Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001347 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001347
Unique NameTCONS_00001347
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5516

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001347 ID=TCONS_00001347|Name=TCONS_00001347|organism=Clytia hemisphaerica|type=transcript|length=5516bp
gttccaaaagttGAACACATGCATGAGTGCAACTGAGTGCAAGAACGTGA
AGAACGTGAAGTGAAGTGATTATGGatatgtttttcattttATATGGTTT
CAGAGAAGAGGAATAAAGAACAAATGGGAATGTCTTTGCGGCTAGATTGT
AATCAACAACAAAGATAGAAAAAAACATTGGTCccttttgaatgaaaatg
aacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGTGTAA
ATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGTGGTC
AAGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACACACT
GTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAGAATT
ACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaaaata
aagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaattcaaa
aaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTGATTG
CGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACTAAAC
TTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGGTGAA
TACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTGATAT
GACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTCCGAG
AAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGAATAC
ACAGATAAGAAAACAAGTGTCAAGCTGGCAATCTCATCCCTCAGTACCTT
CTTTTCATATCAAACCAATAAAGAAGGGAAATGTGTTGTCACCAGTATGG
GGAACACAGCAAAAGATAGTTGTCCACGTACAATCTTTTCTGCATTCCTA
AAACAACTACGCAATGTTCAAGGAACGAGTAAAGCAAAGTGTAAAGAAAT
CTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGGTTGAAAGGAGTGCCTT
TGAAAGAGGAACTGGACaagatgaagaaaatgttgagtGAACCAGCATTG
TTTTCATCGGATACCATTTTAAATTTATTGTATTCTTATCGTGATATTCA
GGATTATGAGTCAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATT
GTGAAATACAAAACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAAC
AGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGTTGTTATTAA
GCTTTTGAACGACAAAGAGCTGAATCCACCAGACTTGTTATGTTTGGCTG
GTCGAATCTACAAGGATAAATATTATGCTTCCAATTTCACGGATGACAAG
TGTCGAGATGAGGCCATCAAATGGTACAAAACATCGTTTGAAATCCAACC
ATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCAGCTGGTC
ATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTATGACGTTGAAC
GGGCTTATTGGTCGCCGTGGGCATCTTCAAGACATTCAACAGTTCTGGAT
AGTGGGTCGTTTCATATTGATTAGTGTTCTTGCAAGAGATGTGTCCAGAG
CTTGTCTTGCAGCAGAAaggatgtttttattgaatcCACCACCATGGTAT
TTGAGATCGATCATACAAGATTTGGAAGTCATCAAACATAAAATACACGC
TTGTGAAGAGAGCCACGAGGAGGAGAGTGAGGTTTCAATGAAACATAATT
ATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGACGAT
ACTCGATTTCTGGTACTCTTACAAGACCCTGGGAACGACTTCATACCAAG
TTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTGCTC
AAACgTTTATTCGATTATGGCACGCCATACCACCTTGTGGAAAAAATCAC
ACCGAAAAATGCAAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGATAT
TCGGGGTATAAGTACGTTTAAAAAAGACAATCGATGTTTGTTTCTATACG
TTCACAATTCAGACGATTTTCAACTCTTCTTTTGTACGCCACATCATCGA
AAAAGgTTTCAAGATTTAGTGGGCAGCATATCAGCACCTATTCTTGACAA
TGTTGATGGTGATGATGTTCTTGTTGACCAAGATGCTCTCGAAtatgAAT
ATGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTT
GGTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGT
CAAAGAAATTCCTGAAAAAGACACAAGCCAAGTACAACCTTTGCACGAGG
AGATTGCGCTGCACCGGGAAATCAATCACAAAAATATCGTACGTTACATT
GCATCGCGTAGTGAAGATGGTTTCACCAAGATCTTCATGGAACAAGTACC
GGGAGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATCG
ATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGTC
AAATATCTGCACGAACAAAAGATCGTGCATCGTGACATCAAAGGTGACAA
CGTGTTGGTGAACACGTACAATGGATGTTGTAAACTGACTGACTTTGGAA
CGTCCAAACGATTAGCTGGTATCAATCCTCACACCAAGACGTTTGCTGGC
ACCATGCAATTCATGGCGCCTGAAGTGATTGACCAAGGTCAAAGAGGATA
CGGACCACCGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGG
CCACCGGAAAGCCCCCTTTCTTTGAGCTTGAACCAGAAGCAGCCATCTTT
AAAGTGGGAATGTTTAAAACGCATCCTGATATCCCTGAAGAAGCATCAGA
AGAATGCGTCAGATTCCTCAAAAAttGTTTCCATCCAAACCCGGCGGAAC
GAATGTCGTCTGAAAAACTACTTCTGACTGCATTCATACAATTACGTACG
AAgcgaaagaagaagaaagatcACAAATTGAAAGTACAAATACCACCACC
TCAGCGGATCATATCAGACCCAGGTCCTTCATCACCACACGAGTCCAGTG
ACGATTCTGGTGCACAAAGCTCCAATACGAACAGCGTAGAGTCACCACTA
GATTATCAAGATAAAATGGATATTATCAGAAGTTCCAAGAAAAACTCCAC
CGGTGCTGGTGACACactTGCCAAACCGACGGACGTTTTCATGAGGAAAC
TTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATTAACAGTGAA
CCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCAGGGTCGACAGA
ATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACACAGCAGTATAG
GAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTAAAATGTTGTTG
TTGACATCCATGAAGAATCATAAGCGTGAGATTTGTGACAAGTGGATGAG
TAAAACAGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTA
ATTACCTGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTT
GTCGATATCAAAAACTTTATCGGCCCAATCCAAAGAGATTTTCCAGGAGA
CAGTCGCGTTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAAT
GCATATCAGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATG
TTTTTGATCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGA
CATCAGCAAAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACA
GTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGC
TTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTT
GACCAATATACAGACGATGTCGGATGATAATATGTACTTGTTACAGGAAT
TGTCTGACCTTCAAACGAATTTCAATAAACTTCTTCGATCTTTGGTTTTG
ATGTATAAATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGA
TTCCTCAAACACTCTAAAAGAAGAACCAACCGGAGATGAAGAATTATTGA
ATTGGCTTCGTAATCTCAATGTTCCAGAACCTGATATCGCTAAGTTCTGT
GAACATTATTGTACATATGATGATGTCATCAACTTGTTCGAGCTTGAAGA
TCTCAAAGATATGAAAATCAGCGTTGGCCCACGGACACGCATCTGGACGA
ACATACGAAAGATTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTG
CGTTAGCCCACGGAACAAAAAGAAGTACGAACGTTGTTTGGAAGATATGT
AGTGTTCAAATGTACTAGAAacaaaagttgacaaaaaaatcttttgtggt
GACAGAATGGTGATGGTGATGGTTATCATGCTTCGCGATACTTACATGAT
CAACAGTGGTAAAGATTATTCCGTTGAGAATGTATAGTTTTCCGGAAATA
TTAAAACCAGCCAGAATCAAGCTGCGACTTTACATAGTTGATTTTCACAT
ATTGGTCTGATAGACTAAAAGTAACAATGTCTTGTGTGCTTGGCTGAAGT
AAAAGGAATTTAAAAAACAGCAAAAGACAAATACATGTTCAAATGAAATG
ACTAAAATGTGTATATACGGCGAGTGAAGTTCATTAtaccctaaaaatga
catttttttgtgGATtccttttttagaatttttttaaaccttttttttat
ttaatgtaaaaaaattttttctttaagaagCTTGCATTATCTTTCCTCTT
CGACCGCTTTCCTTTCTGCCCAAAAGTGGAGtttattttctaatttgaaA
CACCctattgtgaatttatttaaaaCGTTATAATTTAATCTAATTCTTGA
TTATCAAGTTGACGAGATTTAAGttcattttcaattatttttgtatcgtt
ttccaaaagagaagaaagattTTTCACTGTCGCTGTTTTATGTAAAAGTT
GCAGGCTTTCATATTCTAGCTGGTACAAAATACCCATAAGGGGATTGGCT
TGCGTTTGTCCGAAATTCGAAAATTGTCTCTagaaagatcttcatttttg
gcGGGCCTTTAGAGAGAGTTTTCCTCCGAAATTGGTCGAATTTAGCCATT
TTTAGGTCAATCTTTTTCGGAACTTGTTATCCTCAGAGGTTTTTAGGAct
caaattttgctttttcatattttcctttctccactaatttttagttttac
tttttttatgttttcatgttttcattcatttcattACAAAATTTTATGAC
ACACCCTTAATTCTGTACAAAGCAACTTTTTTAATGATGACGTGATGATG
ACGTAATCATGAAAAtatcgaattttttttatattagagTTTATGAATTA
TAATACGAATTCAACc
Run BLAST on NCBI

transcript from alignment at sc0000010:518247..573600+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001347 ID=TCONS_00001347|Name=TCONS_00001347|organism=Clytia hemisphaerica|type=transcript|length=55354bp|location=Sequence derived from alignment at sc0000010:518247..573600+ (Clytia hemisphaerica)
gttccaaaagttGAACACATGCATGAGTGCAACTGAGTGCAAGAACGTGA AGAACGTGAAGTGAAGTGATTATGGatatgtttttcattttgtaagtACT CATTCATATCCTGATCCTTAGAATGTAACATGGAATCTTTCACATcatca atcaaaattttagaCCTGAACTTTTTTGTTTGTGTGTGTTGTTGTGTTGT AAAAATTGTGTTGTCCTgtttttttttgataagaatCAATAGGACCCTGC CTACGCAccttgtccggtggcaaaaagtatcctttcgctacaccggacgc aataagtccggtgtcagtccggtgacGTGTTGCATACaaggaattttgga cgccgaacattttaaaaacatacgCATGCTTAcatttacacaaagattaa aaaaaaaataaagcatcttttataaagaaatattataatcattagaacaa taaaagatggaacttcttaatccaaaaagaaatgttcatagaacaacaaa agccttttagaaatttgttcttaacacTGCgacacaaacagccatatata taaacaaaactcaacattctcacaaaagttgtctgtttgattttccaaac attcgtctaaagGACATACAGTGGGGCTTTCGCATGTCTTTACACGTACG CGAACCTTGCGTGTCAGAGACTCGCAAGCGGCTTCTTTCACTATTGAAAA CCTATTTATTGGCGACTCGTAGCCTCAAATTAATAGAGACACTCAAACTA TTTAAAACAGGTCAAAAGCATATTATAATTTGCTAGCTATTATGTAGTGC AAACAGAAAACAATAGTCTGCGTGTTGAGTGTCGCAAGTCTTCTTATGTG CGAGTGCTCCTATTGTTGGATGCTTAACAGTTGCTTAAAACCGTTTTATA AAATTCTATTGTGCTTAGGATGGAACTAAAAAGGCTTGAAATCAAATGAA AGaaagtaaacttttttcttttctcctttttaattcatttttacttttct ttcggTCTAAGATTTCGAAATGTAGTAAGGAAACAACGGAAACAAATGTT GTTTCTATTAAAAGAATTGAAtaatagaaaattaaataaaatacaaatat aATGGAAACAACtagaaatttaatgaaaatattaaattaagaCTTCCTGA TCTGAATGTGACGTATTAATATATACAAATGCTGGACATTTTAAATTGTC TCCCCTGTCCAGAAATTTATTCTGGTAGATTcgctttggaaaaaaaattt taaccctTATTTTGTTACGCTGACAATGTTAACAAAAAACACTGATGAAA AACGTCAATGAAAGTAGCTATCATTTTTAGTGTCCTGAAGCTTTACCTCC TCGTTTAACCACTATTGGCAATACTTTGTTTATATGTTTAATGTATCGGT TGCATTtcacgagtgaataaagtagtgaagtagcgagtttataaagcaat acataaacgagtgaataaagtagcaaagtagcgagtttataaaggaatac ataaacgagtgaataaaatagcgaagtagcgagtttaAAAGCAATACATA AacaagtgaataaagtagcgaagtggtaagttgataaagcaatacaTAAA AGAGTGAATATAGTAGGGAAGTAgcaagtttataaagcaatagataaacg agtgaataaagtagcgaagtggcaagtaGAAAAAGCATTAGAtgaacgag tgaataaagtagtcGAGTagaaagcaatagataaacgagtgaataaagta gcgaagtggcaagttgataaagcaatagataaacgagtgaatgaAGTAGC AAAGTGggaagttgataaagcaatagataaacgagtgaatccggccatat tttagaaaggcagggcagcgtctgttggtggccaaaaagggcactttttc ttgtgttcttccgctaaaaaggctgttattaccaaaattttagagatttt aggAGAGGCAGCGTCCGATGACCGgacgctaaaagggcatgaaaaatggc ctgtgaataaagtagcgaagtagcgagtttataaagcaatacataaacga gtgaataaagtagcgaagtagcgagtttataaatCAATacataaacgagt gaataaagtagcgaagtggcaagtaGAAAAAGCattagataaacgagtga ataaagtagtcGAGTagaaagcaatagataaacgagtgaataaagtagcg aagtagcaagttgataaagcaatagataaacgagtgaatgaAGTAGCAAA GTGgtaagttgataaagcaatagataaacgagtgaataaagtagcaaagt ggtaagttgataaagcaatagataaacgagttaATAAAGTAGCCAAGTAg aaaaagcaatagataaacgagtgaataaagtagcgaaatggcaagtagat aaagcaatatatAAACAAGTGATTAAATTAGCGAAGTAGTCAGTTTATAA AGCAattgataaacaaatgaaaggAGTAGCAAAATACGTGTtctcttata gttttttaactTCGTATTTTTAGTTAGGAAATCTTTTTGGATCGCTAAAA TCTAAAAGTGCGAAGCTATAATTGAAACCCTGGATATTGTTTATTATCTC