Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001336 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001336
Unique NameTCONS_00001336
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2965

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001336 ID=TCONS_00001336|Name=TCONS_00001336|organism=Clytia hemisphaerica|type=transcript|length=2965bp
TTTTCTATAAATATTCTTGAAAAGACAATAAGTATACAAAAAGGAAGACA
AATAAAGATGATCTAGGAAGATCAATATTTGAGTGGAAGATTTTTAATGT
ACAAAAATTCTAAGaagtgaatcaatcaatcaaacatGGATTTTGATCCG
TTGAGTGACAATGAAGATGATGTGACATTTATgccagagaaaaagaaaaa
agataaagaagAAAAACGACGAAAAAGTAAAGGCTCCCATAAATCTGACA
AGAGAGATAAGGGAAGCTTCAGTGATGGGTCAACACCAACAGCCATGAAA
AGTAAGAATGTCGTGCATGGTCTTGTGGGTCCTGCAGAATACATTGCTGA
AAACAGTCCTACACATGGAGAATCGTCGACAGCGTTTGGCAACCAACCTA
CTTCTCCAACTACAAATATCTCTGCAGCTCAAGTCTTTTCACAACAGCAA
GTGACACCGCAAAAGATTCAACAAACATCACAGGTCCTTCAACAACAAAC
TCCCCAACAGATGCAGCAGCAATGGACGCCACAAAAACATCAACAAGCAA
ACAATCAACAGTTTGCCCAACAGTCCAATTCAACGCCCAACTTCCAACAG
CTTCAATATCAAAACACACCGACAAGTGGACAACCTTTCACAGCTAATTT
CAATGCATCCTCGACGAAAATTGAGCGACCACATTCTTCGGCTGCACTAC
TCCAAGAGCGAACGCCTCAACAATCACCACAGCCTTTCAAACAATCAACG
ACTATGACCCAACAAAAAGGCACTCTGCTTGCTCAAGCAATGAATACAAC
CCCTCAGCCTCAGCCTTCACCACTACCAAATAAACAAGCTCCTGCAGCCA
GTATCCAACCACTTCCACCGAACCCGTCCCAACTGACCGCAGCCATTAAT
ATGACACATCACCGAAACTCATCTTATTCAAGAGCTATGTCATTACCGGT
GGAGTCAGCAACTGGGAAACAGGATGCAAGCTCGGATCACATGATCAATA
GATTCCATACAAAATTTGACAGTGAGCTTGAAGTCTCCACAAATGTTGTT
GGATCACCAATCCTTGAGAATCCAGCCTCACCATTCCAGAGATCAGACTC
ACTCTCTTCACCTCCACTAACACCCAATAACAAACACTCAGCTTCACAAC
AAGAATTGTGGAACAATGCACCGCCCTTACACCACGCCCATCATCATACC
CACCACTCTCATGAAGCACCACACACGCCCAAGCAACATGACGGTGATTG
GGCGCATTTTTCACCTCAAACAGAAGATGTACCTACATCGAGTCATCCCA
ATGCTGGTGTAATCTCGTCTTCNACGGTGATTGGGCGCATTTTTCACCTC
AAACAGAAGATGTACCTACATCGAGTCATCCCAATACTGGTGTAATCTCG
TCTTCGGTTGAGTCGGACAATCAATTGCCACCGCCATCGAATCATATCGA
TATACCAAGAAAGAGAAGCCAAACGGAGAGCATGGCGTCATCCAGCATGG
CATCCAGTATCCCAGAAAGCACGAGTAGTGTTGACAGTAGTTCCGACAAT
GAAGAAATGAGAATCACGCAAGAACAAAGAGAATATTACACCAACCAATT
CAAAAGTTTACAACCCAATGAAGACGATGTTATCAAAGGTCCCCAAGCTC
GTGATTTCTTCTTGAAGTCGAATCTAGCGATGGAAACTCTTTCTAAGATC
TGgCATCTATCAGACTTGGATAAAGATGGCGCATTGAACTTGGAGGAGTT
