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAAC
AGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACC
TGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGAT
ATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCG
CGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATAT
CAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTG
ATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAG
CAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCG
GAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTG
AGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAA
TATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTG
ACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTAT
AAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTC
AAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGC
TTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACAT
TATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAA
AGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATAC
GAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAG
atgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAG
CAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATA
GTCGTGGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCT
AAACACACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTT
CTCAGAATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACg
atgaaaataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCG
caattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATT
CCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCT
GTACTAAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGAT
TTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGT
TGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTG
GTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGAT
GATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCT
CAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCA
CCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCT
GCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTG
TAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAG
GAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAA
CCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCG
TGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAG
TGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTC
GCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGT
TGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTAT
GTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACG
GATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGA
AATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTG
CAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATG
ACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACA
GTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATG
TGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCA
CCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAA
AATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGA
AACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAA
GTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTT
CATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGG
ACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGA
AAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGC
GTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGT
TTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCA
CATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTAT
TCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCG
AAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGT
GGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTAC
AATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTT
TGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTA
CGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGA
ACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCC
CATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTT
GAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAA
AGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTG
ACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACG
TTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCA
AAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTA
TCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCA
GCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGA
AGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACC
CGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAA
TTACGTACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAAT
ACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACG
AGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAG
TCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAA
AAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCA
TGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATT
AACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGG
GTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACA
GCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAA
ATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAA
GTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACA
CATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGA
TCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTT
TCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAG
TGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCG
CATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTAC
CATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTA
GCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAG
GCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGT
ACCGTATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGT
TACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCT
TTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGA
CACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAG
AATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCT
AAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGA
GCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCA
TCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACG
GAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGG
AGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCG
CAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatccaatcc
TCATTCAACGTGGCTAAACACACTGTTgctgataaagaagaaaaacgtaa
aatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAG
TTGATTCTGAAGACgatgaaaataaagatatgGAAAAACATTTAAGTCAA
TCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAA
AGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAAC
AGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAA
TTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAA
TGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTT
TGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTA
GTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCT
GGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAG
GGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCA
CGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAAC
GAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTA
TGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaag
aaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTT
ATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAG
TTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAA
CAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGA
AAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATC
CACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTAT
GCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTA
CAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGG
CGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTG
CAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCT
TCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTG
TTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgttt
ttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGA
AGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGA
GTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCG
GCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGA
CCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATA
AAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCC
ATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAG
TTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAG
ACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTC
TTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAG
CATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTG
ACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGC
GTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCT
CTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAA
GCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAAT
CACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCAC
CAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCC
GCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTAT
ACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGT
GCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGAT
GTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAAT
CCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGT
GATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTA
TTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAG
CTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCC
TGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAtt
GTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTG
ACTGCATTCATACAATTACGTACGAAgcgaaagaagaagaaagatcACAA
ATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTC
CTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAAT
ACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTAT
CAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAAC
CGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCT
CACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGA
CAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGA
GCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAA
GAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCG
TGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATT
TTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAG
TATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCC
AATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAAT
TGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCAT
ATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGC
TGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTA
ATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCC
GTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGG
GATGGATGACAAAGTACCGTATTTGACCAATATACAGACGATGTCGGATG
ATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAAT
AAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAG
TACCACCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAAC
CAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCA
GAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGT
CATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTG
GCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTT
AATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCA
TGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACAT
CTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaa
tcactcatccaatccTCATTCAACGTGGCTAAACACACTGTTgctgataa
agaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGA
ACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaagatatgGAA
AAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGC
TAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCC
AAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAA
TTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTT
GAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGA
GTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGT
ATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAA
AACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATC
AAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCA
AAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACG
CAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGG
ATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAA
CTGGACaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGA
TACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGT
CAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAA
AACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAG
TTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACG
ACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTAC
AAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGA
GGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCT
CAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTC
CAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGG
TCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTT
TCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCA
GCAGAAaggatgtttttattgaatcCACCACCATGGTATTTGAGATCGAT
CATACAAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGA
GCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAA
TGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCT
GGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTG
TTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATT
CGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATG
CAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAA
GTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCA
GACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCA
AGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTG
ATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGAT
CATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATA
CGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTC
CTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTG
CACCGGGAAATCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAG
TGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTT
TATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGA
GCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCA
CGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGA
ACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGA
TTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATT
CATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGG
CTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAG
CCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAAT
GTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCA
GATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCT
GAAAAACTACTTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaa
gaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCA
TATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGT
GCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGA
TAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTG
ACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACG
CCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCG
AGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACA
GCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTC
TCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCAT
GAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAG
AGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTA
GAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAA
AAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTC
TTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAA
GTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGA
TAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAG
AATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGC
GGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCG
AGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAATATAC
AGACGATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTT
CAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATT
GGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCAAACA
CTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGT
AATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTG
TACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATA
TGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAG
ATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaa
aatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGT
GTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGT
GGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACA
CACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAG
AATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaa
aataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaatt
caaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTG
ATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACT
AAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGG
TGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTG
ATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTC
CGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGA
ATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTA
CCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGT
ATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATT
CCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAG
AAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTG
CCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGC
ATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATA
TTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGAT
CATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATT
GAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTA
TTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTG
GCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGA
CAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCC
AACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCT
GGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTT
GAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCT
GGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCC
AGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATG
GTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATAC
ACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACAT
AATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGA
CGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATAC
CAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGT
GCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAA
TCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAG
ATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTA
TACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCA
TCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTG
ACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtat
gAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTC
ATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGG
CTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCAC
GAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTA
CATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAG
TACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTG
ATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGG
TGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTG
ACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTT
GGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGC
TGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAG
GATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAA
ATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCAT
CTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCAT
CAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCG
GAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACG
TACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCAC
CACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCC
AGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACC
ACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACT
CCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGG
AAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAG
TGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGA
CAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGT
ATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTT
GTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGA
TGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGT
TTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAA
TGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAG
GAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCT
GAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTG
GATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTG
ATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTT
CACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGT
TCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGT
ATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAG
GAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGT
TTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTG
TAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTA
TTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTT
CTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTG
AAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGG
ACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGA
AGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAA
AACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGA
ACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatccaatccTCATT
CAACGTGGCTAAACACACTGTTgctgataaagaagaaaaacgtaaaatgt
CAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAGTTGAT
TCTGAAGACgatgaaaataaagatatgGAAAAACATTTAAGTCAATCCAT
AAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAG
TTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTG
AATATGGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAATTTGA
GAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAG
ATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTT
TACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGAT
CGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAA
TCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAA
TGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTAC
AATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTA
AAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAA
AGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaat
gttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGT
ATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAG
GGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGT
CTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAG
CACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCA
GACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTC
CAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAA
CATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATT
ATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAG
AGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAG
ACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTT
GCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttatt
gaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCA
TCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAG
GTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCAC
TGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTG
GGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGAT
TCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACC
ACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGA
GTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAAT
CGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTT
TTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATAT
CAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAA
GATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGT
ATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAA
CAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAA
GTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAA
AAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGA
TCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAG
AAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACA
GCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATC
GTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGT
AAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCA
CACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTG
ACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGG
TGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGA
ACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATA
TCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTC
CATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGC
ATTCATACAATTACGTACGAAgcgaaagaagaagaaagatcACAAATTGA
AAGTACAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCA
TCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAA
CAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAA
GTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACG
GACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGC
TTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTC
CATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAA
TCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCA
CGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGA
TTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATG
CTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATAT
TGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCC
AAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCT
TTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAA
CGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTG
TCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGAT
GAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTT
AGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGG
ATGACAAAGTACCGTATTTGACCAATATACAGACGATGTCGGATGATAAT
ATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACT
TCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCA
CCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACC
GGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACC
TGATATCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGTCATCA
ACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCA
CGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGA
AGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAA
ACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTA
AAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcact
catccaatccTCATTCAACGTGGCTAAACACACTGTTgctgataaagaag
aaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGT
GATCATACAGTTGATTCTGAAGACgatgaaaataaagatatgGAAAAACA
TTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAAC
GAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAA
GCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGAC
TACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATA
TGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAG
CAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAA
AGATAACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAA
GTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACC
AATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGA
TAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATG
TTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTA
AGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGA
CaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCA
TTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATG
ATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCG
TGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTC
AAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAA
GAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGA
TAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCA
TCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGA
TGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATC
AGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCC
GTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATA
TTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGA
AaggatgtttttattgaatcCACCACCATGGTATTTGAGATCGATCATAC
AAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCAC
GAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTAT
CTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTAC
TCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGT
TCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATT
ATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGA
AAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACG
TTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGA
TTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATT
TAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGAT
GTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCA
AGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTG
CACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAA
AAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCG
GGAAATCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAG
ATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCA
ACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAAT
GGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAAC
AAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACG
TACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGC
TGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGG
CGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGAC
ATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCC
TTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTA
AAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTC
CTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAA
ACTACTTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaagaaga
aagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCA
GACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACA
AAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAA
TGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACa
ctTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACC
TTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGA
AAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATG
TTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCA
AGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGA
ATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTG
AGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGC
ACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACT
TTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAAT
GAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGAT
TCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACT
TGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTG
GCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGA
TACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACA
ACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAATATACAGACG
ATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAAC
GAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAAC
GAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCAAACACTCTA
AAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCT
CAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACAT
ATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAA
ATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGATTCG
AGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatga
acCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAA
TGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCA
AGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTG
TTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTA
CAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataa
agatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaa
aacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGC
GATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACT
TGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAAT
ACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATG
ACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGA
AAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACA
CAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTC
TTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGG
GAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAA
AACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATC
TTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTT
GAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTGT
TTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAG
GATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTG
TGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACA
GGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAG
CTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGG
TCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGT
GTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCA
TCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCA
TTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACG
GGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATA
GTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGC
TTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTATT
TGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGCT
TGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTA
TTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATA
CTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGT
TACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCA
AACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACA
CCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATT
CGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGT
TCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAA
AAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAAT
GTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATA
TGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTG
GTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTC
AAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGA
GATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATTG
CATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCG
GGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGA
TAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCA
AATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAAC
GTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAAC
GTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCA
CCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATAC
GGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGC
CACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTA
AAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAA
GAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACG
AATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACGA
AgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCT
CAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGA
CGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAG
ATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACC
GGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACT
TTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAAC
CATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAA
TCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGG
AGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGT
TGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGT
AAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAA
TTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTG
TCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGAC
AGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATG
CATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGT
TTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGAC
ATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAG
TGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCT
TCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTG
ACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAATT
GTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGA
TGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGAT
TCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAA
TTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTG
AACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGAT
CTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAA
CATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGC
GTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCT
GCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCT
CAATAGTCGTGGTCAAGGAAttaaatcactcatccaatccTCATTCAACG
TGGCTAAACACACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGG
ACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAGTTGATTCTGA
AGACgatgaaaataaagatatgGAAAAACATTTAAGTCAATCCATAAGTT
TAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCT
GTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATAT
GGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAATTTGAGAATC
TAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTT
TGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCA
TATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTG
AAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCA
TCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGT
TGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCT
TTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCA
AAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTT
GAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttga
gtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCT
TATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGT
ACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACG
CTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTG
GCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTT
GTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATT
TCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCG
TTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTT
GGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGT
GTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATT
CAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAG
AGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatc
CACCACCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAA
CATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTC
AATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACT
GTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAAC
GACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGT
ACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTT
GTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTT
CACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATG
TTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTA
CGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCA
CCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGC
TCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAG
GTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAAT
GTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACA
ACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATA
TCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTC
ATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATG
GGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGA
TTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGAC
ATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACT
GACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCA
AGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAA
GGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTAC
TGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAG
AAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCT
GAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCC
AAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCA
TACAATTACGTACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTA
CAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACC
ACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCG
TAGAGTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCC
AAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGT
TTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGA
GAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCC
TCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTC
ACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAAC
GTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGT
GACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAAC
CAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAAC
AAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGA
GATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCA
CCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCT
TGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAA
CGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGAC
AACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAAC
GAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGAC
AAAGTACCGTATTTGACCAATATACAGACGATGTCGGATGATAATATGTA
CTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTC
GATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGAT
ACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGA
TGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATA
TCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACTTG
TTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGAC
ACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGAC
CAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTG
CCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCC
AATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatcc
aatccTCATTCAACGTGGCTAAACACACTGTTgctgataaagaagaaaaa
cgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCA
TACAGTTGATTCTGAAGACgatgaaaataaagatatgGAAAAACATTTAA
GTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAA
ATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTT
AGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGACTACTA
TCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTT
TATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGC
CTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATA
ACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTC
AAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAA
AGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTT
GTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAA
GGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAA
AGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaaga
tgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTA
AATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCA
AATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTA
TACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGAT
AGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCT
GAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAAT
ATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAA
TGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAA
CTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATG
AATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGG
CATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGAT
TAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAagga
tgtttttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGAT
TTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGA
GGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACA
AAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTA
CAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGA
CAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGC
ACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATT
CACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAA
AAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTC
AACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTG
GGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCT
TGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAA
ATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGT
AATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGA
CACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAA
TCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGT
TTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTT
GATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTT
TTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAG
ATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAA
TGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTA
TCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCT
GAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTG
GAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCT
TTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACG
CATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAA
AAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTAC
TTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaagaagaaagat
cACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCAGACCC
AGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCT
CCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGAT
ATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGC
CAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGA
AACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACA
ATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTT
CTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCA
GTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCAT
AAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCA
GCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGA
TCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATC
GGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGT
CCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTG
ACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATT
CGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTC
CACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAA
CGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGC
ATGGGGATGGATGACAAAGTACCGTATTTGACCAATATACAGACGATGTC
GGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATT
TCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAA
GACAGTACCACCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGA
AGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATG
TTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACATATGAT
GATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAG
CGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGT
CTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCAT
CTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAG
GACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAA
ttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACTGTTgct
gataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATA
TTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaagata
tgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaactt
caaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGG
AACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATA
TAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAAT
GTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGT
GTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTA
CTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACAGAT
AAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTC
ATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACA
CAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAA
CTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTT
GAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAG
AGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCA
TCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTA
TGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAA
TACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGA
GGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTT
GAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAA
TCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGA
GATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGA
TTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTT
TCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTT
ATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGG
TCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTC
TTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTATTTGAGA
TCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGA
AGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGC
AAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGA
TTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACAT
TGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgT
TTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAA
AAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGG
TATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACA
ATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGg
TTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGA
TGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGA
TCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACG
GTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGA
AATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTG
CGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATTGCATCG
CGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGG
AAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACG
AGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATAT
CTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTT
GGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCA
AACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATG
CAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACC
ACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCG
GAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTG
GGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATG
CGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGT
CGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACGAAgcga
aagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCG
GATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATT
CTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTAT
CAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGC
TGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGC
CGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTG
CGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTT
AAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACG
AATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACA
TCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAAC
AGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACC
TGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGAT
ATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCG
CGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATAT
CAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTG
ATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAG
CAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCG
GAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTG
AGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAA
TATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTG
ACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTAT
AAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTC
AAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGC
TTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACAT
TATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAA
AGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATAC
GAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAG
atgaaaatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAG
CAAGTGTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATA
GTCGTGGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCT
AAACACACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTT
CTCAGAATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACg
atgaaaataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCG
caattcaaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATT
CCCTGATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCT
GTACTAAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGAT
TTTGGTGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGT
TGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTG
GTGTCCGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGAT
GATGAATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCT
CAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCA
CCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCT
GCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTG
TAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAG
GAGTGCCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAA
CCAGCATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCG
TGATATTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAG
TGGATCATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTC
GCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGT
TGTTATTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTAT
GTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACG
GATGACAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGA
AATCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTG
CAGCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATG
ACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACA
GTTCTGGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATG
TGTCCAGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCA
CCATGGTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAA
AATACACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGA
AACATAATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAA
GTTGACGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTT
CATACCAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGG
ACAGTGCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGA
AAAAATCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGC
GTCAGATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGT
TTCTATACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCA
CATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTAT
TCTTGACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCG
AAtatgAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGT
GGTTCATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTAC
AATGGCTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTT
TGCACGAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTA
CGTTACATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGA
ACAAGTACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCC
CATTGATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTT
GAAGGTGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAA
AGGTGACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTG
ACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACG
TTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCA
AAGAGGATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTA
TCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCA
GCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGA
AGCATCAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACC
CGGCGGAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAA
TTACGTACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAAT
ACCACCACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACG
AGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAG
TCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAA
AAACTCCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCA
TGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATT
AACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGG
GTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACA
GCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAA
ATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAA
GTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACA
CATGTTTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGA
TCTAATGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTT
TCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAG
TGGCTGAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCG
CATTGGATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTAC
CATTGATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTA
GCGTTCACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAG
GCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGT
ACCGTATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGT
TACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCT
TTGGTTTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGA
CACTGTAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAG
AATTATTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCT
AAGTTCTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGA
GCTTGAAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCA
TCTGGACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACG
GAAGAAGTGCGTTAGatgaaaatgaacCATCTTCATGAAAACTTGCCCGG