ATCCTTTGGACGCtttaattattcaataaatAAAAGACTTTTCACAAATG TTTCAGCTGTATTTTCTTTACTTAATAAGATAGGAGGCTTTGAAATATAC GTCACTAAAATACTCACTGGCTTCCCtattaattcaaaataaatagcTTT GCTTTCCTATTAATCGGCGGTTGAATAGCACGTACTTTATTATACTAAAC TAAATAGGCCTTTTATAAAAGGTACGAGTTGAGTGTTGGGAGGGAGATCA AAAGCACTCGCATTAAACGAGTCTGAATAAATTGGATTTCTAACACCTAT ACATTTTGTACTCGTAGCGCGTGAGCCTCGCGCACACGTAAAGACATGCG AAAGCCCCACTGTATGTTCATTAAAAAAGACAAGCTCTGTCGTTTTATCG TTTTTTgataataaatcaaaaaatattgtaCTTAAGTCAAAGAAATTTGC TGGATAATTAGGTAACATGGTTACAAAGCCCCTGAAAAGGCCAAATTTCA CTTTCTATGGTTAGTTGAACGAGAATGGATAAAAATGTAACTTTTCAATA CAGTTTGAGctggaaaaacactttttgataaatgcataacaaatgaataa aattatCAAAGTTTAGTACATTAACTACCACCTGTTGTTATTCGGACGAG TTTTAGCTTACGAGAACGAAGATATTGGATAATGAAGTAACTTAGTCAGA AAATCGTAATCTTTCAATAACTTCAATGATATAGAACATAGAAAGTGAAA CTTAAAACATAAACATATAAAAAAGTTAGATAAGATATTGAAATGCTAAA ATAttactgaaatttcattaaatgaCGCTTTTTTGGATAACTTGTAACAG AATTGATAATATCAGTATATTAACGGTTCTTTTGGCTGAAAAAGGCTGTA AACTTAGTCCCAATGTTATTTTTAGAATTGATTAATATTGCATAAGTTCA GGAGTTGTTTTTTATGAGTGTCACATGCTGGATAACTTAATAACAGCAGT CAAAGAAACCAAAACTTCAACTTAATAATAAAACTACGAAATAACCATCC CATGCTTTAGATACATCTATAATATTATATAATATGATATCAAAGTAATG agttttcctttaaaatcatTAATTATAATCCTTTCATTTGTTTCCAGTAT GGAGCTTCAAACAATCAAGGACCAAATGACTGTTAACCACAATATAAAAC CAATTTAAACCAAATTATTTTATGCAAAAAAGTTCCATCGCCGTTATCCA ATAATGTACAATTAACACTGAAGCTATATTCCTTATTCCTTTGTAATGAT TGTAAATGAAATGTCTAATAGACACTTAAACTTAAAAGGAAGGCTTGGAA AGAAAAGTTCTTTCATTTGATAGTTGTCAATAATTGGATAAAATGTAACA AATTTGGTtttttttagagcattttgttacaaaattatccaaaatcTGTC GATTAAGAATGATTTCATGCACCAAATGTTCAACAGAACTAAAATGTGCT GCTTTTGTAAATCTCCTGTCCAAAGAGACCTATGAAGCTTTAAGACAATT TAAAGAAATGGTGGAATATGTAAAGGGGTATGAATGTCAGTTGATTTAAC GAGCTATTTCAGGTTAGCTCTCAAAAAATGTTACATAATTATCCGATTCT CGCCAAGCAATTGTCCCTGTTCTGCCAACCAATGCAAAAATATTAAGGCC AAGAAACTGTTTGAGTTTTCCCTCAAACCATCTCTTTATATCAACAATAT CTGGATATTATGAAAAAGCCTATTCTGACCTTTGAGTTGTGTTTCATCAT TATCCAGTgaatattttaacaaaatttttgtgTTATATACAATAGTATCC AATGTTAATAAGTTCTATAGGTCAAAATATCTATAGGTTTTGTTGATTAG CTGATCTAGAAATCATTATCCAGCTTAACTGAAAATGTTGATGTTACATC ATTATCCAGCACTGTACAAAGTTCAAATTAGcatatcttttgatatttta aagtAACAAAAATTCTGTTACTAGATTATCCAAGCAGAACACTTCACCTT AACCATCAGACTAATCAGAGTTACGATAAGAAATTGTTAaccatcaaaat ggataaattTGTAACAAAGGCATGAAATGTCACAGAAACCTTAAAAACTT GCCTTTTTTAATGAACATGTCCTAAAGCGTTCACTTCTACAAtagtttat gtaattgcaatttctgTCAGACCACACAGTccgcttcaacatatacacat gtttttatttacgtgaccgaagtgcctactaaaacaatccggggtaagtg gcgaagcaacacagcagattcatagtgtgcacccccacCAGAATAGTGGG GGGGGGTTTGAtgttttgggtcggaaatttccAGGTGGGATTTGGATATT TTCAGGTTTTAGGTaggagaaacaagttaaggtggggattaatttcttta ggtgggatttttggtgttttgataaaagttaatgttagttttttcttatt tccaatttaattataattttttctaaatttcatattctataaataattct tttactatactaaacttttctcctttttattttttaaacattaagaattt ttgtttagttaatcgaattagtataatttttcgtggggatagcattttta gctgggatctagGAGTTTAGATTGAAGGTGGGAATTTAAGGGTTAGGTGG GACCTAAATttttaggtgggacctggaacccccttgcacactatgagatt attcgtaaagtaaagaaatattttttggcattgacaatcaaatataatat atctatatattaatagtggtagtctgtatgtcgttttgtcgtctttcttt ctttctttctgtctgtgctactttcgttttcgcacgcaatgtttttgttc ttccaaaagatgacttttattttgttcttgctccacaaatgtgttaaatc agattcgccccgttttataaagacttttttttgattgatagattagactt tttcttttttgttttatgttttcgaatgtaaagtaattaacgaccttatt tgatttgagacattcgaattcttttcaaaacaaaagaaaatcttttaaaa agaatCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcacataacaagtt tgttagaacaacagcaacattaaaaatacattcaaaaggcggtaaaaact agaattctttcttcgtaaaaagggacctttaaacatgtatatatgtcgat aattattttgctgtaaatctaagtcattgttgaatttgaaaaattattga agttatgacgaagttattgtataaaaagcaacataaaattgcgctatcta tcacgcttttttgtctgcgtatcctagctgccttccggggggactatggt tgcgagctgactttcggccctgcccctcggacccttagcagaataaagag gagaagaaacaagggaaattgtgtgaattttaattcactttttgaaacta atttgaccaaatttctatcttactgggggcaaaaagttgaaattttccta tttttccaattcttagtgggactgaagtttgattttccgatttttcaaac tgtNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCtgtcatgtt tcaaaaaaggcacctttaaggctggcacatacccatacccatacccttct cttgcctaagtaccccctcccccgggctgcctttttttcgacgaattgcg tgtcatgtctattatttcactccgcttatcttgacatcaaagttttccta aacatcaaggactacggcaaatataacgcaagcgaagcgagaaaaaaaat ttaattgcagagccgtctcggacgtcgctggtcgccggtatggtgtaatt tgggaatgacgccctttctgttttctgatcNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNcaaaaaaaaaaaaaaataataatgaattaatattacatactaag acacccccgtcttttactctcgtttaatttccgatctcAGAACGTGCAAA ACACCTGTCCggccaatatccacccaatcagcttaaatttactttaattg tcctttgactttcgaaaattagtatttaaaaataattatgaatttgtaat aattacaaaaaataaaaagtttcatacttcattagtgaaatattcaataa attcccagttgcaattttcagtgggcgtttttctagggcttcgtttatcg cgcaatttttgcgtcacacaaatctttctcggccgctcgtaataattatg cattgccaaatttggttctccattgtcaagtcaggatcgatggtgacgtc acctaagcataaaaaagaaaagatttcgtcagttttatgcatatattaat ttgcaagATATTCTATGCGctgcgagcgcacttttcgtagactagtcgga atactttcttttactcgtgggattgatggtaacttttcatcttcgttatt tttaaaatcaaacacaaccgaaaaaaaacaaaacttcagaaagttgcgta tttccagtgagtaaacgattctgatacttaacaaaattgatgatgataat ttttttcggtgaggcaaatgtctcgtattaaGGGTTCTAGTCTTCACCCC TAAAAGTCTACGcaagattgaagcgtttgggtaaacgagacaaaactcca aaaaatttggtgttttgaagcgcttctgTGCGATtgaaatatcgctgttt gtgacaCACTGCTTAAAGACAAagcataccgtaagttggtctaatattga catctgtcgtctaattccgacatccttctttagagacaggaataatatag ATGCTTGAattactgattgaaaaaggattattcctctctgaccactaagc aaagaaaaacagtttcaacctctCTATCagtttcagctgataaaaaagtc ggctctgtgatggagtgcaaggctgaaagccacatgaatatggttcatct tataaaaggaagttcattctatggtggcctatcttgaagtgaaggtgaca gttgaacaaaatgtttttggtattttgatggaactgttaatatattcttt ctttttgcatatgttttgcatactttccaaggGAATTCCACcacggcaat tcagccaccataattttgcatacaattcaatatggcagatggaaaggcga aaaggtctattccaacACTGTCTCatgcaattttttcaaaagtttgattt ctcacacATTTTTTGAtacatattgaaaaaaaatttcctcaattttctga ttttttgaaaaaagtttcccaGATTTTctggttttcagaaaaaaaattcc ccaatcttccaattttgggaaaaagtttcccagattttccgattttttgg acaaaattttcaacttgaGATGTTCATTTTTCAACTTGAGATGTTCATTT TGAGTGAGATTTCGGATACTCAAAATGAACATCTCAAGTTGGTAGGTCTG TGATAGTGCCACGGATCATCAGTGGacagtattcaattatcattatccct ttattttaatttaactggaacttttgcaaaaaaaagggaaaaacagaaaa gttgtattttttactgctctattcacaaactgaatttgaaagatcttgta tgtggcatttttttttgcaaacttcaataAACTGATTACTGTCCCACTAT TGCAAAACTTCAGCTTAAATGCTTGTGTACAGGATTGGGTATTAAGCAAC TTTGCAAATTTTTCTAAGGAAACGGTagttttttagatttatggCTGCTT TTACccttaaaagaataaaaatttattGAGGGGTATAATCAATTGTTGAG GGACCTCTGGAAACTTTGGTACATGAATTGAATGTTAAAAAGATGAGATG TTATAGTGGTTTGGGAAATTGTGACGACCTATTGACTCAGTTCCGCATAT TTAATTACTCCACTACTTTGGGCTGGAACTTATCTGCTCAGACAGGGGGG Taccaagtcagtgtactggaccataaggtactaacttgatttttggattt tttttcgaaaaaattagaccaccaccctttttagtacactgtactaaatT TTTTCCACAGCcagggctttgacaccacccttttattagtacactgtact gacgTTTCTCCACAACTAGATTTTTAATACCATCCTTTCAGAACACTGTA CTGACTTTTCTCCATGACTGGATTTTTGATACCACCCTTctagtacactg tactagctGTTTTTTTGATCAGATAAGTTTAGAAACcaccccttatagtg cactgttCTAATTTCTTCTTGGTCAGATAAGTTTAATTGCCAGCATATAC AaaggttttgaagcattttgctaagaaaagcACCAAATTGTATAAAAGGA AAGACtgggaaagatttgaatatttaAAATACTTGAATCCTTATATAGTA CAAacactgaaacaatgaaacagacAAAGCAAAGTCACAAGCTGTagcag tttttcatttttgaaaaagaaaataagagaCTTGAAAAGAGAATGGAAAA TCTTTTATCAAATGTAATATcaccgtaaatcctcgaataagcacccgggc gcttatttaatttttcaggctctaaggggggcgcttattcgagcggggcg cctatttttttatttcagaaattcgtatatcaacaagTTNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNtccaattgacaatttctatcattt tattcttaattgctttctttctttttaagacacaagtatctactcaatat cttattcaatcaataacaatatttgaataagcgcccctccctgGAAGGGA GCGCTTATTcaagggggcgcttattcgagcggggcgcttataatattatt ttaactaaaaggggggcgcttattcgagcggggcgcttattcgagcgggg cgcttattcatGCGGGGCACTTATTCAAGGATTTACAgtatacaaaatat ataaaaagatgCTTTCACTAatatatacagatttttttaatcaatgtaGA TAGGGCCTTAAAGAAAACGTAATCAAGATTGGACTtaaggctggtctcca cttgCACATGCTGCGACTctgaaacaaatccaatcaaaTAAACAGGAAAC ATTGGGAGAAAATCAGTGTACCAATTTGTATAGCTTAACCAGCCTTGACT TGAAGGTCTTGCACCAGCTTGGACCTGGCAAATTCCAAATATACATGGGA ATTTATTGGGTCTGTGTGTTTTTATCACTGAAATTAGTACAATGTACTAA CTTCTCAGTGTGTATCAATTCAgaacaccaccctttttagtacagtgtac taacttttttattgtatttttctcagaggaccacccttttagtacactgt actaactcaatTTAACCTAAGAAATACACCACCCCACCAGCTATGGGCAA GTACACTGACTCGATACTCCCCCTGGCTCAGAAGGACTTACAAATCCTAC CAAGATATCGCAGCGATATCGCATGATAATTCAGGAAAATGTTAGCGTGC TaatttgaacaaaacttatTTATAGGTAAAATATCTAATTTCCTGCTTGT TTTACCTGCATCCACACAAAGTGTGGAGTAGTATGCAAGGTCTTAGTAAT ATAGCCCTAACTCTTCATATAAagtttaagggaaaacacataTTTGCACT TTGTACTTAATAACTAATAGAGTAAACTTGTGCTACTGAATTAATCTTAT TGATTTTACAACAAAGTAGTTTCCTAGGGGCAAGATAATTTATTTCTGCA ATTTAGTGCTGCAAATAACAgccggtgaccggtaattaccagTCACTTCA TAGTTTCGACCTGTCATTCTGAagcttacttttttaatttgtccgGTATA AAGGCTTCTAGGCTTCTTTCGTAAGTTTGTTTCGTAAGTTGTTGCTGAGA AAATTGTCATGCTCTTAGCATaccagggctgcaaataagcgtcggtCATC AGTCATAtccgactgaaaatcttttgtgtcggtcatgatgtccgaatgaa aagaggaataaaccattaacttgCGAGTTGAAGATAAATCTCTTACACCT CAgtctcttacttagcctattcttttaatactcgcttcctttgcagcttt caagagtgtttctaaagtTTACTTTAATTGACTGCTTTCTTGGTAATTTT ATTAACagttgtttctaagatcacttttttaTTGACTGGTTTTCtccata actttcaagagtgtttctaagatcactatTATTGATTAGCTTTCTTCaca actttcaagagtgttttcTAACTAACTTtctaacttttatcaactctctt tcttcgtaacttttaagagtgtttctaagatcacttttgtcaacttgctt tctttgtaactttcaagggtgttttaaagttaacttttatcaactcgctt tcttcgtaactttcaagagtgtttctaagatcacttatATCAACTTGCta tctttgtaactttcaagggtgtttctaagatcacttttattgaatcaatt tctctgttaaACAGTAACGAAAATTGTTCCAAGGTCActttctccgtaac tttaaagaatttataattttagataaaaataagcactgaatgaccgacag gattttgagtttgatagacaggatttcatttctgtcggacatgatgtcgg attgactaaaaatatttatttgcagccctggcATTCTATGGCCTCTTAGT ATACTAGGATCTAATACGAGTCTAATTTCTTAGTATATTAAGAGGTTCTA GTATACTCTGTAGTCTTAGTATGCTACGGTTAAACTTGACTGAGCAGATg gtgcgtgatttgggctatttttggCTCTTTTTGCAATTTCACGATTTTTG AACTCTTTCAGTTCGCAGAAGTTTAatatgtctttgaaaattcttaacaa ggTAGCGATTTACGAAAGTTTATTGACAGGAGAATTTTATTAACTATTCA AAAGTTCGCTTTCGCTCAACattcaaataaattaaaatttctgCTGTAAA TACAAATTACTGAATATCTTACACCAAGCTGGCCGCTTCTAAAATCTGCT CAGTTACAACACCCTCCCAAATGGGCCTTTTTGCTATTTGCAATACCATT TTATCTCCAGTTAAAATTAACTGCAAAAGCATCATTAATGGCTGCATACT ATATCCCTGGATAGATCAATTATTTTTTGGTCAGGCAGGggtcacaaata