TCAGATTGCAATGCATCTGGTTGTGTTAATTAAACATGGTTACGAGTTAC
CGATGGTTTTACCTCCTTCCCTTCTTGGTCAAGAGCAAGTCCATCAAATG
GCAAGTCAAGATGGTGTGGATATGAGCGATGAAGATGAGAAATTGATTTC
TGATGACGAAAAACAAGAATCTGGTGATTGGTCCGCTGAATTTGATGCTA
CGGATGGGGCACCAATTGATCGTGGTGAACGTATAGTGCAAACTTACGCG
CAACCCTCCCCTACGTCCGTCACCGTGCCGTCAGAAACTCGCGTACAACC
CGTCTCGCACATGATCGAACAACAACAGATCAACCATGACGACGAAAACG
AATTACCTTCCTCGCCTGGTGCCTTGGCTTCTCCTAACGATGTCGCCGCG
GCGGGTGGCAAAATGACAGCTATCGCACGACCCCGTGTAACCGCTAATAA
AAACGTTAATCTGATGGATGCGTCACCATGGCAGCTCCTGCCACCACCGT
CCGGGAAAACTGGCAAATTCGGTGGCCCGAATGGTGGTACAACCGCGAAG
AAAGCCTTGAAAATGGATAGTGTTGATAGTGAATTAGACTCGGCGGGTGT
CATCAGTGATAGCGAAAATAATAAACTGGTCTCGATTGATAATCACATGT
CCCAAACGACGTCGCCGACAAATGGCGACAGTAGTCTGGATAACCTCGAC
GACGACGAACATTTGACGGACGACCACGATCACGAACGTTTGAAAGTCAA
GAAAAAGGATTCGGCATATTTCAGGAATTTGTCAAAAGAGAAATCGCGTT
CGATTGATAGCTTACGGTCAGATATTTCGGAGAGTAGCATGTTTGAATGG
AAGAGACAATCCATTAGACGAGAATCGAGACCAAGGTCATTTACAGGGGA
AAGCACACACGACACACCGCAATTCGAATCACCGCCCGTCCCACCGCCAC
GAACGAATAAAGGACACGCCAGGGCGTCATCACTCGATTTTAATCAAATG
TTCCATAATCGTTCACCTAGAGTCAGTTCTGAACCGAAATTACAAGTAAC
GACACCAACTGACGGAACAGGCAAGAATCCGCCACAAAAACCACCACGCT
CAAATCCACCAAGCACTTCTTCAACTAATAACTCGTCTGCCGCCCCCACT
GCTGCAGCCCGCCCTCGTTCGTCCAAGGGTGATGAATATCATAGGTCACG
ATCACTTGATGTAAG
Run BLAST on NCBI

protein sequence of TCONS_00001336-protein

>TCONS_00001336-protein ID=TCONS_00001336-protein|Name=TCONS_00001336-protein|organism=Clytia hemisphaerica|type=polypeptide|length=494bp
MASSSMASSIPESTSSVDSSSDNEEMRITQEQREYYTNQFKSLQPNEDDV
IKGPQARDFFLKSNLAMETLSKIWHLSDLDKDGALNLEEFQIAMHLVVLI
KHGYELPMVLPPSLLGQEQVHQMASQDGVDMSDEDEKLISDDEKQESGDW
SAEFDATDGAPIDRGERIVQTYAQPSPTSVTVPSETRVQPVSHMIEQQQI
NHDDENELPSSPGALASPNDVAAAGGKMTAIARPRVTANKNVNLMDASPW
QLLPPPSGKTGKFGGPNGGTTAKKALKMDSVDSELDSAGVISDSENNKLV
SIDNHMSQTTSPTNGDSSLDNLDDDEHLTDDHDHERLKVKKKDSAYFRNL
SKEKSRSIDSLRSDISESSMFEWKRQSIRRESRPRSFTGESTHDTPQFES
PPVPPPRTNKGHARASSLDFNQMFHNRSPRVSSEPKLQVTTPTDGTGKNP
PQKPPRSNPPSTSSTNNSSAAPTAAARPRSSKGDEYHRSRSLDV
Run BLAST on NCBI

transcript from alignment at sc0000010:226374..238625+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001336 ID=TCONS_00001336|Name=TCONS_00001336|organism=Clytia hemisphaerica|type=transcript|length=12252bp|location=Sequence derived from alignment at sc0000010:226374..238625+ (Clytia hemisphaerica)