AGTAAAACCTGCAAGCAAGTGTAAATGTAGGACATCTTTAAAGCCAATCG
CAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaatcactcatccaatcc
TCATTCAACGTGGCTAAACACACTGTTgctgataaagaagaaaaacgtaa
aatgtCAAGGACTTTCTCAGAATTACAATATTTGAACGGTGATCATACAG
TTGATTCTGAAGACgatgaaaataaagatatgGAAAAACATTTAAGTCAA
TCCATAAGTTTAGCGcaattcaaaaaacttcaaGCTAAACGAAAAATCAA
AGTAGTTGCTGTATTCCCTGATTGCGATGGAACCCAAAAAGCTTTAGAAC
AGTTGAATATGGTCTGTACTAAACTTGATATAGAATTGACTACTATCAAA
TTTGAGAATCTAGATTTTGGTGAATACAATGTTTTGAATATGTTTTATAA
TGCAGATGTTTGTGTTGTTGATATGACAGTGTTGAGTGAGCAAGCCTCTT
TGTTTTACCATATTGGTGTCCGAGAAAGTACTGGTATGAAAGATAACGTA
GTGATCGTTGAAGATGATGAATACACAGATAAGAAAACAAGTGTCAAGCT
GGCAATCTCATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAG
GGAAATGTGTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCA
CGTACAATCTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAAC
GAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTA
TGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAACTGGACaagatgaag
aaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTAAATTT
ATTGTATTCTTATCGTGATATTCAGGATTATGAGTCAATGATTCAAATAG
TTGAGGGTGTACCAGTGGATCATTGTGAAATACAAAACCGTGCTATACAA
CAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAGTTGTCAAGATAGAGA
AAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACGACAAAGAGCTGAATC
CACCAGACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTAT
GCTTCCAATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGTA
CAAAACATCGTTTGAAATCCAACCATCAGATTTCTCAGGATGCAACTTGG
CGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTCCAATCAGATGAATTG
CAAAGAGTGTGTATGACGTTGAACGGGCTTATTGGTCGCCGTGGGCATCT
TCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGATTAGTG
TTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAaggatgttt
ttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGATTTGGA
AGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGGAGGAGA
GTGAGGTTTCAATGAAACATAATTATTGGCAAGAATGTATCTACAAAGCG
GCCACTGACTGTGAAGTTGACGATACTCGATTTCTGGTACTCTTACAAGA
CCCTGGGAACGACTTCATACCAAGTTACATTGTTGTTGGTTCGGACAATA
AAGATTCTGTACCGGACAGTGCTCAAACgTTTATTCGATTATGGCACGCC
ATACCACCTTGTGGAAAAAATCACACCGAAAAATGCAAGAAAATTCACAG
TTGGAGTTTTCACGCGTCAGATATTCGGGGTATAAGTACGTTTAAAAAAG
ACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTTCAACTC
TTCTTTTGTACGCCACATCATCGAAAAAGgTTTCAAGATTTAGTGGGCAG
CATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATGTTCTTGTTG
ACCAAGATGCTCTCGAAtatgAATATGAGATCGATCATCAAGGAAATCGC
GTGGTATTAGGTCGTGGTTCATTTGGTACGGTATACGCTGCACGTAATCT
CTCAACAAATGTTACAATGGCTGTCAAAGAAATTCCTGAAAAAGACACAA
GCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATCAAT
CACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTTCAC
CAAGATCTTCATGGAACAAGTACCGGGAGGAAGTTTATCAACGTTGATCC
GCGAGAAATGGGGCCCATTGATCGATAACGAGGGAGCAATGGCTTTTTAT
ACACAGCAGATTGTTGAAGGTGTCAAATATCTGCACGAACAAAAGATCGT
GCATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGAT
GTTGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAAT
CCTCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGT
GATTGACCAAGGTCAAAGAGGATACGGACCACCGGCTGACATCTGGAGTA
TTGGGTGTACTGTTATCGAAATGGCCACCGGAAAGCCCCCTTTCTTTGAG
CTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCC
TGATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAtt
GTTTCCATCCAAACCCGGCGGAACGAATGTCGTCTGAAAAACTACTTCTG
ACTGCATTCATACAATTACGTACGAAgcgaaagaagaagaaagatcACAA
ATTGAAAGTACAAATACCACCACCTCAGCGGATCATATCAGACCCAGGTC
CTTCATCACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAAT
ACGAACAGCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTAT
CAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTGACACactTGCCAAAC
CGACGGACGTTTTCATGAGGAAACTTTCGCCGACGCCACCTTTGAAACCT
CACGCTTCGAGAATTAACAGTGAACCATTGCGGCGAGTGAAAACAATGGA
CAGTCCATCCTCAGGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGA
GCCAATCGTCACACAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAA
GAGCACGAACGTAAAATGTTGTTGTTGACATCCATGAAGAATCATAAGCG
TGAGATTTGTGACAAGTGGATGAGTAAAACAGAAGAGCTGAGTCAGCATT
TTATGCTAACCAACACATGTTTTAATTACCTGTTAGAAGCACTGATCGAG
TATATTGAACAAGGATCTAATGTTGTCGATATCAAAAACTTTATCGGCCC
AATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTCTTAATGAAGTCCAAT
TGGCTTTTCACCTAGTGGCTGAATGCATATCAGAAGTGATTCGTGACCAT
ATGAACGTCTTGCCGCATTGGATGTTTTTGATCGATAACTTGATTCGTGC
TGCTGTCAAACGTACCATTGATGACATCAGCAAAGAATTGGCTTCCACTA
ATGATGAGACAACTAGCGTTCACAGTGGCGGAGGCGGTGATACAACGCCC
GTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCGAGACAACAGCATGGG
GATGGATGACAAAGTACCGTATTTGACCAATATACAGACGATGTCGGATG
ATAATATGTACTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAAT
AAACTTCTTCGATCTTTGGTTTTGATGTATAAATTGGAACGAAAAGACAG
TACCACCGATACTGACACTGTAGATTCCTCAAACACTCTAAAAGAAGAAC
CAACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCA
GAACCTGATATCGCTAAGTTCTGTGAACATTATTGTACATATGATGATGT
CATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGCGTTG
GCCCACGGACACGCATCTGGACGAACATACGAAAGATTCGAGAGTCTGTT
AATGAAGGACCAACGGAAGAAGTGCGTTAGatgaaaatgaacCATCTTCA
TGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAAATGTAGGACAT
CTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTCAAGGAAttaaa
tcactcatccaatccTCATTCAACGTGGCTAAACACACTGTTgctgataa
agaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATTACAATATTTGA
ACGGTGATCATACAGTTGATTCTGAAGACgatgaaaataaagatatgGAA
AAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaaaaacttcaaGC
TAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTGCGATGGAACCC
AAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAACTTGATATAGAA
TTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAATACAATGTTTT
GAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATATGACAGTGTTGA
GTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAGAAAGTACTGGT
ATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATACACAGATAAGAA
AACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTTCTTTTCATATC
AAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGGGGAACACAGCA
AAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTAAAACAACTACG
CAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAATCTTTTTGAGGG
ATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTTTGAAAGAGGAA
CTGGACaagatgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGA
TACCATTTTAAATTTATTGTATTCTTATCGTGATATTCAGGATTATGAGT
CAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAA
AACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGAGAGGCAG
TTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAAGCTTTTGAACG
ACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTGGTCGAATCTAC
AAGGATAAATATTATGCTTCCAATTTCACGGATGACAAGTGTCGAGATGA
GGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACCATCAGATTTCT
CAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTCATTCTTTCCTC
CAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAACGGGCTTATTGG
TCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTT
TCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCA
GCAGAAaggatgtttttattgaatcCACCACCATGGTATTTGAGATCGAT
CATACAAGATTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGA
GCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATTATTGGCAAGAA
TGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGATACTCGATTTCT
GGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAGTTACATTGTTG
TTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTCAAACgTTTATT
CGATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATG
CAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATATTCGGGGTATAA
GTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCA
GACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGAAAAAGgTTTCA
AGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTG
ATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAATATGAGATCGAT
CATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTGGTACGGTATA
CGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTCAAAGAAATTC
CTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTG
CACCGGGAAATCAATCACAAAAATATCGTACGTTACATTGCATCGCGTAG
TGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACCGGGAGGAAGTT
TATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCGATAACGAGGGA
GCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTCAAATATCTGCA
CGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAACGTGTTGGTGA
ACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAACGTCCAAACGA
TTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGCACCATGCAATT
CATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATACGGACCACCGG
CTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCACCGGAAAG
CCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTTAAAGTGGGAAT
GTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGAAGAATGCGTCA
GATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAACGAATGTCGTCT
GAAAAACTACTTCTGACTGCATTCATACAATTACGTACGAAgcgaaagaa
gaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGATCA
TATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTGACGATTCTGGT
GCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTAGATTATCAAGA
TAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCACCGGTGCTGGTG
ACACactTGCCAAACCGACGGACGTTTTCATGAGGAAACTTTCGCCGACG
CCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAACCATTGCGGCG
AGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGAATCTTTAAACA
GCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAGGAGACGAATTC
TCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTGTTGACATCCAT
GAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAGTAAAACAGAAG
AGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACCTGTTA
GAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGATATCAA
AAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCGTTC
TTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCATATCAGAA
GTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGATCGA
TAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGCAAAG
AATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACAGTGGCGGAGGC
GGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGCTTCCTGAGTCG
AGACAACAGCATGGGGATGGATGACAAAGTACCGTATTTGACCAATATAC
AGACGATGTCGGATGATAATATGTACTTGTTACAGGAATTGTCTGACCTT
CAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTGATGTATAAATT
GGAACGAAAAGACAGTACCACCGATACTGACACTGTAGATTCCTCAAACA
CTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGAATTGGCTTCGT
AATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGTGAACATTATTG
TACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGATCTCAAAGATA
TGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAG
ATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGatgaa
aatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGT
GTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGT
GGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACA
CACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAG
AATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaa
aataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaatt
caaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTG
ATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACT
AAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGG
TGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTG
ATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTC
CGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGA
ATACACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTA
CCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGT
ATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATT
CCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAG
AAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTG
CCTTTGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGC
ATTGTTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATA
TTCAGGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGAT
CATTGTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATT
GAACAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTA
TTAAGCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTG
GCTGGTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGA
CAAGTGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCC
AACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCT
GGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTT
GAACGGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCT
GGATAGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCC
AGAGCTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATG
GTATTTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATAC
ACGCTTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACAT
AATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGA
CGATACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATAC
CAAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGT
GCTCAAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAA
TCACACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAG
ATATTCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTA
TACGTTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCA
TCGAAAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTG
ACAATGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtat
gAATATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTC
ATTTGGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGG
CTGTCAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCAC
GAGGAGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTA
CATTGCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAG
TACCGGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTG
ATCGATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGG
TGTCAAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTG
ACAACGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTT
GGAACGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGC
TGGCACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAG
GATACGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAA
ATGGCCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCAT
CTTTAAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCAT
CAGAAGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCG
GAACGAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACG
TACGAAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCAC
CACCTCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCC
AGTGACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACC
ACTAGATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACT
CCACCGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGG
AAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAG
TGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGA
CAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGT
ATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTT
GTTGTTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGA
TGAGTAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGT
TTTAATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAA
TGTTGTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAG
GAGACAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCT
GAATGCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTG
GATGTTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTG
ATGACATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTT
CACAGTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGT
TCGCTTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGT
ATTTGACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAG
GAATTGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGT
TTTGATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTG
TAGATTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTA
TTGAATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTT
CTGTGAACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTG
AAGATCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGG
ACGAACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGA
AGTGCGTTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000727XLOC_000727Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001348-exon-sc0000010-1491911889:532504..532543TCONS_00001348-exon-sc0000010-1491911889:532504..532543Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:532504..532543TCONS_00001348-exon-sc0000010-1510915933:532504..532543Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:532504..532543TCONS_00001348-exon-sc0000010-1575043694:532504..532543Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:532992..533724TCONS_00001348-exon-sc0000010-1491911889:532992..533724Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:532992..533724TCONS_00001348-exon-sc0000010-1510915933:532992..533724Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:532992..533724TCONS_00001348-exon-sc0000010-1575043694:532992..533724Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:534037..534270TCONS_00001348-exon-sc0000010-1491911889:534037..534270Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:534037..534270TCONS_00001348-exon-sc0000010-1510915933:534037..534270Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:534037..534270TCONS_00001348-exon-sc0000010-1575043694:534037..534270Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:534484..534576TCONS_00001348-exon-sc0000010-1491911889:534484..534576Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:534484..534576TCONS_00001348-exon-sc0000010-1510915933:534484..534576Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:534484..534576TCONS_00001348-exon-sc0000010-1575043694:534484..534576Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:535387..535487TCONS_00001348-exon-sc0000010-1491911889:535387..535487Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:535387..535487TCONS_00001348-exon-sc0000010-1510915933:535387..535487Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:535387..535487TCONS_00001348-exon-sc0000010-1575043694:535387..535487Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:535908..535956TCONS_00001348-exon-sc0000010-1491911889:535908..535956Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:535908..535956TCONS_00001348-exon-sc0000010-1510915933:535908..535956Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:535908..535956TCONS_00001348-exon-sc0000010-1575043694:535908..535956Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:536616..536737TCONS_00001348-exon-sc0000010-1491911889:536616..536737Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:536616..536737TCONS_00001348-exon-sc0000010-1510915933:536616..536737Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:536616..536737TCONS_00001348-exon-sc0000010-1575043694:536616..536737Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:537077..537189TCONS_00001348-exon-sc0000010-1491911889:537077..537189Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:537077..537189TCONS_00001348-exon-sc0000010-1510915933:537077..537189Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:537077..537189TCONS_00001348-exon-sc0000010-1575043694:537077..537189Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:537813..538057TCONS_00001348-exon-sc0000010-1491911889:537813..538057Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:537813..538057TCONS_00001348-exon-sc0000010-1510915933:537813..538057Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:537813..538057TCONS_00001348-exon-sc0000010-1575043694:537813..538057Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:538582..538662TCONS_00001348-exon-sc0000010-1491911889:538582..538662Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:538582..538662TCONS_00001348-exon-sc0000010-1510915933:538582..538662Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:538582..538662TCONS_00001348-exon-sc0000010-1575043694:538582..538662Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:539062..539154TCONS_00001348-exon-sc0000010-1491911889:539062..539154Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:539062..539154TCONS_00001348-exon-sc0000010-1510915933:539062..539154Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:539062..539154TCONS_00001348-exon-sc0000010-1575043694:539062..539154Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:540040..540099TCONS_00001348-exon-sc0000010-1491911889:540040..540099Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:540040..540099TCONS_00001348-exon-sc0000010-1510915933:540040..540099Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:540040..540099TCONS_00001348-exon-sc0000010-1575043694:540040..540099Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:540265..540311TCONS_00001348-exon-sc0000010-1491911889:540265..540311Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:540265..540311TCONS_00001348-exon-sc0000010-1510915933:540265..540311Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:540265..540311TCONS_00001348-exon-sc0000010-1575043694:540265..540311Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:540939..541031TCONS_00001348-exon-sc0000010-1491911889:540939..541031Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:540939..541031TCONS_00001348-exon-sc0000010-1510915933:540939..541031Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:540939..541031TCONS_00001348-exon-sc0000010-1575043694:540939..541031Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:541435..541522TCONS_00001348-exon-sc0000010-1491911889:541435..541522Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:541435..541522TCONS_00001348-exon-sc0000010-1510915933:541435..541522Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:541435..541522TCONS_00001348-exon-sc0000010-1575043694:541435..541522Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:541839..541972TCONS_00001348-exon-sc0000010-1491911889:541839..541972Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:541839..541972TCONS_00001348-exon-sc0000010-1510915933:541839..541972Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:541839..541972TCONS_00001348-exon-sc0000010-1575043694:541839..541972Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:543251..543378TCONS_00001348-exon-sc0000010-1491911889:543251..543378Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:543251..543378TCONS_00001348-exon-sc0000010-1510915933:543251..543378Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:543251..543378TCONS_00001348-exon-sc0000010-1575043694:543251..543378Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:543703..543806TCONS_00001348-exon-sc0000010-1491911889:543703..543806Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:543703..543806TCONS_00001348-exon-sc0000010-1510915933:543703..543806Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:543703..543806TCONS_00001348-exon-sc0000010-1575043694:543703..543806Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:544278..544478TCONS_00001348-exon-sc0000010-1491911889:544278..544478Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:544278..544478TCONS_00001348-exon-sc0000010-1510915933:544278..544478Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:544278..544478TCONS_00001348-exon-sc0000010-1575043694:544278..544478Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:545053..545118TCONS_00001348-exon-sc0000010-1491911889:545053..545118Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:545053..545118TCONS_00001348-exon-sc0000010-1510915933:545053..545118Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:545053..545118TCONS_00001348-exon-sc0000010-1575043694:545053..545118Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:545395..545492TCONS_00001348-exon-sc0000010-1491911889:545395..545492Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:545395..545492TCONS_00001348-exon-sc0000010-1510915933:545395..545492Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:545395..545492TCONS_00001348-exon-sc0000010-1575043694:545395..545492Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:546763..546831TCONS_00001348-exon-sc0000010-1491911889:546763..546831Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:546763..546831TCONS_00001348-exon-sc0000010-1510915933:546763..546831Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:546763..546831TCONS_00001348-exon-sc0000010-1575043694:546763..546831Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:547082..547155TCONS_00001348-exon-sc0000010-1491911889:547082..547155Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:547082..547155TCONS_00001348-exon-sc0000010-1510915933:547082..547155Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:547082..547155TCONS_00001348-exon-sc0000010-1575043694:547082..547155Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:547831..547978TCONS_00001348-exon-sc0000010-1491911889:547831..547978Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:547831..547978TCONS_00001348-exon-sc0000010-1510915933:547831..547978Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:547831..547978TCONS_00001348-exon-sc0000010-1575043694:547831..547978Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:548821..548901TCONS_00001348-exon-sc0000010-1491911889:548821..548901Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:548821..548901TCONS_00001348-exon-sc0000010-1510915933:548821..548901Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:548821..548901TCONS_00001348-exon-sc0000010-1575043694:548821..548901Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:549804..549987TCONS_00001348-exon-sc0000010-1491911889:549804..549987Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:549804..549987TCONS_00001348-exon-sc0000010-1510915933:549804..549987Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:549804..549987TCONS_00001348-exon-sc0000010-1575043694:549804..549987Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:550521..550662TCONS_00001348-exon-sc0000010-1491911889:550521..550662Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:550521..550662TCONS_00001348-exon-sc0000010-1510915933:550521..550662Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:550521..550662TCONS_00001348-exon-sc0000010-1575043694:550521..550662Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:561011..561090TCONS_00001348-exon-sc0000010-1491911889:561011..561090Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:561011..561090TCONS_00001348-exon-sc0000010-1510915933:561011..561090Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:561011..561090TCONS_00001348-exon-sc0000010-1575043694:561011..561090Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:561792..561900TCONS_00001348-exon-sc0000010-1491911889:561792..561900Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:561792..561900TCONS_00001348-exon-sc0000010-1510915933:561792..561900Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:561792..561900TCONS_00001348-exon-sc0000010-1575043694:561792..561900Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:565908..566082TCONS_00001348-exon-sc0000010-1491911889:565908..566082Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:565908..566082TCONS_00001348-exon-sc0000010-1510915933:565908..566082Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:565908..566082TCONS_00001348-exon-sc0000010-1575043694:565908..566082Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:568052..568123TCONS_00001348-exon-sc0000010-1491911889:568052..568123Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:568052..568123TCONS_00001348-exon-sc0000010-1510915933:568052..568123Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:568052..568123TCONS_00001348-exon-sc0000010-1575043694:568052..568123Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:569205..569266TCONS_00001348-exon-sc0000010-1491911889:569205..569266Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:569205..569266TCONS_00001348-exon-sc0000010-1510915933:569205..569266Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:569205..569266TCONS_00001348-exon-sc0000010-1575043694:569205..569266Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:569990..570063TCONS_00001348-exon-sc0000010-1491911889:569990..570063Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:569990..570063TCONS_00001348-exon-sc0000010-1510915933:569990..570063Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:569990..570063TCONS_00001348-exon-sc0000010-1575043694:569990..570063Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:570414..570490TCONS_00001348-exon-sc0000010-1491911889:570414..570490Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:570414..570490TCONS_00001348-exon-sc0000010-1510915933:570414..570490Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:570414..570490TCONS_00001348-exon-sc0000010-1575043694:570414..570490Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1491911889:572406..573600TCONS_00001348-exon-sc0000010-1491911889:572406..573600Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1510915933:572406..573600TCONS_00001348-exon-sc0000010-1510915933:572406..573600Clytia hemisphaericaexon
TCONS_00001348-exon-sc0000010-1575043694:572406..573600TCONS_00001348-exon-sc0000010-1575043694:572406..573600Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001348-proteinTCONS_00001348-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:532504..573600 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.15387 0.114683 0.00255724 1.4356 4.96264 2.942 4.23388 4.35025 5.96911 9.54061 10.6666 2.60078 13.1015 10.5267 2.90493 6.11941 2.59919 8.65653 7.55732 9.14851 3.61573 0.238048 0.618763 1.88724 10.5067 6.20336 2.19987 3.40927 1.53411 1.01917
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR025136DUF4071
IPR011990TPR-like_helical_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom
IPR013761SAM/pointed
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0005515 protein binding
molecular_function GO:0004672 protein kinase activity
Blast
BLAST of TCONS_00001348 vs. Swiss-Prot (Human)
Match: M3K15 (Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 482/1309 (36.82%), Postives = 722/1309 (55.16%), Query Frame = 3
Query:  537 VCTKLDIELTTIKFENLDFGEYNVLNMFYNADVCVVDMTVLSEQASLFYHIGVRESTGMKDNVVIVED----------DEYTDKKTS-------VKLAISSLSTFFSYQTNKEGKCVVTSMGNTAKDSCP--RTIFSAFLKQLRNVQGTSKAKCKEIFLRDLRKAMQRLKGVPXXXXXXXXXXXXSEPALFSSDTILNLLYSYRDIQDYESMIQIVEGVP-VDHCEIQNRA-IQQVYAFALNRRGSCQDREKALAVVIKLLNDKELNPPDLLCLAGRIYKDKYYASNFTDDKCRDEAIKWYKTSFEIQPSDFSGCNLAIMLVAAGHSFLQSDELQRVCMTLNGLIGRRGHLQDIQQFWIVGRFILISVLARDVSRACLAAERMFLLNPPPWYLRSIIQDLEVIKHKIHACXXXXXXXXXXXMKHNYWQECIYKAATDCEVDDTRFLVLLQDPGNDFIPSYIVVGSDNKDSVPDSAQTFIRLWHAIPPCGKNHTEKCKKIHSWSFHASDIRGISTFKKDNRCLFLYVH-NSDDFQLFFCTPHHRKRFQDLVGSISAPIXXXXXXXXXXXXXXXXEYEYEIDHQGNRVVLGRGSFGTVYAARNLSTNVTMAVKEIPEKDTSQVQPLHEEIALHREINHKNIVRYIASRSEDGFTKIFMEQVPGGSLSTLIREKWGPLIDNEGAMAFYTQQIVEGVKYLHEQKIVHRDIKGDNVLVNTYNGCCKLTDFGTSKRLAGINPHTKTFAGTMQFMAPEVIDQGQRGYGPPADIWSIGCTVIEMATGKPPFFEL-EPEAAIFKVGMFKTHPDIPEEASEECVRFLKNCFHPNPAERMSSEKLLLTAFIQLRTXXXXXXXXXXXVQIPPPQRIISDPGPSSPHESSDDSGAQSSNTNSVESPLDYQDKMDIIRSSKKNSTGAGDTLAKPTDVFMRKLSPTPPLKPHASRINSEPLRRVKTMDSPSSGSTESLNXXXXXXXXXXXXIGDEFSQVSQEHERKMLLLTSMKNHKREICDKWMSKTEELSQHFMLTNTCFNYLLEALIEYIEQGSNVVDIKNFIGPIQRDFPGDSRVLNEVQLAFHLVAECISEVIRDHMNVLPHWMFLIDNLIRAAVKRTIDDISKELASTNDETTSVHSGGGGDTTPVLERKAVRFLSRDNSMGMDDKVPYLTNIQTMSDDNMYLLQELSDLQTNFNKLLRSLV---------LMYKLERKXXXXX-XXXXXXXNTLKEEPTG------DEELLNWLRNLNVPEPDIAKFCEHYCTYDDVINLFELEDLKDMKISVGPRTRIWTNIRKIRESVNEGPTEE 4346
             C      LT++ F  LDFGE  VL+ FY+ADV VVDM+ +S Q SLFYH+GVRES  M +NV++  D          D  T K T+       +   ++  + +F  +++ + +       N      P    +   F+  L+++  TS    KE  L D+RKA ++ +G  L +EL ++K  +    + +SD I+NLL SYRDIQDY++M+++VE +  +  C++ ++  I+  YAFALNRR S  DREKAL +++++L   +   PD+ CL GRIYKD +  S+  DD  RD AI+WY+  FE+Q S +SG NLA++L+ AG  F  S EL+++ + LN L+GR+G L+ +  +W VG+F  +S+LA DV +A  AAER+F L PP WYLRS++Q+L +I+      +++  E S    + N+W + I++A  +   +  RF VL+ +P   + PSY+ + ++ ++         + LWH  P        + K++H W+F AS I+GIS  K D RC FLYVH NSDDFQ++F T     RF  LV  +      +    +   D D LEYEY+ D  G RVVLG+G++G VYA R+LS  V +A+KEIPE+D+   QPLHEEIALH+ + H+NIV+Y+ S SE+G+ KIFMEQVPGGSLS L+R KWGP+   E  + FYT+QI+EG+KYLHE +IVHRDIKGDNVLVNTY+G  K++DFGTSKRLAG+NP T+TF GT+Q+MAPE+IDQG RGYG PADIWS+GCT+IEMAT KPPF EL EP+AA+FKVGMFK HP+IPE  S E   F+ +CF P+P +R ++ +LL   F++             +V      RI   P               S     V   L  Q +  +  SS ++ + + D+ A+P  +F R  +P    + H   + S P       D   + S E  +   FL              + ++ ER+ +L   +   + ++         + S+   L+      ++  L ++I    + V +   I  ++ D   DS  ++++ L      + +++++R+H+ + PHWMF +DN+IR AV+  +  +  EL +  +              P  E + V    +D     +   P     Q       +L  +L +L+   N+LL  LV         L   LE+K            SN + E P G      D+EL++WLR        I K  E   T  D++N    EDL+ +++  G   R+W+ + + R +     T++
Sbjct:   90 ACEAEGAHLTSVPFGELDFGETAVLDAFYDADVAVVDMSDVSRQPSLFYHLGVRESFDMANNVILYHDTDADTALSLKDMVTQKNTASSGNYYFIPYIVTPCADYFCCESDAQRRASEYMQPNWDNILGPLCMPLVDRFISLLKDIHVTSCVYYKETLLNDIRKAREKYQGEELAKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDAMVKLVETLEMLPTCDLADQHNIKFHYAFALNRRNSTGDREKALQIMLQVLQSCDHPGPDMFCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGINLAVLLIVAGQQFETSLELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKLKPPVWYLRSLVQNLLLIRR----FKKTIIEHSPRQERLNFWLDIIFEATNEV-TNGLRFPVLVIEPTKVYQPSYVSINNEAEERT-------VSLWHVSP-------TEMKQMHEWNFTASSIKGISLSKFDERCCFLYVHDNSDDFQIYFSTEEQCSRFFSLVKEMITNTAGSTVELEGETDGDTLEYEYDHDANGERVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPM--KEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAELLREGFLR-------------QVNKGKKNRIAFKP---------------SEGPRGVVLALPTQGE-PMATSSSEHGSVSPDSDAQPDALFERTRAP----RHHLGHLLSVPDESSALEDRGLASSPEDRDQGLFL--------------LRKDSERRAILYKILWEEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHRV-MATTISKLKVDLDFDSSSISQIHLVLFGFQDAVNKILRNHL-IRPHWMFAMDNIIRRAVQAAVTILIPELRAHFE--------------PTCETEGV---DKDMDEAEEGYPPATGPGQEAQPHQQHLSLQLGELRQETNRLLEHLVEKEREYQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD 1311          
The following BLAST results are available for this feature:
BLAST of TCONS_00001348 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
M3K150.000e+036.82Mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top