acttgtgttcgaGTCATCTGACTGACGGataatttttcttacttttccaA ATCGTTTGAGTTGGAAAGTCGTAGACAGAATTTTATCCCATTCCATCCTT TGCTTTACCTGCCatctttatttcaattttgaacacgcaagaattcaatt tcaaaatataacagGGTAATATTCAACCCTTTCCTATGCTTGTGGTAATA TGTTATTATCCCCCTAGTACAGAGATACCGCATTTAAAAAACGAGGGGTC ATATTGTTCGTAATCCAAAGATTGCGGTAACAGATCGTCTACATATAAAC ATGGCAAAACAGCAGGctctttattttcaatttctgatAGATTTGATTTC TGCCAActcaaattaaatttaaaaaattttaaatttcagatCATTCTGAT TGCCAACTGACTGACTCACTCACTCACTTTTTGGAGCCAAAAATGACctg aacacaagttatttgtgaccGCGGCCTCattatttaaacttttttgctgc taattgttagagtagaaAATTactactgtaagttggtctaatgtcgataC ACCCTTCTAATTtggacacccttctttagacaTAGAATAACCAGATGGTC GGAATCGCTGGTGGAAACTATTTGtctttgcttagcaatcagagaggaaa aaatctttttgtctaTAAGTGATcctgaccttcctattattcctatctct aaaaaagGGTATCAGAATTAAAGAACGGATGtaaacattagaccaactta caatATCAAAGTTAATCCATGTAACACAGCTTGGCCTGCTTATGGATACT CTTTCCCTCCCTGGCCTTAATGTGGCCTTGTGGCCCTTCAAAATACCTTG GGGAAATActgtgtattttgtttttgataagctctcatatttttttaaca gttttaacaATTGTGCAAGCAATTCACCTGAGTGGGAAAATCATTCATGT TCCTAGGTGTGATATTGTCTTTTCACAATCACCTGGCTgatttactctct ttttccTGTTTAAAGAGGTCTGGTAAAttcacttttcttttatttacaaC GTCAAGGATAGGCATGTTATATACTGATGGAAATAAAGTTTTGAACAAcc gtttgaaaaaaaaactttttctaaagCAATTCATCACAtccataaaaata aaaaatttgtaaaacttATCTCAATAACAAAAACTTATCTCTATTAGTAG CAGAGAAACCATGACATTCTGATTGGAACTTGTAAGACCTGGAGatattt tcaaagcttttagTATTACAGTAAACCATAAGCTTTGGTAGGTCTGAGAC AGTCTCAATCCATGATTAAATCAATCGAACTAAATCAAACAGGATATATA TATTAAACCTAATTgaaatttgaccttttttgaAAGCAGCCAAAAACTTG GTGATGAAAACGGTTTGCTGAACCTTACCATTATAGATTAATGATGGCTC CTTCAAGGGTTTGATTGCTAGTTTTCAGTGCttgacctatcaaatttcta ttttaaagtTGATAACCACAACAGCCTTTGCAAGAGTAGGAGCTTTTATT TAGTAATTGAGcgcaaaaattttaaacttgagcctggaaattgtttaaaa tccttatcaaaaacattttcatatGTTTTCACCAAACTTTCCATCACAGA ATTTTGGTCCTGGACTGGATTTAATGTAATTATAATATAAGCCTGGATTT ATCTTGAAACCCATTATATGAtgtattttcttgaattttagcagattttt tggtttttctgacaaaattttctttattttattgaaatttaacTTTATAT AAAAAGGTTATATATACTTTGACagctaaaaatgatttttaatgcctaaa ataaaaatactgatgtatcatgtaatcaCCGCTGTTGAATTGGataggta atttttttttagatatgaTATTATAATACAATCTGGTCACAGAGAAAGTA ATGTTACATCTCAATAGAGAAAaggaaaacgaaaataaaaataaataaaa taaaattttccctTGCTACTTACTTATTCATgaagtattttttcaatgaa aaacgaaaaatatatttgagAGAATGTTTTAATAGACTTGAATATATTTC TAAATTAATGGTAGGATTCTTTTCTCAAGATATCTTTTTATAGCAGGTTG cacattttcagatttttctttttttgtacaATAAATTGATATATTTTACT CTCagtttttcctttgttttagTCTATCAGTCATTTCTGATCAATTTTTA TAATTCTATGATAAGCTGGTTATTTTTGTTCATATTCTTGATAGTttaca aaattatgaaaatatttttattttctcttttgtcTTACATAATAGATATG GTTTCAGAGAAGAGGAATAAAGAACAAATGGGAATGTCTTTGCGGCTAGA TTGTAATCAACAACAAAGATAGAAAAAAACATTGGTCccttttgaatgaa aatgaacCATCTTCATGAAAACTTGCCCGGAGTAAAACCTGCAAGCAAGT GTAAATGTAGGACATCTTTAAAGCCAATCGCAAGAACTCTCAATAGTCGT GGTCAAGGAAttaaatcactcatccaatccTCATTCAACGTGGCTAAACA CACTGTTgctgataaagaagaaaaacgtaaaatgtCAAGGACTTTCTCAG AATTACAATATTTGAACGGTGATCATACAGTTGATTCTGAAGACgatgaa aataaagatatgGAAAAACATTTAAGTCAATCCATAAGTTTAGCGcaatt caaaaaacttcaaGCTAAACGAAAAATCAAAGTAGTTGCTGTATTCCCTG ATTGCGATGGAACCCAAAAAGCTTTAGAACAGTTGAATATGGTCTGTACT AAACTTGATATAGAATTGACTACTATCAAATTTGAGAATCTAGATTTTGG TGAATACAATGTTTTGAATATGTTTTATAATGCAGATGTTTGTGTTGTTG ATATGACAGTGTTGAGTGAGCAAGCCTCTTTGTTTTACCATATTGGTGTC CGAGAAAGTACTGGTATGAAAGATAACGTAGTGATCGTTGAAGATGATGA ATACACAGATAAGAAAACAAGTGTCAAGGTGAGTGGCtaagtttgaattt ttatgttcaAGGATGAAAAAGTAGCACTTTTGCCAGCAAGTACCAACATC AAGTATAATTGTTTCAcaaatttctacaaatttctACTTTATTAATGACC TTTTGGTCCAAGTTAACTTGTTTGAGTTtccataatttgttgaaatACGA GTTTTAAACAGAGTTTTAATCAAGtgttttataaaacaaaatttccCATG AATGGTTGATTGGCCAAAATACTTATACCCCCTATAAGTATTTGACAAAG AACCTCTCAGTTGAGCATAAAAGCTTCTTTTGTCTTATAGCTGGCAATCT CATCCCTCAGTACCTTCTTTTCATATCAAACCAATAAAGAAGGGAAATGT GTTGTCACCAGTATGGGGAACACAGCAAAAGATAGTTGTCCACGTACAAT CTTTTCTGCATTCCTAAAACAACTACGCAATGTTCAAGGAACGAGTAAAG CAAAGTGTAAAGAAATCTTTTTGAGGGATTTAAGGAAAGCTATGCAAAGG TTGAAAGGAGTGCCTTTGAAAGAGgtttgttaaattttgtttcttgaaaA CTAAGTAATCTATCTATTTAAATATATACAGCATTCTTCATCATTGCAAT AGAGTTTTATCTCAAAGAAAGTCTAGCTGCCCTTTGATTATTATTGTTTT TCTGACGCAAATGACTGGAAAATTCACTGGAATATCTTGAAATGAATCAT TTAACACCTCTTTGACATTGATGTTTGTTTTCTTCAGGAACTGGACaaga tgaagaaaatgttgagtGAACCAGCATTGTTTTCATCGGATACCATTTTA AATTTATTGTATTCTTATCGTGATATTCAGGTATTGTTTCTTAAAGTTTA CTCCTTGTATCTTCACCATTTTTATGCAACAGAGAGTTCTAAACAGAATA AGTAGGGTATTTAAAGTTTGGGACTGTATGGAGAAAAACCAACAAATAGC TGGGGACGCTTAGAGGGGAGGTTTAACAAATTTAGGTAAGGTTTAATAAA TTAAGGGAAGAACAGATGGGGTCCAAGAAGTGGAAATTTAGCAGGTGAAA CTGGGTGAAACAACCCATGAGGACATGTATATCTCATGTTTAgctttttt gtttaaaagaaaactaGTCATTCTGGGGCATCTGATCAATGTGTTTTCCC GTTAAGATTTTAATAAAGCATCGATGTATTTAAACTCTTCATCTCAAGAA CTCGTTTTGTCCTAATGAAAGTTCTGTTTTTAACCCTTTTTCAACAATTT ACCATACGGACAATTATATTTTGCCTATTTCAACTCTTTACAACCATATT ATTAGTACATGCACAATTTGAGATGAAACTTACAATCAAAGTTCATCAAA GTATCCAAACCATAGATAAAGGACAACTTTTTCCTACCCTTAAGgggact actttgaaattttctgatttttggaacccttagagagacttgggaaattg aaaaaaccgacccttttCGTTCGAACATACCGACCCTTTTCGTCCGAACA TACCCACCACcgatttttgcctaagtacggACAGTCATATTATTAGTACA TGCATGATTTGAGATGAACTTACAATGTGAGATCTTTAAAGTATCCAAAC CatagataaagaaaataaactcATTCTTTTTGCTTTACAGGATTATGAGT CAATGATTCAAATAGTTGAGGGTGTACCAGTGGATCATTGTGAAATACAA AACCGTGCTATACAACAAGTCTACGCTTTCGCATTGAACAGGTATTTCTA TGAGTGAAGGTTGAGATtttatcaccatatttccctagtATCCTGCCTGA AGTGgaagtgcttgggattcgaacacagtctaTTGCGatgcaagtctgtg atcgaaatcTTCACATtaccaatcggcagaatgttagtgagacaCAGTGC TACCTGCTAGCCTTATCTAGATAGTGAGTGAATGTAACGTACTGAACTTA TCGTTCTACATaatcattttgagcttttttttcTAACTCATTTTACGTCA ATCGATGCTTACTCGAACATAATACCTAACTCATTACATAACTACAAATA AGGGATAATGCTATCAACAAGTCTGGTATTTGTCTATCAGTCGGTTCATC TTAGAATTTAAAGTATaggttcaaatattttctggaaaCTTCCTTCTTTC ATCTGTTATAGGAGAGGCAGTTGTCAAGATAGAGAAAAAGCACTGGCGGT TGTTATTAAGGTGAATTGAAGTTCTCCAACTTTCAAAACATAACCCTAGA TTAAAAATATTGACCTCTTTAATGACCTTCAATACTTGAAATGAACTGTG CTTTATAACATTTCCTTTCTATGATAAAAATAACTTTAATAAAATCCTAA GTCACGTTTCATCTTTGTGTAGTTGTGTCATGTTAACCTTACACAAAGCA CCCACTTTTATGGTCCTGTTTTGAAAACCTTATTAAAGCTGGTTAGATGG GAGTAGAAAATCATGTTATTTGCATACATTCGCGCATCGTATATTGGTAG AATTGTTAAAAGAAGCTACAAAGAGGTGGGTAtcaaaaatttgtcagatg agttggagtttttataagatactttaataattggtcatttaagtaataaa aatgacgccttttttagaaaaagtaacaaaattgttttattactggttag cgaccaaccaaatcaaataagagcttttAAAAACTCCATCACGTCCCAAA TTTGTAATGAGGAACTTGTTGTTTCAATCAAATCTCATTGTTTTGTAGGA TTTTTCAGTGACATCTGACgagtaattattttttttaaagatttttgcct tcaaatgtttttcttgccaatctagaatttttcaatttcatttaaatCTT AATTTCGTTCTCTTTCTAGCTTTTGAACGACAAAGAGCTGAATCCACCAG ACTTGTTATGTTTGGCTGGTCGAATCTACAAGGATAAATATTATGCTTCC AATTTCACGGATGACAAGTGTCGAGATGAGGCCATCAAATGGtgagaaat atttattttattgataTGTCTTATTGGTTAATAtcttgcccggggggggg ggaggtaAGAGGTTTGCGAAtggacgggtatgtccgagccaaagtttgac ccttagagagacgaaaattttttgacatttttaccaCCTTAGAGACTATT TCCCCAAgaattcagccaaaattttcaaattttagtctgTAAAGAATtca tgaccctttgagggagtcCTTTGCAAGGAAGCCCTTCTCtgaaaatgcca aattttgcccaaaaatacCCTGTTTTTCCGCAATAGAGACTTTGGCCACA TCatttaactttcttttttccACACTCTAGGTACAAAACATCGTTTGAAA TCCAACCATCAGATTTCTCAGGATGCAACTTGGCGATTATGTTGGTTGCA GCTGGTCATTCTTTCCTCCAATCAGATGAATTGCAAAGAGTGTGTAAGTG CAATGCTGTAGAATTCTTTCTCGTGTACTTATTTGAAGGGGAGTCAATGC ACCTATGAACACTTAACGGAGTGGTCAACTTTTGAGAAAACTTAAAATAA GTTTGAAttaaatgaaacttttttcatataaaagGGTATGAAAATGGTAG GGGTTTGATTGGTAATGCCATTGTTTTGCAATTTTCGTATGCAATAATCT TTCATGATCCTGAAAAAACGAAACCTACAAACATTTCTAGAGAAATAAAC TCGTCACATAATTATCTAAATTCAGGAAAATAATTATTAGACACGCAAAA AAATATTGGCCGATTATTGACCATGCCCAGACAGAGCTTTAATTAATCAC GTGATAAATTCCTCTTCATAACATTGGTTTAACCTTAGGAGCCGTGAAAT CTTTTCTATTACGCAACTGCGTCCAATTTCTTTGGAAAGGTTAACGGATT CAAAGTCTTTTTTGCGTTAAGGCGTGGTAAAAAACTTTATTGGTCAGAGA CTGACGTTACACGTAAAACTCCAAACCCCAAATGAGGGAAAATAcccttt tttaacactttttggaaGAAGTATTATATAAAGTGATACTTTAGTGATGC AATTTTCCATCCAAAGGTATGACGTTGAACGGGCTTATTGGTCGCCGTGG GCATCTTCAAGACATTCAACAGTTCTGGATAGTGGGTCGTTTCATATTGA TTAGTGTTCTTGCAAGAGATGTGTCCAGAGCTTGTCTTGCAGCAGAAagg atgtttttattgaatcCACCACCATGGTATTTGAGATCGATCATACAAGA TTTGGAAGTCATCAAACATAAAATACACGCTTGTGAAGAGAGCCACGAGG AGGAGAGTGAGGTAATACATCAAAtgtttaaattgaaaaatagtttttca aGAACTTGTTGTTTGTTGCTGTTTCACTCCCACTTCAACTGGAGTTTTAA AGTTTAATGTACTGTAACAAAGTGTAACGTGACTACTCGATGTGCAtact gaaaataataaatttaGTTCAGGGTTTCAGATATAGCTAAGTGAGTCTCA CACATAAACTTCTATTATTTCGCATAGGATCAATTTTTTATTACAGTtga ttctctaattcgatcttcaagagacTAGGgattttattcgaattagagaa agatttgaattacagagagtattttatactacTTTCTGACTGAGAGGATC AATATTTTAGTTCCAATTAAAAGAAGATTCTAATAATATAGGTTTGAATG AGAGAAAATTGACTGTATCAGCTTTTACTTTTGGCTGTCTTCTGTAAAGT AAAGACTGCTAATTGGCATTGCTTAGAAGATGTCGACTGATTTTGTAATA GATGTAAAATCATTACAATCATCGCTCTTATTTAGGTTTCAATGAAACAT AATTATTGGCAAGAATGTATCTACAAAGCGGCCACTGACTGTGAAGTTGA CGATACTCGATTTCTGGTAGGTTTCTTTTTTAATCGATGTCTAACTCCTA TGTTGGGAAAAAGCATGAGAGACTTTCCTGAATCGGGAATCaaactgatt tttctttattttacaaATACTTCTTTTCGTTTACAATTGAATAAATTTTC TGTTTATATGCTACTTTACAACAAAGGTTTTCCTCGCAATAAAGTACGAA ATACATGTTAATTCGTCGGTTTATTGGTGTTTCCCAGCCATAATTCCTCT AAAAAGTCGTCGTTACTATGGAAAATCATTCATTGGCAAAGACTATTCGT CGGTAAAAAGTGACGATTTTTATTGCTGACGAATTTTCTACCAATAAGGT AATAGTTCTCATAATGTTATAATGATGTTATCAACTGAACCTTTTATCGT CGTTGCGCATTTCAGGTACTCTTACAAGACCCTGGGAACGACTTCATACC AAGTTACATTGTTGTTGGTTCGGACAATAAAGATTCTGTACCGGACAGTG CTCAAACggtaaaaataatattttctcgtctattttttctcaatttttag tCTAACAAGCTAGACGACTTATTCAGACATAGtcgaaataaagcaaaaag taatggagggaacaaattttagttgattagtagcaataatcgtattatca tataacgctcatactactgtattacacgcattatgaacgactccagtcta ctcaATTTTACACAATTTACTCAATGAAATACAAGACATTTATAATTTAT AGTTACATAGTGCTGTTTTACGGATAGTTCTCTCGAGGTTGACAGGTTAA TGATAGTGCTTATTGATTCTTTCTTAAATTTACGTGCTTTTAACGAACTT TTCCCTCCAAAATTGTTGTTTGCTGATTTTATGAATAAGCGCCAGGTAAC AATATGCTACTTAATAATGACACCTTTTTTATTTCCGCCTTGTTTTCAAT CAATCGTCAACATACGATTCCCTAAGGTCAAAAGTtcaagattatttttt gtgtatcATTTAGGgagtaaaaaagttttctttctcaaaaatattACATA AGTGATGTATACTTTTAAAATAAGTGTTAAGCTTACACGATGGAAATATT CTGCCGCTTATTTTACCCGTTTCCATTTATGAAAATTAGATATTTAAGGT TCTTTACATATTTTCTGAACTTTAAATCGAAACTTCAAACCCATAAACTA TCACTAGTAGACCCAGAATAAGCTTCTCTACTAGACTCCTCTACGTCGAT CTTGATGTAACCTAATATGACATAGAGATTTTCTAAGCTCTACTTTGAGT ATTATCTTAAGATAAATCCATTTTGAAAAGTATAaaagaaatttatcctt