TTTTCTATAAATATTCTTGAAAAGACAATAAGTATACAAAAAGGAAGACA AATAAAGATGATCTAGGAAGATCAATATTTGAGTGGAAGATTTTTAATGT ACAAAAATTCTAAGaagtgaatcaatcaatcaaacatGGATTTTGATCCG TTGAGTGACAATGAAGATGATGTGACATTTATgccagagaaaaagaaaaa agataaagaagGTATCGTTCAAATTCTACTTCctgaacaataaaaaaact attCAGCAGCAACCTTCTCTCTCTCAACTCCCTCTAGCTTGTGTTGTCTG ACAACCAATTACGTGGGAAAAAATAGTTTATAGTAAATAACTTGTAGTTA ATTAAAAATGCTTGTTTTTCTATTGTGTTTTATCTATTAGCAGCTTTTTA ATCCATCTCTACTCATCAATATTTTATACTTTCCTTGTCCTTACAAACTC AACACTGTTTTTAACTGGCTTGAATGGTTAACCATCTAGTTTGCTCATTT ATTTCTTACAATATCGAAttaattaacatattttattaGCCTTCCAGATA AGTGCGAttgatatctttttattgattgTGAGTTGCTATTATATTAGCGC TGCATTTTGGTTTGTAGAAAAACGACGAAAAAGTAAAGGCTCCCATAAAT CTGACAAGAGAGATAAGGGAAGCTTCAGTGATGGGTCAACACCAACAGCC ATGAAAAGTAAGAATGTCGTGCATGGTCTTGTGGGTCCTGCAGAATACAT TGCTGAAAACAGTCCTACACATGGAGAATCGTCGACAGCGTTTGGCAACC AACCTACTTCTCCAACTACAAATATCTCTGCAGCTCAAGTCTTTTCACAA CAGCAAGTGACACCGCAAAAGATTCAACAAACATCACAGGTCCTTCAACA ACAAACTCCCCAACAGATGCAGCAGCAATGGACGCCACAAAAACATCAAC AAGCAAACAATCAACAGTTTGCCCAACAGTCCAATTCAACGCCCAACTTC CAACAGCTTCAATATCAAAACACACCGACAAGTGGACAACCTTTCACAGC TAATTTCAATGCATCCTCGACGAAAATTGAGCGACCACATTCTTCGGCTG CACTACTCCAAGAGCGAACGCCTCAACAATCACCACAGCCTTTCAAACAA TCAACGACTATGACCCAACAAAAAGGCACTCTGCTTGCTCAAGCAATGAA TACAACCCCTCAGCCTCAGGTATCATATAAAGTAATTAGTATGAAGCTCT ATTCTACCAACGCAGTGTTCGTTCGCTaataaatttttagattttcttaa CCTGTTAATAAGCGTGAAATGGTTGTATTAATTTTCTAAAAGATCTTAGT AATCTTACAACAATAGAATCTGTGTGTGATACTGCTGGCTTTTCAATTTA AATCATCAAATCtgtaaaatgtgttttttttattcttactATATATaaca tttaaaacttttttctcaGCCTTCACCACTACCAAATAAACAAGCTCCTG CAGCCAGTATCCAACCACTTCCACCGAACCCGTCCCAACTGACCGCAGCC ATTAATATGACACATCACCGAAACTCATCTTATTCAAGAGCTATGTCATT ACCGGTGGAGTCAGCAACTGGGAAACAGGATGCAAGCTCGGATCACATGA TCAATAGATTCCATACAAAATTTGACAGTGAGCTTGAAGTCTCCACAAAT GTTGTTGGATCACCAATCCTTGAGAATCCAGCCTCACCATTCCAGAGATC AGGtataaatgtttttaattttcgagCAGCAAATTACAAACACTGCACTA TTAAttctaaaggttttattttcttCCCATTTTTTAATGATAAGTGAAGG TGTCAAAATATTATTTCGaatctttattttttccttAAGTAACTACTCAT CCCCACTTTATTAGCACTCTTTATGTTGCAAATCGTAAATTTAATAATTG CAATAATTAATTACTACACTTCCACTTGCAACTAATAAGAAGTAATTAGT