aaCATGTATATCTAGACAACCTACTTTTGTCATATTTCTATAGTTTATTC GATTATGGCACGCCATACCACCTTGTGGAAAAAATCACACCGAAAAATGC AAGGTAAAGTGAGATGTTGATTTTTATGTTGAACCTCCAATTTCATCGCC AAAGGTTCATCTTACAAAACGATTCTCAATATGCTAAGAGACTCATTTGC CCTTGGTGATACAAGTGAGAATTTGACTTGACATAATGATTATCATTCTA CCTTTTGTTATCTACTAGAAAATTCACAGTTGGAGTTTTCACGCGTCAGA TATTCGGGGTATAAGGTAAGAGAAAGAAAGGGTCGAAATGAACCATGggt aatgggcttttccagaaaaaaatcgtataccccctgttgaggaggtccat ccctctgtggctggaaatgctgtaaccccctggaattccaggcaatttca ggtttaaacccctctggaattctgaattttagtaggatttaaaaagctac ccccatggaattccagttatttttgaccgaTTTTTGTATATCCCTATGGA ATttcgccacatatcaaaccttacccccttggaacggaaatggacctcct caacagggggtatacggtttttttctggaaaagcccaatcagGACTCTAT TAATGGCTTCCCATTAGTTAGACGCAAAACCTTCCAAAATTTCTGATTAA TAGAAAGTCCACgttggtcctgattacccatgattcagtTCGATCTTGTG ATAACCTTTTTTATCGGAATTAGAGATTTCGACATTGCACCAACTTACGG TAGAGCTTAGATCCATTGAGGaatattttcccaatttttttggTCCAAGT AGTAGTGGTCTGAGTAGTTGACTTAGCGTAACTCAAAGTGTTAGTTTTCT CAAGTTTTTCATTCAAGTCAACTATGAATATTTATGTTTTAGTACGTTTA AAAAAGACAATCGATGTTTGTTTCTATACGTTCACAATTCAGACGATTTT CAACTCTTCTTTTGTACGCCACATCATCGAAAAAGGTACGATTATATATA TATAAGGAGGCTTTTAAATACACGTACACCGCCTTACCAGAGTACTGGTA TCGAGTtaatatgaaaatcttttttcgatGCACGGCACAAAATCTAAACC GAGCCATAAATATTGGACCATCCCATCAAACCAACCCTAAACCAGAAAGA AGGGTTTTTTAACTGATGAAAGTTGTCGATTGAGGCAAAATATTAATGGT CAAAAtgcatattttttattttgtcgcAACTTCGACGAGATATTACGGGC CAATTAAATGGTGAAAGATCTGAAATGTAGATGAAGACTTTATTAAAGCA GAACCATTGAATGCCAGAACATGGATCATTCAAGCCGTCGGTAATAACTT ACTATATAGCACCGAtgtcaattttcttatttttgaaggTTTCAAGATTT AGTGGGCAGCATATCAGCACCTATTCTTGACAATGTTGATGGTGATGATG TTCTTGTTGACCAAGATGCTCTCGAAGTAAGTACTGGTGTTCACAACGGA TTCAGTATTTCGcataatctcataacagatctaccattctgcgcatacca tgctttgctctaaagggatatggCGAAGTGGCAACCTGACCTGGTTATTC AACCATAACAATCAAAACGTTGCGTtgctttttgattgaaaatgaaaata aaagtatcTGGGTTCtgatgtttatgtttatgtttatgtttatgattgGC TTTTGAATTTGGTGTACAACTATAAGCGTATATTGAAAAAGGCATGTAAT GACTTTCAGAAATCTCTTACTcgtttactttttctttttcagtatgAATA TGAGATCGATCATCAAGGAAATCGCGTGGTATTAGGTCGTGGTTCATTTG GTACGGTATACGCTGCACGTAATCTCTCAACAAATGTTACAATGGCTGTC AAAGAAATTCCTGAAAAAGACACAAGGTAAGGTATTCAGATTGTGAGTTA GTAACTACATTCATTCGGTGGCGAAATCGAGAGTGAGGGTCTATCCTCTT TTCTATTTTTGCCTGTTTGCGCTAGACTTGGGAGGTCGAAGCTGAGAAAG AgtcaggggggggtcggtagtaaaatctcagacataatgaNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNtttttataatttgaaaaaattttctgttggaaagttgtttgctgcaa acaaaaaattctcgaaattttttgtcaatataaaaagactttaattctaa gggaaaaacgttaatttttgcactacgtgaaaaatgtgtcacagaaataa tcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNgtaaaatacctcttccaagag tctgggtggtggtatgtaaaaattcgtaaaaatccttttactactcatat atgtctgagattttactaccgacccccccctgaaAGAGTGCCACATCTAC TTTCAGCTCCCAGCAACTTACCGCCTAAATCAAATTACTTAGTGTAACAG AGTGTAAGCTACTCAAACGCTGCTTTGGAGGTGAGTTTAGGATGTAAATC CCTGCAAATCATTGAtatcgttcgttcgttcgtctgtttgTCAGTAGAAG TTACGTATCTGTAAGGCTCTGTATATCATTGGAAATAACGTCTTCAATTT TCAGCCAAGTACAACCTTTGCACGAGGAGATTGCGCTGCACCGGGAAATC AATCACAAAAATATCGTACGTTACATTGCATCGCGTAGTGAAGATGGTTT CACCAAGATCTTCATGGAACAAGTACCGGGAGGTTTGTATCCCCACGATT CCATTTTCTAATTTCACTGTCGGCATTACTGCCTAAAACTactctctgtt tttttttttttttttgcttgagtgTTTACTTTCTTACCCACTCAAACGTT GGTTAGCAGACCCTTTTCTTTATAGACAGGTCTATTATCCATTACAATTT TATGGACATATCCAACGTGAATACAATCACGTGAATCAAAAAACCTTAAA AGCAACGataattttccctaaaatttcTGACTCCCTCACTTTAAACCGTT GCCGAGACCCATGAACATCATGCTGTTTTTTAACccttaattttctttat tcataGGAAGTTTATCAACGTTGATCCGCGAGAAATGGGGCCCATTGATC GATAACGAGGGAGCAATGGCTTTTTATACACAGCAGATTGTTGAAGGTGT CAAATATCTGGTAAGTTCGACCTGCTTAAAAGCTTATCAATTTGGTCTAT TATGTTGCCAGCATCGTTTTTTGACGGTCGAACTAAAggctttttttcat aaaatttctcaTGTGCAACTCTACATGCCttgtttttgagatattttgcc tttGCTTTTCTGAGAAATTACAGAAACTTTCATAATTTCCtacaagattt catcatttcttctttttgaagCTTGAAGAAACCCTCCGGGTTAAGACTTT TAGAGTAAATGACAAGCTTTGTTGccaattttttcttgaaaatcctTACC CTCCTTTTAAGCCACTTGATCCACTTTCATATTGCTCAACCCACTCGCAC TCATTTCTAACCCCTGGGAAGTTTCTACCCCATCCCCTGATGATGAATAA TCATTTACCTTTGTTTTGAAAGCTAAAAGGTCCCTCTCCTTCAGCGAAGA TGAAGTCAGTAAGTAGCCCTCTTTATTTTAGCACGAACAAAAGATCGTGC ATCGTGACATCAAAGGTGACAACGTGTTGGTGAACACGTACAATGGATGT TGTAAACTGACTGACTTTGGAACGTCCAAACGATTAGCTGGTATCAATCC TCACACCAAGACGTTTGCTGGCACCATGCAATTCATGGCGCCTGAAGTGA TTGACCAAGGTCAAAGAGGATACGGACCACCGGTAAGATCATAgcgcgaa aattaatttttagaaGTAGCAATTTCAAATCGAATAAGCCAGCTGCGCTG GTGTCAGCCCAAAAGGCATAGACGATAAGTACAAATAAAAGATCGAGCTT TGAGAAAGCGCATCTAAGCAGCTTTGGAGAGCACATCCATTTGCTCGGAA CATTCAAACAATATTGGCGCACAGTGAAATCCGTCTAAATCAGAATTCTG TAGAGCAAATTTATCTCGCCTTAGGGAATAAGAATGAAATCATTTTGTCA TTCTTTGCTCTTTTTGATAGTTTTCACATGCCCGGATGGTACTAGGATGG CGAGCTGACGGGTGTGCCGTcagactttcgaccctcggaccttAACGGAa ctaaaaaggaggaaaaaaggacaatttttgtaaatttaacgacccttttt tggacaaatttgaccaaatttcgatctttctagGGGGCAAAAAATCTTTC CGACCGTTTATGTGACTGAAATTTAAGTAGGCGGTAATAAATTGTAAACA CCCAGGGTTTCATATTTCAACGACCGTATAAATTCCTTAAAATGTACTAT TTACAGGCTGACATCTGGAGTATTGGGTGTACTGTTATCGAAATGGCCAC CGGAAAGCCCCCTTTCTTTGAGGTAAGTCTGAGAAGTGCAagtttcttgt aaaaaaattctaccTAGTCAAGCCATCCATTTGTGTTATATAGATATAAG ACCGTAGAACTATTGCAAGCTACCACTTTTGTACCTGACAAACACATTTC TTTTCCGGagtatttcaaaatattcaatataaaaTTTAATGAGAACACTC ATTTTTTGGTAACGAGCGCTTTTTTGTGTTAACTTGTTCACCTTACAAAC AATAATATGAAATGTATtcaattaaataaattaaattaatttttgtaGCT TGAACCAGAAGCAGCCATCTTTAAAGTGGGAATGTTTAAAACGCATCCTG ATATCCCTGAAGAAGCATCAGAAGAATGCGTCAGATTCCTCAAAAAGTaa gtaaaatcaatcaaaagttaGACTTGTGCTTCTCATATGAAAAAAAGCAA TACAATACAGTATACCTCGAATATCTCCTTGATTCGAACAAGTGTAATGG TCCTTTTAGTTAATAATGCCTTTATCAACcttacttcataactcgaaatt tccttaactcgaacaaatttgtgatCGATGTGCATGCGCGAGTTTAGAGA ATATGATATTACGAGTTATAGAGAGGTGTTCAGGGGCTTGCTTACTGAAG gtacgagaaaacttgttcgaattgAAGAGAcatattcgagttatagaggt tcgagttatggaaacttGCTGTACTACATGCGGTTTTGAAGAGGTCTATA ATTCAGATTTCAGATTTTAGAAAGAATTACAAGCTTATTAATTCGAAGGC TCCTACAAATCTAATGAACATGTCAATAGAATAAATATCTGTTATCGTTA TGAACGATGATAAGTAGCTATTGGCAGGTATCCTGCTCAAACTGACAagg aaaatttaaacaaaaacattcttaaagtcaaaattaaatACTCTTTGCAC TATCCACAATTTTCTCTGGGAACTAGTCAAAACTGGTTGTAAAGACAGAC TGAAAAATTCGACTGAAAAATTCGCatgaaaagtttcttttttcctAACA AAGACGCCCTGAATAGAGTGCAATTTGCCTTATTTTAACTCGTCTTATGA CGTCACACGGAGGGTGAATTTCTGGACTTTCAGGGTTTTgctgtttaaaa agaaaataacatattttaaTGTGTGCATTAGGCTGTTCCATAAACAATTC ATACAgagtaggggggggggggctacgaACCTTTTCACCTCAAAAAAGAT TGTttgaaatgtgtggataccccctgaaaaaaaaaaaaatttttaaagtt tacattgggcttttccaaaaacaattcatacagggtaggggggggggggg ggctacgaACCTTTTCACCTCAAAAAAGATTGTttgaaatgtgtggatac cccctggaaaataacaaaaattcttGTCCTACCTTTTAAGTGAGGGCGGA AGAACTTGAATAAGTCTGTAACACCTCTGGACATTTTAGAATAAGTTTTT ACCCCAAGTTTTTACCCCCTTGAATAATAAAATACACTCCTTTAACCCCC TTGGATTCTCGGATTACGTCCTGGAAACGTTAGTCCACCCCCTgtttgga tataaaatggaatggtccATTTCATGAATATCTCCatatgattttgatat tttatttttcttatagttGTTTCCATCCAAACCCGGCGGAACGAATGTCG TCTGAAAAACTACTTCTGACTGCATTCATACAATTGTAAGTTACACTgag ttaaattaaaatgattttcttaTATACAGTATgcgtactttaatgggata aattttcgcggggattaattttcgttgATCTCGCGGATTTTGGTGttaac cgcgaaattaagtccaaATGGAAAAGCgttatccgcgaaatatttttgaa caaaaataaaaaaatgtcaaataactcCTTTCAAAATGATTAATGGCATC AATAACTATGCCGAGCATGTTCTTACTCTCTCTAGACGTACGAAgcgaaa gaagaagaaagatcACAAATTGAAAGTACAAATACCACCACCTCAGCGGA TCATATCAGGTAACCCGCATGGCTGTCTTCTTTAATATGCCATGGGTATT TTCCATTGGTATAAAATGTCGTCCATCTACCATGGTTGGGAGATTAAGGA AATGTTTACCCTCCAAATGTCCAAAATAAGTattttcatgcatttttgat AGCCTAAAAATTCTaacatgattaaaaaaaaccttgcTAATTGTTAGTCT CCTCGCAATAAATCGAGTTGATATTTCAGAGTTTTTATATCGTAATTTGT CCATTTTAGAAGAttgattttgaaaactcaaattaaaattgagtttttac CACCAAATGACGGTGTTAAAAAAGGACTTGAAAATTACCATGATGCCATG TCGCTGTACCGTCGAATTATAGAATGAAAAAAATGGGACCGCGTGATACT TTTTCCTTTATAAATATCGTAGGAAAAGAAAACAGGCGAAGATTTCAGTC GCTTTTATATTCCCCATTGTCCCAATCAGTCGGTGAAAAGGGACGAGAAA AACACTTGTTGGGGAAAGTACTAAACGATACATTATTTTCTCTTTgctat ttatttaaaaaaactccaaaacgATAAGAATAATGTAATGTANttattaa aaaaaaaagacaaaaaaaaactataagaataaGTTAATGTAACTCCATtc cattgaaatttttctttatttgattttctttcagACCCAGGTCCTTCATC ACCACACGAGTCCAGTGACGATTCTGGTGCACAAAGCTCCAATACGAACA GCGTAGAGTCACCACTAGATTATCAAGATAAAATGGATATTATCAGAAGT TCCAAGAAAAACTCCACCGGTGCTGGTGACACGTAAGCCggctttctttt tttatattaaaCATCCTTTAGGCTTTTTAGACCAAGCATccggcctttca ttagcatatTGATCTCCGTGGTGCTTTATGTCCGTTTTTAAAGAAGCGGC GTTTCGTCAATTCAAGGCCATTTAGGAAGAAACGGCGCCTCATAACAATC AGTACGAATAATCAGTAATCACGTGTCTGCATTGCGAACAAACATTCAAC TATTGCTATATCGTTGGACCTTCATGCAGCTTATCTAGTTGGGTTTCCCA TAGCCGCACTCGTCTTCACCCGTTAAACAGTCGGAATGAATCTTTGTCTA AAAGATTTCGATCAGTTTAGTCTTTCGCTAGAAAGCTCGCAGTCCTTGAA TCGATAATAGCGAGCCTATGTATGAGATGAGTGTTTTCCGCGACGGATAT GGTTATCTTGATGATCCTGATTAACTAAGGACGACGGTAATTTAGTACTT TTACCATCCTCGATTTTTCGGGTCAAAACTttgggtttttccaaatcgct tcagtcactctgcCGACCTTAAAAATGCAAATGCATAAACTCACCATTGA CGTCAAGTAGGGATTTTTAGACTTCACGTTTTTTTAAATGGTTTCGGTTT ACACAATCAGGATATTTTTCAAAGCATGGATTAGACTATTAGAATTTTTA CTTACAAATGCAGAATTTTCTGCAAACTTTGCACGAATCAAAAATTTgca tattttgtaattttaaagtTACCGATCAAACatttctctttcattttatt GAACAAGCAGGAGAATTTTAAATCTGTAAGATCCatagcaaaattttgtt ttagtgttatcctttttttttcagactTGCCAAACCGACGGACGTTTTCA TGAGGAAACTTTCGCCGACGCCACCTTTGAAACCTCACGCTTCGAGAATT AACAGGTTTGTACAGACAGACTTTAACATGTCCCATGTATTTTCACTGGG AGtgttgtttgataaaaaatacatcaaaatctGGATTGATGTTCACAAAA TATAAGTGCAACttcgaaaaaaatcaattttatgaTACTTCAAGGTCACT CTAGCAAGCTCATGATTTTAAGGGTCAGTAATGCGggatttttccaaatc gcttcagtcattCCGCCGTCTTTAAAAGTGCAAATACGTAAACTCGCGTC TATCGCGCCTTCGAGTTTATCAAGTGGTTCGGTTGCTTTCAGGCTAGGCC AAAATATATTATTTGAGGATTAAGTAAGtcacccgaaggctcctctttcg atagctatcttccctaaggtaggggagggcgccactttTTCTCCCTAGAT TGCTTCATTTACCCTTGActcttctcttaattgctgagcatcaagtagag agacaccaagtaccatttttgtacTTTAGGTACGAAGTCTTTAGTATGAC CCGGGGTTGAAAACCCacgaccttgcgcaccgtagctggaggATTCTCTA CCTCTACATTACGTTCGATGATTAGCcataatgggctattccagaaatag tctgtaccccctatgttgaggaggtgtgacgtccagggtggtctggaaaa tataaaaaatccgGGGTGGTCTGgtttttttgaatgataaaatccagggt ggtcagtataacgaggttgaaaatccagagtggtccaaagaaatgggaga aaaaaatccaagggggtactgaaaaattggaaaaaaatccagaggggtca cctttttaaaaatagaCCTCCTCCACAAAGggggtacacgttttttctgG ATTAGCCATAATGACGtaacgtttttttttgttttttttctttgaaacta cCAACAGTGAACCATTGCGGCGAGTGAAAACAATGGACAGTCCATCCTCA GGGTCGACAGAATCTTTAAACAGCATGTTCTTCTTGAGCCAATCGTCACA CAGCAGTATAGGAGACGAATTCTCTCAAGTCAGTCAAGAGCACGAACGTA AAATGTTGTTGTTGACATCCATGAAGAATCATAAGCGTGAGGTTAGTCTG TCAAATAAACACTCAATTTTAGCGTTATTGCCAATGAAGTGTTAACCCGA AtagctagaagcgaatctcctaggtaggatttgaagccggCGCTAAATCC CACCTAAGTTtgcggccttgagcggcccgtgtggtttttaaaaattccaa atgttttacaaattctggattgaaagtaaaattttccgccagatttgaaa aaaaatttaccacTTGAAGAAATACGGCGTATATTCTAATGTTTCACATT TTCTTgtctgagaaaggttaaagattcgcttctagcccttcgggcttaaa cTTCATTAGCCATAACGCTAGAATTGAGTGTTTATATCCTTGTCCGAGTG TCTGATTTCCTCAAATGCGAAAATTTAGAAAGCAAACTACAGTTACGTAA ATTAAAGTAACATAATTCGAGTTAAGGGGGGAAACTTACAGAGGTTGGAG TTATGGAGAGGCCGCTGTAAAATCATATTTATTCAGTAAATAATcaattt cttaaaaatgtttttgttttccagATTTGTGACAAGTGGATGAGTAAAAC AGAAGAGCTGAGTCAGCATTTTATGCTAACCAACACATGTTTTAATTACC TGTTAGAAGCACTGATCGAGTATATTGAACAAGGATCTAATGTTGTCGAT ATCAAAAACTTTATCGGTAAGGATtttcaagttgacgtcaaattagCCCA AAGTTTAATTTAGGCTTCAGTCCACCAACTAGTTTTTTATAGAAAGTTTG CGCTTTGAAATTTCTGTCTGATCTTTTTTCTTAGTCCGGGTGGGGGGNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNtttttttttgggggggggggggggggggggtactt aggcaagtgaaggtacgggtatgtgccgccctttgCACCTGGCTTTTTGG AACCTggcagtccctgtaagggttagaaaaatcaaaaaattaaatctcag gtccactaagggtcggaaaaattttttgctcctaaaacattgaaattttt taaattattccCAAGAAGGATCATAAAATTTACAACATTTTACGATTCCT CCTTTTTAAGTCCCGTTgaggtccgagggtcgaaagccGGGCTACACCCC CCCCGCCCGTCATCCTGTAAATCTAGTTCCCCCCGGGCTTTTAGTATATC ATTTACTAAACATTTTCAATTATTCAACACATAAAGTACTCTTTGGTGGT CGAGGCACTGACTGATGTATGTGAGATTTTCAGCAAACTTCTTACGGCAG GTTCATTTATAAAGGACACTCCTTCCTTGAACTTcgtaaataattttcaa aaagtacgCTTTGGTTTACAACTGGAGTACTTTTTTAACCCAGCGATAGG GTCTGCTTATATTCCTTATTGGAGAGGAAGAATGCTTTTGACATATATTT TTTCTCGAATCCTCTTTTTTTCATCATGAATGTTTGTCTTTTGAGTTTCG TAAACAATATGATTAAAAAAGCGCCCCTAGGGTTCAATTGGGTCAATTAt ccatgaaacaaaaaacatCTGTTAtcgaaatttaattaaaaaaaacccgg ggaattttattttcgtgaactttggaccctttCAATAAGTGAATTGgttt tttgtaacccttagagagaccttCAAGGGTGTAAAATGGAACCTTAATGG CTTGCATATACCCAATACCCATTTAGCCTAGTACCCCCTCGAAATAATTC ACTCTTTGaaagggtccaaagttcacgaaaataaaatttcccactcaaag ggtcatgatttaaaaaaatatagacCAAAATTGAGTGAAAATCGACAAAG ATTTTGGGGAGAAGTCTCGCTAATTTTCGATCGattttttggctcggaca tacccgtcaccttgcGAAcctgtaaccccccccccccccctggaaaaaaa aaacaagtaataGAATAACAAAGCACGTCAGTGTATCCCTTTGTGTATAC TTTGATTCCCATTCATTCACTCTCGTTTCATAACAACTCACAACTTTCTC CTTTAAcgaaagggaatttccctttggTAAACGAGCTTCGAAATTCGAAT GGTACATTCGaacattcgaacattcgaatgtttacaaacaaaagaatgac agaatttttttaagtgtCAAAAGCAGTTCCGTGCTCCTTTTTTTTTATGA GAGCGAGTTGGTGTTGGTAGagatacatttttttttatgaacatgAATTT TTAACTTATTGTGTATGAAGCTTAGACATTAAATTCATAATTCTAGATGA AACCAAGTAGGCATTGAAGAGTCACATATAATCAAAACACTGAATGGTGA ATTAATAgatacagatttttttctgataactttgttgtgtatagaccttt tttcaaagaggacgtcctgttgaataattatgtagtccagccataaaaca ATGATAgggccatgcataattactgtgtcatgcatattgtaataattatg aatggttttatcattgtttttctgctggactacataattattctacaggg tggcctctttgaaaaaaggtcttaAAAAAATAGATCTATGGTTTTATAAA CCGCAACACCTTAACAACACAAGAAGAAAAATGcatcaaagaaaagaaat gGCGATAGGGCATGATAGTTCTTCTACTAAAACAAAATTCTTCCAACTTG GAAAGGAGACACCAGAAGTTACAATGAAACGAAAAAGAAGACCCATCATT GTAGTGTTTGTATTATTGGCATTATTTTATTGGTTGTTTTTGTCAGCTTA TGTTAATCTAGAAACGTGGCAATCTTTGACCAGGCAATTGAAATCAGTCA AAGCAAAATTTGTTTACAAGAAAGTTCCTAGGTCTTACTTGAGCCTGTTA AAAGCCCGAATGAAGAAGAAGCAAAAAGCAAAGAAGATAGTCGTAGATCG CTGTCCTCACCCTACACTACCTGTAAAAATGAAATCAGAAGAAAGTAACG GACAAGATATAACATGTAAACCCAATAGGTTGACCGCATCCGCTTGTAAT TACGTCAAATCGAGGTATCATTATAATTATCACACTTACAAATGTGGAAA AGGCGAGGGTGAACCAACATTGAACATCTGTACTTTCCAGGAACAATCAA CCACATTCAAATGCAATCATAAAGCTTGTGGTGCAAAGTTCAACGGATCA ATTTACATACAGTTGTTTGATACCAATCGCACAGGCTGGCATTACACCAT TAAACCTGGTTACAACGATTCACAATCTCTTGAAAGAGCTGTTCTCAAAT TCGCCAAACGATCTACAAAGTTTGCTGATGATTTCATGTTTTTGGTTTGC CAAGGAACGAACCAATCGCAGCTTTTACATTTCGATGCAACGCACTTCAA AGAACCAAAGGTGATGATAAACGATAAAGATTCGCCAAAAACCAACAACA AAATCAACATCAATGTTATATGGTTGGATTCAGTATCTCGTCGCCATTTC TTTCGTTCTTTACCAAAGACCATTCATCAAATCAGGCAAATTAATACGAA CGAATCGACCAAAGCTGAAGTCATAGATTTTGAACTGATGCAAGCAGTCC ACGGTCACACCCACTTGAATACTTTCCCGTTCTTCGAAGGGCGTGTCTtc atcatcattgctcgaccgcagtcgagacaaTGGATTCCNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNATCAGGTTCCATCTTATCTGGAGAGACCCTCCCATTGGGGT TTAAGATCTCACCTTCATTGGATCCCAAGGTGGAATCAAAGAGAGAAGAA TGATCGAGAAAAATGTCTTACCGGAGACGATGAGCGGTAAACAGAAATCG AACACACTTCCAGACTTGAATAAACTCTTCAATTTTATGAGGAACTCTGG ATATAAGAATCTCTACCAAGAAGACTTGTGTTACAAAGGTTTCTATGGGT TAAACGAAATGTTGAATGGCGGAAAAACGTGGAAACAGGTctcaaagaaa ttgaaaaatctccaaattGATGATTTAGGTATGAAGCACTTCACACATTT CAGTATCTTGTAtaagaaaagttttttcgaTCAAGTGCGTTAATTTGATA TGAACTGCTAGGGGATCAAGGCCAGCACACTACCGCCATATAAATAAAAT ACAGACATAGTGGGCAGAGGGGTATTAGGCCCCTTAAAAATGGCACCCCC TCTTAGCTCAAACCTcctcttgaaaatgaaaattcctcaACTCCCCTCAT TTTATTCATCCCCCTCTTTTCTGACCTTTTACTCACAAACTCTTATAATC TCTAAGTATATTCGAAAGgttattaaaatgaaaaatacaataacatgaaT CTACTGGCAGAAATTACTTTTTTAACAGATACAGCAAATATGAAGTCTAA TATGTAACTGACCCTATTGAAATATGTAAAATACATTTTGCAAATTTCCA AATCTTCCAAACCCCCtcaattttcccccccccccgttttttTGCCCAAG CCACCCAttgtatttgaaattttcacaagtcTTCTTCTGAATTCAATGAA ATTCTCAAACCCATGTTTTTTCAAGGGTAATGTGTACCCACTATGAAAGC ACCAAATGGGAATCGGATATTGTCTCCCTGGACGGCAGCTAAGATCGATA AACACCCTACTACTGAACCATGTACCTTATAAGGGAAGAAAACTTGGCGG ATAGAAATTTCGGCGGTCTAGGTAGATTTGGtcaaaatctgccaaattat AAGTTTACGCGAAATTgatttcccgccaaatttagccATCCGCAACATTG GATTCCCTCTGTAAAAACTTTTTCGCCCACCAAActattagtagggggaa atttgttcgtttttttgatgtcgctcgacttttttagtcaaagcacttgt tatacatttttggaaagctaaggggtaggggaatcaaaataacttgggtg ccaattttttttcggacactNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNgcacccaagttattttgattcc cctaccccttagctttccaaaaatgtataacaagtgctttgactaaaaaa atcgagcgattttacaaatttccccctactatatatCCCCGCTGAAATTT CTTCCCATAACGTATTATAGCAGCTTATATACTGCTTGATTTTTTAGCTG ATGATTGTTGTCAATACGGGCGGCATGAAACGTAAAGTTCTGAAACAATA AATcaaagtctctttcttttaatttgaataagCTCTGATATCATCGAGCA CTCTCGGCAGATAAGAAGAAAATAGACTTGTATACTGCTTGATATATAAG TAAGCCCTTTAAAatcatatcaaaaatattttttgtttattcttttaAGG TATCACTTTGGCATCATGCAAGATTATTCATTTTTATAAATCCAAAGAAA TGAATACCTTCAACATGCGTTCATTGCCTCAGATATGCCACAATGGCATC AATCTCAACACGTATTTCCTCCAGCACATTAcgtcaaaactgaaaaaaac caCACATAACTTGTTCAGTTTTACCACGTTAAATATCCCTCATGATCAAA TCGGTCGGCGTATTCAAGGCATCGACCAAAGCGTTGCCGAATTTTTCTCG GTAATGAGTCGAATGAAAAACACAATCACTTTCTTTTTTGCCGATCATGG CAACTCATACACGCCTTATATCTATTCAGAATTAGATGTCAGATATGAGC AGCACCATCCACACTTCTTTGCCATCCTACCGGAAGATGTAGTAGAGAGA CTGGGCCCAAAAGTGGTTGCAACATTACGTCAGAACCGTCTCCGTTTAAC GAGTATTATGGATATTCATCATACCATCAAACATATTGCCAACTCCTCAC ATCCACACAAAGGGCTATTTGAAGAGATTTCACCTAATCGAACGTGTGAT GACATCGAAGTAAACGCCCCTAATTATTGTGTTTGTCAAGGCTGGGATTC TCCAATGACTAACACATCTGGTGACTGGAAATTTGCCGAATTTGCAGTCG GCCATCTTAATAACATGATCACTAGCGCGTCACCAAGAGGCCATTGTAAA TGGCTACTACCTACAAGTTTTGAGAATCTTATTACCAGGAAACACGATAC GATTATCCAACTGACCATGGATATTGTTACAAACCCAGGGCTCGGATCCa caaataaagaagaaaaattttcagttcAAGTCCAATATGATGTTCGCAAA GGCTTGAATTCGTTTCATACACGATTTTTAACTTCCAACCGAATATCGAA ATATGGAGGTTATGCCAATTGTAGTGATACCAGTGAAAAGGATCTACATT TGTGTGTTTGTGATTTGATTGATAGGACATCAAAATCGTCATTACCATTG ACCATAACTTCTTCGCTTAAGTCAGTAGATTTGAAATCTTATAAATCATC CCTCTCAACAAGAAAAAACAGTGCTTCTTCCAAGAAACTATTTAACACTA GCGATAAACTTTTCCTCGACTCTAGCAATAGATTGGCAAAATCGATCAAT ATATCTTCGGTTCTGACCAACTCTAACCTCATGCTAAAATCTCTGAATGT ACCGAGCCTCGCACCTAAGCCATATGATCTTGCTAAATTGAGGACAGCCA AAGAATTCAAAATCCAATTTAACCATAAAgagataatatcaaaaattatg ATTGATGTCAACCAAACTAAAGGAAATGAAAGAGAAATATACCCGCTAGA CTTAATACAAAGGGGTGTATATGAACGCAAGACTCCAGTTTCAACCACAT TTGAAGTGATTAACTATTCACATAATCAAACTTTTGAAGTAACCATTCTT TTTTATTGGCGTAATCAGGCGAAGCGGATGAATACGCGCCCGTGTAAAGG AATAGCGAAACCGAAATCCATGAGATATCTGTGCACTACCGGCAAAGGAA TACCGAATTATAAAGTTAAcgtgaaaacttttttaaatccgtaattgaat tgaacttttattttttttagattctccTGTTTTtattattccaaaaattt tttaaattaaaagtttaattttgcaattttgaataaattttcttaaacAG TATTCTTACAAATTATGCTTGGAAAAGTATTTTCTAGGGTATTGTTTCCA TAACATCTTTCGATGATTCTTAAAGATCCCTTTTGCTTTTTAACCCAGTA CCTCGACTACCAACAACAATTTTTTATTAGTTAACTACCCAATAAAAATT GACCTTCGTCTACAGCCTAGTTATTAATCTTGAATGGTCCGCATTTCAGA AAGTTAAACTTAAGGAAACCAACTTCAGCCAATTTAGGTCAAATTCGGCA AAAATAAATCTTGCATCAGTCTGTGCGATTTCTTTGATGAAAATTATCAA ACCTTGTCTTACACATACCCTTAAAACTAACCATAAAATTGAATCAAACT TTATCAATTAACAGGCCCAATCCAAAGAGATTTTCCAGGAGACAGTCGCG TTCTTAATGAAGTCCAATTGGCTTTTCACCTAGTGGCTGAATGCGTAAGT ATCTCAACTATAGTTGTTCTTTCGTAAAATTTTGATTTGGTGCTCTGTGA CAGACGTCTTCGACAAATTCTGGACATTAATTTTGGAACTTTTGGATAAA TTGGATAATTAAATTCTTTACTGTCCTTATCCTTGTTACTGTTGAAAATA ACCGTATAGGGTTCAAACGCCCATTTCATATATTTGAATATCGGAGGGGT GGAGGCTGGGGTCCGTAAGaatcaaaattctaaaaataattaAGAGAAAC AGAAAAATATACTGTATCTTCACCAGAATGATGaccctgtttttattttt cttgcaaCTCGTTAACCATTCTACCAAAGGGTTACCAAACTATTGTAATT CATATTGcaagtcttcataactcgaacacacgcACGGGAATTGAAATTCG TTTGAGTTATTGAAAATTCGAGTAGCCTCTTTATTGAAGGTTTGTTTGCT GAAAGGAGGAAACAAATCGTTTGAGTTAAGGAGTTACGGGGTCACGAAGA GGTGGAGTTTTTTTACCCATTTCTAAAACTCAAATCTCTCCTTAAAACTA GAACATAATTTCTCGTCCCTTCACTTAGCAATGCCCTATAAAACTTACTC CAcatctcgaaatttccttactcgaaataatttttgttacccatgcttgt tcgagttatggaggcttTGCTATACTTTTATCTTCCTTTCACCAGATATC AGAAGTGATTCGTGACCATATGAACGTCTTGCCGCATTGGATGTTTTTGA TCGATAACTTGATTCGTGCTGCTGTCAAACGTACCATTGATGACATCAGC AAAGGTAGGCTCATGCGATTTTCTATTCCTTAAACCATTGTTCACTCCTT TGACGAAGGGTCGGTTGTATGGTAGACTAGAGTCTGCTTCTGACTTAAAC TTGCTTTCTGAAAAATTCCTGTGAAGTACTTATAAGCACCATCctgtcta tcaaaaagctacaagtgccccccccccctccgagGGGCAATTTGTTTGGC TACTTGTATATGCCAAGAAGTTACGTTTAAACTTTAAGGTAAAAACCAAT CACTTTCGAATAAGTGTTAAAGATTGAAATACTTTTTATATGGTAGGGCT CttatgtgaaaaaaaattgcttaGCATCTATTTCCCTGATGTAAATGATG TTATTTGGTCGTATTTGAAAGTCGAGAATGGAAAAGTAGTTACCAATTTT AGAATGAAAACCCATGCCAAAAGTATCGGGATTCAACAGCCCGAAGACAG GCCGATTTTGACAATTTTACAACGCATGCAGTTTCGCTACTATTTGCATG TAGTTGCGTTTAGTATACTTTGCCAAaaattcaatcatttttgcacgttt tatttttcaaggaatTCTACCCTATATTAGCTACTAACCAACTCTATTTT CTGTAATATGATATTATCCAAACTTTACTAACATTTACTCAGTCCACTTA CGTTTTGAGTTTTTGGTTCTGAATTCACGTCACGTTTCCACTCGACAAAA GAGGCATTCTTGAAAGTATTATAAATTACTCAAGCGGGATAGAATACATT TTCGTTAAACTATCGAAATCCCAACGGGGATAGAATTCTGTTGTTCCTAA GTTGAAAAATCTAGTGGAATTGTTGTACCTAGTGATACTTTAGAGtacca