TATTTATTTTACCATTCTCACATTTTTTAGACTCACTCTCTTCACCTCCA CTAACACCCAATAACAAACACTCAGCTTCACAACAAGGTACGGACATGCA CACCATTCATTCACTACCCCTTCTATTATAATATTACTGTTATTAAAAAA TCTGTAGACAATCTTTTAGTATAACTTCTTTTGTTATCTCTAAATATCTC GAATGATATCTTACGCCTTCTTCTTACAGACCCTGTGGGACCATaacaat ttttccagttggaGGGGGGACTGGAAAAATTgcccaaaatattgtcccca gtgTAAAATAAAACTCCAATTTTTGAATCGCTGaatgaaatttcttgaaa acaatTTAATTCAAATCTCCGGCCATAAAAAAACATAGGAATGTCAATCG CCATCGATATTCAGTTCGTTATTTTTTACTcaactggctgaaaaatccta tcgggtctgtgagaagtagGTTTTATCTGATTTGAAATAGCTTTTAATTA ATAAACTATTTAGAGCAACTCAACCCTTGACCGATAATCCCATATGGTAA ACCTAGCTTAAACCAAAAGAATTTTATACCTTTTTTTAAAAGCTGGTTCA GTTGACCCCTTTATCCTCCAGACATTCTGattgaacttttgaaatctcta gagagataaaaaacaaatttcaagaaACCAAATGCTTTTCATCCTCTGTC AGTACGTATCTCTCTCTAATCACATCCTTTGAGACGAGTCGGTGATTTTA ACTGTGTNTGTCAGTACGTATCTCTCTCTAATCACATCCTTTGAGATGAG TCGGTGATTTTAACTGTGTCCTTGATAAAACATGACATTTCTATTGACAT TGCGAATCTTATTTATTTACATTgaccacaaaataaaaaacaaattgaac GTAAAAACTTGATTAATGAAATGAGTTTATGATTTATGGGAGTAGAAACG TTCATTTGGAGTATCGGACTAACTTTTTGAGGCTTTCATAGTCTCTGTTT CATGCTCGTGAAATGTTGAAATTTGTTAAACTTCGAAGCAAAGTTTATCA TGTGaatctttcaaaaagtttttcatcaGGGAGCGAAGAaggtctgtttt tttttatgttaaaaattcttttgaggTTTTCAACAGTTTGTTTGTTCCCT CTTATTACACAACTTATAGGGTCCATAATGTAATATAGCCAAAGGGGACC CCCAGGGGACCCCTTTTAAAcaataagaaaaataacaaaatgggTATAGT TAATGTCGGATGTTTGTTTATGTACAAGTGTATGTGGTGtcactttttca caaaaaaatctgACTATATTTTTATATGTTTGCGTGTGTTTGCAGATGCT GTAATAAAGGGGAACAACATTGTGTTGAACTATTGGTCACAAGGTTTTTA AAAAGGAAGTGacaattgattttttaaagttttttggatTCAGTAAAATT GTTACAAAAAAGCTAACAACTTCCAATTATCCAAAGCTAATCGCTGTTCG CTGTTCGACTAAATACCAAGCAGCTTTTTATTTGAGTCATGGCTTTAAAT TGCTTGGTCAATTTTAACGATTTAGAATTGTGGAACAATGCACCGCCCTT ACACCACGCCCATCATCATACCCACCACTCTCATGAAGCACCACACACGC CCAAGCAACATGACGGTGATTGGGCGCATTTTTCACCTCAAACAGAAGAT GTACCTACATCGAGTCATCCCAATGCTGGTGTAATCTCGTCTTCNACGGT GATTGGGCGCATTTTTCACCTCAAACAGAAGATGTACCTACATCGAGTCA TCCCAATACTGGTGTAATCTCGTCTTCGGTTGAGTCGGACAATCAATTGC CACCGCCATCGAATCATATCGATATACCAAGAAAGTAAGaacgtttttct aatatttctaTTCTAATGACAGCATATTTAGGGTTTGAAAATTGAAGGTT GATAATTACACTTGTAATTATACATGGATattaccattgagtttaaagcc gcTAAAGGGGCTTAATGCTGATTAAGCTACTTATTCTCCAAAACTAATTT TACCAGTACGAAAATTATATTGTCGACTTCTAATGGACAGAAAGATTTAA