ttgaatttcaaatgaagATTAAAGcaaagtcaatttcctagtggggctga aattgaaGGGTAATTTCCCATCGGGGCGGAATATGGCTAAATTTTCAAGT GTAGTGGGGGttcagcgggtctgtgacacggttataaaagatatttcttt tagAAGATGAGcaacttttttatatttcagGCTGTTTTGCAAAGTCACTA GACTTAAAgctcaaattttattttttgaagtgcttAGGTCATTATTATCT TAGATGTCACATCTAATTTCAATATCCCCTAACGAAGCTATCCTTTTACA AATGTCCCTATGCAAATAAAAGGCGAAGTGAAGTCATTATATAGAACAGA ATAGATGATAATTGCTGATTAGACGTTTTATAAATTAATGAGTTTACGAA TAGGGTCTTTTTTATGTAATATGACGTAAATTAATGCAAGTTGGGAAAGT CTAGTCATCTGCGAAATCTACACTGAATCTGTTAAAAACCTGCCTGATGA CGCAATATTACGTAAATAGATTGATTCTCTTTCCTAAATTATAGTACACA GTAAGGGTAATCTAGAAATACTTTGAGCGTTTTCACGGATCAACGGTCTG CAAACTCCGCTTTCTATGAAGTGAAACAGGTTTATGGCACTGACACCATA GACATGAATTTTACAGTACCTCTGTTCCCCTTTGAAAAATTGAGACACCT CTGTCTCAGTGACTTAGAGAATACTATTTAGGGGATTTTGAATTCGATTG TTTACAGGATGAACAATCCATTGGGGTTCTTAAAATTTCAGTTTCTTCTC CAGACTTAAGTGTGGTTTTCCAAGATTAAATCTTTCTCACATGGAcgatt ttttgactgatttttatCCAGTTAAGTGAGCAGTTATTGATTTTTGCAAA CCTTTACCACTGTATTATAGAACGAGgagaaaacaacatttttttgaGGG TTTGGTCAAAGAGAATTGGAGAAAAGTAATTGATATcttaaatttcaacc aatgcTTGCATTTTTGTTAAATGTTGATATAAGCATTACTTATTAATCTG ACATACTTTGACCTTTTCCGCTTAAACTTTCGTGACCCGTTTTATAAAGT CTTAGGAAAAATAGTTTTATTGATTGACATATGCTGTGCGATAAAATACA AGAATTAGGTGAGTAAGGTTAATTCAGCAAAATACGATCACAATTAATGA CTAGTGTGCGATTAGTCGAAACCCATAGACCCAGTTTAGGTTACTCTCTT CATTTGAGTTCAGAATTTATTTAAATGGTTAACTTAATAACCTTACGTTA GATAGTTTATGTATACTAAGTTTTCTGAGACAGAAACggctagaatttct tttgccttGGTCCTGGCTGATAAGGTAAATCGACCCCTTTCACCGTCCTC GATTATGCGGGTCAAAATGCGGATTGCCCTAAATGGTTTTAGTAACTACG CCGTCCTCAAAAGGGGAATGCAAAAACTCGCTTTTTGTCCTTAGTCATCT GTATTAGCATGTTAGACTAATCattttgaggattttgctaCGATGCTTGG TCATAGGAAGGATATCATAAGTGAgggaatttttgtgtgatttctCTTCC TTATTACCTACTTCCCTCGCCTCTTCATTATAGAATTTCTTGATTTGTTC AGCATGATTTTCCTTttggttggaaaaatttttttggaagtTTTCAAATC ATCTCATCATTGTATAAAATGTtaaactacaatcatggtcgaaatagaat gagaattccggttattttaacgttttttcaagatttaaagttctggcgag aaagtcgattttgggctatctttttaacttaatcgaatatttcaatttgg gaggggttggcagacttccaggctatattctgagtcttattgggctattt ttgaacttttggatcctgagatcctaaacCATAGGACGAATAAAAGAAAT TCGAAAATGAAATAGAACTACTATCTTTTGGCGCAACATCGCTCCGGTCT TTTGAATGAGCTGTCAGCAAGAAAAGAATGATTTGTCGAGCAAGGCAACG TTAGGCAACATGATATCGACTTCGTTCAGAGCTTGCAATTGCTTTGACCT TTGGCCGAGACTAgactatacacgttttttcataagaacattgaaaactt ttgaagccttgggatgttcgtaacttaagcctaaaaatgttcttaacatg ttcttattttggccatttttttagtatttttgtccattttcctaagaaat tcggTGTTTTTAAGAATCagcaaagcctcaaaatgtccttaacttgttct taacattttggctgcggaagccttgtgttcttatatagtttgttattata aaaaaacgtttatgtAGTATAGACTTAGAAGTATATGATACGATgagaaa attggcaaaatgtaGCAAAATAGAATTGCAATTTCACGAAATTTGAACGA AAGTGATTTAACAATAGTTAGCGACTATTTACTAACATTTTAACATGTCG TTTCAATTTTTCCCAGAACACAAATAAACGCGGTAAGATTAAAAAAATGC ATTCATaagcattttattttatttccctTAATTTGGATATAGGAATTCCC ATAAGTTATGAACAGCAGCGTTTGTCCACCCACGCAGAGATCACCAAAAT ACCTTTCTCAATTATCAAGCTTCCTACCTTTTGCATAACTGTGATTCCTC TTTATGTATTTAACAATCTTTTCCAAAACAGTAGATTAGATTGTAAGATC GGAAAGCAATAGTTTGTCCTCGTTTAGCTTTTTGTGCagtcagcaaaaaa atttttagcaTTTGATGACAGCGCAACTATGTCATCATGTAAGAATActa tagaataaaaaaaataaaaaaagagctttttataTTGTGTTGCTTTGATA GATTGTGATAAAatagacaatttttttttcaaatgcagAGACGTATCAAT TAAAGTAGGGGAAAGTTGACAAGACTTTGGAAATAAGAAACATTCATTAA TCCAATATTTCTTAAGATATAGAGTTGTATATGAGTTGAGACGCATCATA TAGAAGAAATCGGAAAGATGATGAAGCCAGACTTAGCGAACGAAAAAATA GGGATGTTGAACTTAAAAACACGATCTTGGTATTTCTTTGAACACCATTC CTCTGATTTAGAATTGGCTTCCACTAATGATGAGACAACTAGCGTTCACA GTGGCGGAGGCGGTGATACAACGCCCGTGTTAGAACGAAAGGCGGTTCGC TTCCTGAGTCGAGACAACAGCATGGGGATGGATGACAAAGTACCGTATTT GACCAATATACAGACGATGTCGGATGATAATATGTAGTAAGtatactttt tcatgattttgaaattatgaatgACTATTGCTAAttctgttattcgaatc tttctattattcgcctataactcgaacaaatttaaaGACTTTCCGTTCTG ATTAAGCAAGAGTCAATTGTATTCTTTATGAGATTTTTAGATTTAGTGCA CAGATCGGTCAGGCTATCTACGTGGGCGGGCAACTGAATAGAAAAGGGTT GCACTTTATGGTTTGCACTACAGGAGCCACATTGTATCCTCATATACCTG TTTAAGTTGGAAATTTCTCATTTTAAGCACCACAGAATCTTTGTTGAACC AAAAACTTCATTCGGGTTGAAAAAGTGTCTTTGGCGAAATCCAACTTTGT GCAAGCTCTGCACAAAGACATTTTTATTAGCCTAAATAAATGAGCTAGAC CACAAAGGTTATCGATTCCTTTTCAAACGATAGCGATAAGCATGCTGGGG AGGATAACATCTTTATATATACCAACCATGAAATTCCTTAGATTTTAACC TTGGTTACAGAATGACTAATTCGTATATTCAGCTCTTTTTCTCGAAAcca ttatacgtttttttataattgaacatccaaaaatttggaagctttcggat gctcttaactttttgagttttaagccttcaaatgttcttaacttgttcct aacattttgaccatcgaagccttatatagtttgttcttataaaaaacgtg tatctctTTATTACTGATAAGATTCTTTTTGCATTTGCGATCATATAAGT ACATTCGCGGTTTCTTTTTTGTCTCGTAAAACCTTTTTTCCCCGGAATTA AGTTACACTGTTAGCAGTATGTTGGAAATGAACAATATTGTAAGACAACT AACTTCCTTAAAGGATGAAAAAACCCATCATAATGAAATCCTGGCGACCA TAGACGTGCTAGTGGTTATAATTGTCAGCACTAATTATAAAGTTCAAAAC AGCCAATTAAGTTAAATCGAGGAAAAGAATATTagatttttgcttggtta agcaacattttttttatctagTGATTTCACTCCACTCGATATGTTTGCCA GTCAGCATGGCTTTTTACTTTCGTTTGCTTTTGAACAGTTTCTATTGTTT ACGAATGGAACGAGCTCTTccttttcaagattttcaatgtacttttttct ttgatttccaCAACCATATACaattgactctcgctaattcgaactcgaac gagAATTCTTATTTGATCGAACTGCAGAGAGATTCTAATTATAGAAAACA TTTTACCCGAGGGTTTCTCATTAACGGGGACTGGGAATGAGTTAGAATTA TAgaaaattcgaataatagaaacttcgaataagagagagttTACTGCATG ACGTAATTTTTCAGAACAATGTCATCTCCGGTTGTTTAATGTATCCGACA GATTTTCATGCAATAGTAAaccaggcacgacggaagctttttatatctgg tacggcgaatgaggaaatttaagcgattttatagcgatttgaccgacgaa gaggaaaacttcgggtatttttgtgaaaatctggtacggcggccGCCCTA CCTGCCGTACCCGACAGATTTTCATGCAATAGTAAcccaggcacgacgga agctttttatatctggtacggcgaatgaggaaatttaagcgattttatag cgattttaccgacgaagagaAAAACttcggttttttttttgaaaatctgt tCCGGCGGCCGCCTTACCTGCCGTACCCGACAGATTTTCATGGAATAGTA AACGCTTAGAACAGTAGGAGTAATTGGGTATTCTCAACAACactgtttca acgttcatctaatgttcacaacgtctatataacgttTGATGAACATTGat acaacgttgtgtgccagctgctGTGGTCCAATCACTTAAGTGCAGGTGGC AATTGAGGTAGCAATCACTCAATTTGTAATCTGTTCCAATTTTCCCCTTT TATAGCTTGTTACAGGAATTGTCTGACCTTCAAACGAATTTCAATAAACT TCTTCGATCTTTGGTTTTGATGTATAAGTAAGTATCTATTTCCAGTTTCA AAGTACTTGTCTTCGGAAAAGAAATTGTCTGCTATTTGAGGAGTAAATCT TTCATAGCTACAGCAAATTTACTAATCAAGCCAAATTCTGATCGAAAAGT TTCTGTGTGTCGTTAAGCCAAGGTTGCGCTCCCGTTGTAACTACATCATT AAAGTAATATTTGTTTGCATAAAATGTACCTTGAATAAACGCAAAGGCCT TAGAGGGTTCATTCAACTTACGTTAAATGTATGTTGAAGAAATATATTTG GTCTGTCAATATTACATTAATGGTTACTTGATAAGAGGGCTTTGGCGAAG GGTATCTCAAATTTCTGCAAACCAAAGCGTAATTTGAACCATTTTGCAAG GAAAAAAGTAGTTTAGAAGTATGAGTATTGTTTGCAAAGAGATCACTGAT ATCTAGGATAGGTCAAGACAGATATAAGAGGTCATACctattctttaaaa aacttttgcttCGCAAAAATTATACTTGCCCTTCTTCCTTAAGCCGCTCT CTGCCTTAATCTTCTTCATACCTCATTCCTAAAGGAAAGTGACTTTCATC ATAGTTATTGGACACTTTTCTCACTTCCCGGAGTTATCCCATGATGGCGA GTTGAATAGAGTAATTCCTATAGATCGTTTTTACCCTTTTTTATTGAACG AATGTTCATTTTTAAACGAACAGTAACCCTGTAAAATTGcgtcgttttgc ataagatttCATTTCCTGCACCATGATTTCACTGACTTTTTCGATATCTT TCCGCTATTTTCCCGGGATATCCGGTATGAGATTGGAAAAGGTTTTTATC TAAAgatacggaaaatcttgtgtctACTTACGAAATAGCCTAATTTTTTG AAGCTCATTTTTAACTACACGGAGTtctggtctttttccgctagaaaGGT GGCAGTAGAAGCTAGAAAGGTGGCAGTAGAAGCTAGAAAGGTGAATCTTA GTGCGGGTAAGACCCTAATCAATCAGACTCGCGGACTAACATACCCTAGA AATTTATAATAGAGATCTGAACCTAACAATTGATTTTGTTATACTCTGTT TACGTTAGATTGGAACGAAAAGACAGTACCACCGATACTGACACTGTAGA TTCCTCAAACACTCTAAAAGGTACGTCTAGACAAAAAGTTGTAGATGTTT TACTCAGAACAATGAAAGGAATCTACAATCAAAATGTCTCGAACCATCTG ATTATCACTTTAAGTTTCAACACAAAATGATTCTTTCCGGATACACCTTG TTTCGGAACAAGTAGTCTCCGaatccattgagtttcaagcgaAACGCCAG AGGCGAATCGTCAACTTTTCCTagacgagaaaaaaaattatgcctTGAGT TTCATGTTGTATTTCGGATAACGGATGGAACCTaacactttttttgtttt cgcgtctcacatttttagaattttgacgTGATTGTTCTCGTTCTGCTGAT AGTGGTCCTCCATGGAAACAATTCTTTAGCTGCAAAGCTAATAAAGTTTT CGGAGCATGCCACTCAAAacatattatattattttgtcaTTATTATCTTA CTCTAGGCTTTAAGAAAGATCGCATGCAAGcttgtcttttgggaatttcc ccggcgtagagtttttgttgattagtCTCGcaagcttagggaaattcctC ATTCCTGAAGGTCTTAAGTAAGATTTTACGTACATTTGAAATAAGCTTAA GGTTTAAAAAACAAAGTAAGCTTATGGAAATTCCCCATTCCTGAAGGGCT TAAGTAAATTCTACGTACATGTGGAAAAAGCTCCAGAAACGCATAAAGTA AATAACGTTCAAATGAAATGATTCGGTCATTTTCTTTCTACAGAAGAACC AACCGGAGATGAAGAATTATTGAATTGGCTTCGTAATCTCAATGTTCCAG AACCTGATATCGCTAAGGTATTTTCATACAATCCTCGAAATCTACCGTCG TTTTGCATAAGTTTCCCTTTCCTACACTAAGATTCCTGTGACACTTTACT ACCGGAAAAAGGCCAGAACTCCGGGTAGTCGAGAAATGAGCTTCGGAAAG AAagtcagaaaacagaaaaatccCGGAAAAGTGTCGAGGATCTGTGTTAT GGGAATCTTTCGCAAAAAGACGGTAGTACTTGGGAAACACGTTTAGTATC CGAGAAAATATATACACTTAAGAtgtcgaaagaggagccttcgggtagCC TCCGACTGCCGTCGCAGatgttgaataaaaaaataattttaaatattttg tttatacTTTTCTTCAGTTCTGTGAACATTATTGTACATATGATGATGTC ATCAACTTGTTCGAGCTTGAAGATCTCAAAGATATGAAAATCAGGTAACT AATTTTTGATACCACATCATTTGTGATGTGAGAAAAAAGTGGCTGTGTTC GGGTGCGAGGCTAATTTTCACATTAAAAGATATAGATACAACAAACTATT TGAGAGGTGTGGTACCTCAGGGTTTTGCTGTGTGCAGAAAGGATCTTGGA TTGGTGAACTGAATATACCTTTCAAACCTAAAGTAATGAGAGGTTGGGTT CTATTTATCAACAAGGTATACTGTCTGCCTTAGTGAACGCGATTTGAACA GAATGGCATTTGACGCTATGCGATAATGCGGTTATTTTCAACGTAGTTCA ATTCAAACATCCCTATCTCAGTGACTGGAACTTTTCttcattggaacttt tcttcattggaacttttcttCCACATGAAAATGTCTATcgaagcaggggg gggggtacagccgcagggtactaacccatagccgggtggtggtgtctaat ttggaaattcaaaaaagttagtacccggtactaatttTGGGCTGGGGGTG GGTATATCTCCAATTttaagttagtacccggtaccaATTTTAGGGTGGGG TGggtatcatttcaatttttcttcaagtactCAGGCCCTGAATATGGtac atttgtttaattttttgtcttcaaattTCTGGATTTTGATGAGAAAAGAT TTCCTTGTTATGGCTTACAGTATCTGACAGTATTGAAAAGTTCCCCCTTC CAATTGAAGGTACTTTCCCAAGAGGAGAATTTTATGACCACTAagttata aaaatattgaaatagctAATGTAAAGAAAGCTATTGTTCAAAATCAGTAT TGTTTTAATTAGTGAGAAGGATAGTTCGTCTTTGATATCTCAAGTTAGAA CGAGGTATATGTTTGTCATTGCCTTCTGATGAAATGAATTACAAGCTGTT GCATCCAAAGTGATACAATCTgtcttttaaacaataaaattcttaTCCAA ACTGATGATTCTTACAGCCTGATTTTTGTTAGAGGGGTTAGTTTATTTTA GTTTATTACAGTTTATATTATACCCTATAGCTTATTtgtgtttatatttg tttgtttgtctgatTGTTTCTTTGTTTATGACAATTAAGACGGAGGCAGG TCAACTAAGCAAAGTCAACCAGAACCAACAATGCAACTATTTTCTATTTC AACTTCTTTCATAAGATTGACacagttttgaataatttgaataaattacc aatctattgaagaaaaaataaNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCAACTTGA TTTTTACTTCTTCTGATAGATATATACTTTTATTGCCGTTATTAcagcta tataatattttacttttgccaaGGAATTTCCTTGTTTTACCTCTGTAATC AAAAGTTGTGTTCgatttaaagaacttttaagAGGATCTGAGATAAAAAC ATGGTATATACAAATCATAATAACAACAAAGAGCTGCTTTTGCTGGCTTT TGAAAGATTGAGAANNACTAAAAGgggggtgggggtccctttttccttaa gaaaaagtaagtacccggtactaaaaagggggtggtggtacctaagacaa tttttcttgaaaatcaggttagtaccctatgggttagtaccctgcggctG TACCCCCCCCCTGATCGAAATCCAAATAGGGAAAGATATTCCATatccaa tggggatggttttgagtGCTATTAtttccattgaatttcgaatggggatg cgTGGCTGATAACTGTATGGAAACACTTTCATTACTTCTTTGTTTTATTA AATCTTCAGCGTTGGCCCACGGACACGCATCTGGACGAACATACGAAAGA TTCGAGAGTCTGTTAATGAAGGACCAACGGAAGAAGTGCGTTAGCCCACG GAACAAAAAGAAGTACGAACGTTGTTTGGAAGATATGTAGTGTTCAAATG TACTAGAAacaaaagttgacaaaaaaatcttttgtggtGACAGAATGGTG ATGGTGATGGTTATCATGCTTCGCGATACTTACATGATCAACAGTGGTAA AGATTATTCCGTTGAGAATGTATAGTTTTCCGGAAATATTAAAACCAGCC AGAATCAAGCTGCGACTTTACATAGTTGATTTTCACATATTGGTCTGATA GACTAAAAGTAACAATGTCTTGTGTGCTTGGCTGAAGTAAAAGGAATTTA AAAAACAGCAAAAGACAAATACATGTTCAAATGAAATGACTAAAATGTGT ATATACGGCGAGTGAAGTTCATTAtaccctaaaaatgacatttttttgtg GATtccttttttagaatttttttaaaccttttttttatttaatgtaaaaa aattttttctttaagaagCTTGCATTATCTTTCCTCTTCGACCGCTTTCC TTTCTGCCCAAAAGTGGAGtttattttctaatttgaaACACCctattgtg aatttatttaaaaCGTTATAATTTAATCTAATTCTTGATTATCAAGTTGA CGAGATTTAAGttcattttcaattatttttgtatcgttttccaaaagaga agaaagattTTTCACTGTCGCTGTTTTATGTAAAAGTTGCAGGCTTTCAT ATTCTAGCTGGTACAAAATACCCATAAGGGGATTGGCTTGCGTTTGTCCG AAATTCGAAAATTGTCTCTagaaagatcttcatttttggcGGGCCTTTAG AGAGAGTTTTCCTCCGAAATTGGTCGAATTTAGCCATTTTTAGGTCAATC TTTTTCGGAACTTGTTATCCTCAGAGGTTTTTAGGActcaaattttgctt tttcatattttcctttctccactaatttttagttttactttttttatgtt ttcatgttttcattcatttcattACAAAATTTTATGACACACCCTTAATT CTGTACAAAGCAACTTTTTTAATGATGACGTGATGATGACGTAATCATGA AAAtatcgaattttttttatattagagTTTATGAATTATAATACGAATTC AACc
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000727XLOC_000727Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001347-exon-sc0000010-1491911889:518247..518337TCONS_00001347-exon-sc0000010-1491911889:518247..518337Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:518247..518337TCONS_00001347-exon-sc0000010-1510915933:518247..518337Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:518247..518337TCONS_00001347-exon-sc0000010-1575043694:518247..518337Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:532992..533724TCONS_00001347-exon-sc0000010-1491911889:532992..533724Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:532992..533724TCONS_00001347-exon-sc0000010-1510915933:532992..533724Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:532992..533724TCONS_00001347-exon-sc0000010-1575043694:532992..533724Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:534037..534270TCONS_00001347-exon-sc0000010-1491911889:534037..534270Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:534037..534270TCONS_00001347-exon-sc0000010-1510915933:534037..534270Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:534037..534270TCONS_00001347-exon-sc0000010-1575043694:534037..534270Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:534484..534576TCONS_00001347-exon-sc0000010-1491911889:534484..534576Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:534484..534576TCONS_00001347-exon-sc0000010-1510915933:534484..534576Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:534484..534576TCONS_00001347-exon-sc0000010-1575043694:534484..534576Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:535387..535487TCONS_00001347-exon-sc0000010-1491911889:535387..535487Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:535387..535487TCONS_00001347-exon-sc0000010-1510915933:535387..535487Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:535387..535487TCONS_00001347-exon-sc0000010-1575043694:535387..535487Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:535908..535956TCONS_00001347-exon-sc0000010-1491911889:535908..535956Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:535908..535956TCONS_00001347-exon-sc0000010-1510915933:535908..535956Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:535908..535956TCONS_00001347-exon-sc0000010-1575043694:535908..535956Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:536616..536737TCONS_00001347-exon-sc0000010-1491911889:536616..536737Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:536616..536737TCONS_00001347-exon-sc0000010-1510915933:536616..536737Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:536616..536737TCONS_00001347-exon-sc0000010-1575043694:536616..536737Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:537077..537189TCONS_00001347-exon-sc0000010-1491911889:537077..537189Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:537077..537189TCONS_00001347-exon-sc0000010-1510915933:537077..537189Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:537077..537189TCONS_00001347-exon-sc0000010-1575043694:537077..537189Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:537813..538057TCONS_00001347-exon-sc0000010-1491911889:537813..538057Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:537813..538057TCONS_00001347-exon-sc0000010-1510915933:537813..538057Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:537813..538057TCONS_00001347-exon-sc0000010-1575043694:537813..538057Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:538582..538662TCONS_00001347-exon-sc0000010-1491911889:538582..538662Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:538582..538662TCONS_00001347-exon-sc0000010-1510915933:538582..538662Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:538582..538662TCONS_00001347-exon-sc0000010-1575043694:538582..538662Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:539062..539154TCONS_00001347-exon-sc0000010-1491911889:539062..539154Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:539062..539154TCONS_00001347-exon-sc0000010-1510915933:539062..539154Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:539062..539154TCONS_00001347-exon-sc0000010-1575043694:539062..539154Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:540040..540099TCONS_00001347-exon-sc0000010-1491911889:540040..540099Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:540040..540099TCONS_00001347-exon-sc0000010-1510915933:540040..540099Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:540040..540099TCONS_00001347-exon-sc0000010-1575043694:540040..540099Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:540265..540311TCONS_00001347-exon-sc0000010-1491911889:540265..540311Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:540265..540311TCONS_00001347-exon-sc0000010-1510915933:540265..540311Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:540265..540311TCONS_00001347-exon-sc0000010-1575043694:540265..540311Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:540939..541031TCONS_00001347-exon-sc0000010-1491911889:540939..541031Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:540939..541031TCONS_00001347-exon-sc0000010-1510915933:540939..541031Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:540939..541031TCONS_00001347-exon-sc0000010-1575043694:540939..541031Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:541435..541522TCONS_00001347-exon-sc0000010-1491911889:541435..541522Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:541435..541522TCONS_00001347-exon-sc0000010-1510915933:541435..541522Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:541435..541522TCONS_00001347-exon-sc0000010-1575043694:541435..541522Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:541839..541972TCONS_00001347-exon-sc0000010-1491911889:541839..541972Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:541839..541972TCONS_00001347-exon-sc0000010-1510915933:541839..541972Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:541839..541972TCONS_00001347-exon-sc0000010-1575043694:541839..541972Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:543251..543378TCONS_00001347-exon-sc0000010-1491911889:543251..543378Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:543251..543378TCONS_00001347-exon-sc0000010-1510915933:543251..543378Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:543251..543378TCONS_00001347-exon-sc0000010-1575043694:543251..543378Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:543703..543806TCONS_00001347-exon-sc0000010-1491911889:543703..543806Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:543703..543806TCONS_00001347-exon-sc0000010-1510915933:543703..543806Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:543703..543806TCONS_00001347-exon-sc0000010-1575043694:543703..543806Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:544278..544478TCONS_00001347-exon-sc0000010-1491911889:544278..544478Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:544278..544478TCONS_00001347-exon-sc0000010-1510915933:544278..544478Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:544278..544478TCONS_00001347-exon-sc0000010-1575043694:544278..544478Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:545053..545118TCONS_00001347-exon-sc0000010-1491911889:545053..545118Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:545053..545118TCONS_00001347-exon-sc0000010-1510915933:545053..545118Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:545053..545118TCONS_00001347-exon-sc0000010-1575043694:545053..545118Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:545395..545492TCONS_00001347-exon-sc0000010-1491911889:545395..545492Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:545395..545492TCONS_00001347-exon-sc0000010-1510915933:545395..545492Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:545395..545492TCONS_00001347-exon-sc0000010-1575043694:545395..545492Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:546763..546831TCONS_00001347-exon-sc0000010-1491911889:546763..546831Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:546763..546831TCONS_00001347-exon-sc0000010-1510915933:546763..546831Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:546763..546831TCONS_00001347-exon-sc0000010-1575043694:546763..546831Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:547082..547155TCONS_00001347-exon-sc0000010-1491911889:547082..547155Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:547082..547155TCONS_00001347-exon-sc0000010-1510915933:547082..547155Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:547082..547155TCONS_00001347-exon-sc0000010-1575043694:547082..547155Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:547831..547978TCONS_00001347-exon-sc0000010-1491911889:547831..547978Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:547831..547978TCONS_00001347-exon-sc0000010-1510915933:547831..547978Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:547831..547978TCONS_00001347-exon-sc0000010-1575043694:547831..547978Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:548821..548901TCONS_00001347-exon-sc0000010-1491911889:548821..548901Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:548821..548901TCONS_00001347-exon-sc0000010-1510915933:548821..548901Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:548821..548901TCONS_00001347-exon-sc0000010-1575043694:548821..548901Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:549804..549987TCONS_00001347-exon-sc0000010-1491911889:549804..549987Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:549804..549987TCONS_00001347-exon-sc0000010-1510915933:549804..549987Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:549804..549987TCONS_00001347-exon-sc0000010-1575043694:549804..549987Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:550521..550662TCONS_00001347-exon-sc0000010-1491911889:550521..550662Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:550521..550662TCONS_00001347-exon-sc0000010-1510915933:550521..550662Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:550521..550662TCONS_00001347-exon-sc0000010-1575043694:550521..550662Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:561011..561090TCONS_00001347-exon-sc0000010-1491911889:561011..561090Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:561011..561090TCONS_00001347-exon-sc0000010-1510915933:561011..561090Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:561011..561090TCONS_00001347-exon-sc0000010-1575043694:561011..561090Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:561792..561900TCONS_00001347-exon-sc0000010-1491911889:561792..561900Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:561792..561900TCONS_00001347-exon-sc0000010-1510915933:561792..561900Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:561792..561900TCONS_00001347-exon-sc0000010-1575043694:561792..561900Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:565908..566082TCONS_00001347-exon-sc0000010-1491911889:565908..566082Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:565908..566082TCONS_00001347-exon-sc0000010-1510915933:565908..566082Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:565908..566082TCONS_00001347-exon-sc0000010-1575043694:565908..566082Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:568052..568123TCONS_00001347-exon-sc0000010-1491911889:568052..568123Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:568052..568123TCONS_00001347-exon-sc0000010-1510915933:568052..568123Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:568052..568123TCONS_00001347-exon-sc0000010-1575043694:568052..568123Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:569205..569266TCONS_00001347-exon-sc0000010-1491911889:569205..569266Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:569205..569266TCONS_00001347-exon-sc0000010-1510915933:569205..569266Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:569205..569266TCONS_00001347-exon-sc0000010-1575043694:569205..569266Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:569990..570063TCONS_00001347-exon-sc0000010-1491911889:569990..570063Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:569990..570063TCONS_00001347-exon-sc0000010-1510915933:569990..570063Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:569990..570063TCONS_00001347-exon-sc0000010-1575043694:569990..570063Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:570414..570490TCONS_00001347-exon-sc0000010-1491911889:570414..570490Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:570414..570490TCONS_00001347-exon-sc0000010-1510915933:570414..570490Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:570414..570490TCONS_00001347-exon-sc0000010-1575043694:570414..570490Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1491911889:572406..573600TCONS_00001347-exon-sc0000010-1491911889:572406..573600Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1510915933:572406..573600TCONS_00001347-exon-sc0000010-1510915933:572406..573600Clytia hemisphaericaexon
TCONS_00001347-exon-sc0000010-1575043694:572406..573600TCONS_00001347-exon-sc0000010-1575043694:572406..573600Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:518247..573600 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.89225 3.00902 1.70811 8.62657e-06 14.0711 10.3368 13.3916 15.067 8.25623 8.12832 8.23739 9.08906 9.42358 8.36671 9.08043 8.27883 8.5969 4.12662 7.42452 9.93179 13.6508 17.5737 8.27857 10.4792 7.47338 12.7147 6.63952 4.7041 5.13631 5.7717
Blast
BLAST of TCONS_00001347 vs. Swiss-Prot (Human)
Match: M3K15 (Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 482/1309 (36.82%), Postives = 722/1309 (55.16%), Query Frame = 3
Query:  588 VCTKLDIELTTIKFENLDFGEYNVLNMFYNADVCVVDMTVLSEQASLFYHIGVRESTGMKDNVVIVED----------DEYTDKKTS-------VKLAISSLSTFFSYQTNKEGKCVVTSMGNTAKDSCP--RTIFSAFLKQLRNVQGTSKAKCKEIFLRDLRKAMQRLKGVPXXXXXXXXXXXXSEPALFSSDTILNLLYSYRDIQDYESMIQIVEGVP-VDHCEIQNRA-IQQVYAFALNRRGSCQDREKALAVVIKLLNDKELNPPDLLCLAGRIYKDKYYASNFTDDKCRDEAIKWYKTSFEIQPSDFSGCNLAIMLVAAGHSFLQSDELQRVCMTLNGLIGRRGHLQDIQQFWIVGRFILISVLARDVSRACLAAERMFLLNPPPWYLRSIIQDLEVIKHKIHACXXXXXXXXXXXMKHNYWQECIYKAATDCEVDDTRFLVLLQDPGNDFIPSYIVVGSDNKDSVPDSAQTFIRLWHAIPPCGKNHTEKCKKIHSWSFHASDIRGISTFKKDNRCLFLYVH-NSDDFQLFFCTPHHRKRFQDLVGSISAPIXXXXXXXXXXXXXXXXEYEYEIDHQGNRVVLGRGSFGTVYAARNLSTNVTMAVKEIPEKDTSQVQPLHEEIALHREINHKNIVRYIASRSEDGFTKIFMEQVPGGSLSTLIREKWGPLIDNEGAMAFYTQQIVEGVKYLHEQKIVHRDIKGDNVLVNTYNGCCKLTDFGTSKRLAGINPHTKTFAGTMQFMAPEVIDQGQRGYGPPADIWSIGCTVIEMATGKPPFFEL-EPEAAIFKVGMFKTHPDIPEEASEECVRFLKNCFHPNPAERMSSEKLLLTAFIQLRTXXXXXXXXXXXVQIPPPQRIISDPGPSSPHESSDDSGAQSSNTNSVESPLDYQDKMDIIRSSKKNSTGAGDTLAKPTDVFMRKLSPTPPLKPHASRINSEPLRRVKTMDSPSSGSTESLNXXXXXXXXXXXXIGDEFSQVSQEHERKMLLLTSMKNHKREICDKWMSKTEELSQHFMLTNTCFNYLLEALIEYIEQGSNVVDIKNFIGPIQRDFPGDSRVLNEVQLAFHLVAECISEVIRDHMNVLPHWMFLIDNLIRAAVKRTIDDISKELASTNDETTSVHSGGGGDTTPVLERKAVRFLSRDNSMGMDDKVPYLTNIQTMSDDNMYLLQELSDLQTNFNKLLRSLV---------LMYKLERKXXXXX-XXXXXXXNTLKEEPTG------DEELLNWLRNLNVPEPDIAKFCEHYCTYDDVINLFELEDLKDMKISVGPRTRIWTNIRKIRESVNEGPTEE 4397
             C      LT++ F  LDFGE  VL+ FY+ADV VVDM+ +S Q SLFYH+GVRES  M +NV++  D          D  T K T+       +   ++  + +F  +++ + +       N      P    +   F+  L+++  TS    KE  L D+RKA ++ +G  L +EL ++K  +    + +SD I+NLL SYRDIQDY++M+++VE +  +  C++ ++  I+  YAFALNRR S  DREKAL +++++L   +   PD+ CL GRIYKD +  S+  DD  RD AI+WY+  FE+Q S +SG NLA++L+ AG  F  S EL+++ + LN L+GR+G L+ +  +W VG+F  +S+LA DV +A  AAER+F L PP WYLRS++Q+L +I+      +++  E S    + N+W + I++A  +   +  RF VL+ +P   + PSY+ + ++ ++         + LWH  P        + K++H W+F AS I+GIS  K D RC FLYVH NSDDFQ++F T     RF  LV  +      +    +   D D LEYEY+ D  G RVVLG+G++G VYA R+LS  V +A+KEIPE+D+   QPLHEEIALH+ + H+NIV+Y+ S SE+G+ KIFMEQVPGGSLS L+R KWGP+   E  + FYT+QI+EG+KYLHE +IVHRDIKGDNVLVNTY+G  K++DFGTSKRLAG+NP T+TF GT+Q+MAPE+IDQG RGYG PADIWS+GCT+IEMAT KPPF EL EP+AA+FKVGMFK HP+IPE  S E   F+ +CF P+P +R ++ +LL   F++             +V      RI   P               S     V   L  Q +  +  SS ++ + + D+ A+P  +F R  +P    + H   + S P       D   + S E  +   FL              + ++ ER+ +L   +   + ++         + S+   L+      ++  L ++I    + V +   I  ++ D   DS  ++++ L      + +++++R+H+ + PHWMF +DN+IR AV+  +  +  EL +  +              P  E + V    +D     +   P     Q       +L  +L +L+   N+LL  LV         L   LE+K            SN + E P G      D+EL++WLR        I K  E   T  D++N    EDL+ +++  G   R+W+ + + R +     T++
Sbjct:   90 ACEAEGAHLTSVPFGELDFGETAVLDAFYDADVAVVDMSDVSRQPSLFYHLGVRESFDMANNVILYHDTDADTALSLKDMVTQKNTASSGNYYFIPYIVTPCADYFCCESDAQRRASEYMQPNWDNILGPLCMPLVDRFISLLKDIHVTSCVYYKETLLNDIRKAREKYQGEELAKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDAMVKLVETLEMLPTCDLADQHNIKFHYAFALNRRNSTGDREKALQIMLQVLQSCDHPGPDMFCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGINLAVLLIVAGQQFETSLELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKLKPPVWYLRSLVQNLLLIRR----FKKTIIEHSPRQERLNFWLDIIFEATNEV-TNGLRFPVLVIEPTKVYQPSYVSINNEAEERT-------VSLWHVSP-------TEMKQMHEWNFTASSIKGISLSKFDERCCFLYVHDNSDDFQIYFSTEEQCSRFFSLVKEMITNTAGSTVELEGETDGDTLEYEYDHDANGERVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPM--KEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAELLREGFLR-------------QVNKGKKNRIAFKP---------------SEGPRGVVLALPTQGE-PMATSSSEHGSVSPDSDAQPDALFERTRAP----RHHLGHLLSVPDESSALEDRGLASSPEDRDQGLFL--------------LRKDSERRAILYKILWEEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHRV-MATTISKLKVDLDFDSSSISQIHLVLFGFQDAVNKILRNHL-IRPHWMFAMDNIIRRAVQAAVTILIPELRAHFE--------------PTCETEGV---DKDMDEAEEGYPPATGPGQEAQPHQQHLSLQLGELRQETNRLLEHLVEKEREYQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD 1311          
The following BLAST results are available for this feature:
BLAST of TCONS_00001347 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
M3K150.000e+036.82Mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top