TAACGGATAGCCCATGCCATAGCAAACAAGCTTCGTTAGATGTTCGCACT TGGAAACTCTATTTGAATTATTGATAGCTTTGTAATTTGATTATCGTTGA GCTGCTGtgcagaaaatgcaaaaaaaattatcttatagaaaactttttaa aagtctTAAAAATATAACGAGAAAACATGTTAAATTTATTAGAACTTAGA TGTTAAAATCTTTAACATCAAATATTGTTCACGTTTTGTTAGTAAACAGT TCTTTAATAGGGAAGCTAAAAATCTTTGAATGAAGTTGTGGTACGAGTGT GTACGAgtacttgaaaattttaaacttcCTCCACCAGTTAAAAAGGAGAT TGTATGAATTTTGAACGTCTGTGACCAAACTTTACGAGTATTTATTATTC CCTTCCTGCTTAATACCCTCTACGCAAggagggggtcaagcagtttgTAC ACGACTCCCATGAAGCTTAGAACGGTGGTGGTTCACTTTCAAAAGTGACA AAATGAAAATCTGACCTCGAAAGCAGTTAATAGATTGTGTACTTAGTGAA AGGTAGTGGTTGTCCTTTTCAAAATCAGTTAGTAGACAAAGTGTTCCGGA gtaactgcttgaactcctctGTTTACGCCTTCACTTTACCCTAAAGCCAG CAAGTTAGTATTCTCAATTCGGAATTTTTGAAGAACTGTTCGTATGCATA ACGTATTTACGTATTTACATAGTTGACGTATGCTAAACATTCTGAGCTTT GGCAGGTTGATTGCAGGTCAAATTACTAGCCGACCTTAACCAAATCCTGG GGATACACTgagcagtgccgtaggaagcattttaatattggggggggggg gccccgggggggggggggggaggggggggggggggagggggggggggggg aggggggggggggggaggggggggggggggaggggggggggggggagggg ggggggggggagggggggggggggctgaagtttagtgacgccgcgagggc caaccatggtttggcccgaggggggaaattttgaaaacttgagctctaga ttgcttgaaaatgcactcaaaacatccccttataagacaattatgacaaa ttaaaaaagaaaaactttgctttttgcaaaatagccatttttgaaaaaat tatttgggggggggggagctgaagtttagtgacgccgcgagggccaacca tggtttggcccgaggggggaaattttgaaaacttgagctctagattgctt gaaaatgcactcaaaacatccccttataagacaattatgacaaattaaaa aagaaaaactttgctttttgcaaaatagccatttttgaaaaaatttttgg ggggcatagccccccttgccccccccccagttgctacggcactgcactGA GTGAcctacacctttttttataaggaaccttaacgaGCTCCGaactctga gcctggagttccttttTTCTCCAGAAAAATTTAGCCTCAAAGCTCCTTAT CGAGCTCCTTATTCacttagctgctaagtttggactGATTTAATACAGAC GTTTATTGAATGTTGTTTCatcaatattttgatgatattttgaacttttt atttaGGTTTTTGTGAATGTGTGTAAGTTCAAGTTTAACTCTTACtgttc tcagcctgagcagtttcttaagttccttataaaacgtgttccttttaaaa aatgtgtatactTATTTGCTAAATACTCATAAAGTTTAAATCTGCAGGGA ACGTAGTTGCGGTCTAACCTACCTTTCTTGCTACTTCGTCAGCAGGTCAG CTTACTTTTTTACTACAGCTCCGTAGTAGTTTTTTGACAGTATTGAGTAA TCTACAACTTGAGAAATGAAACGTCATCACACATTCTCTCATCATTCGTC ACTGCCCAAATGAGATGTACAAGAACCTCTGCAAAGGTCAAACTGTTACA AGTTGTTAATAGAACTGTTGACAAAAGTTTATAGATGTAATTTTAATGCt gctttttttacttttgtagTGAATTTTTTCTATTCTGTGGTAATAGATTA GTAAGGCATATTGGATGTGAATTAAAACGTGTGTTGATTTACATAATTGa ttgacaaaacaaaaaaaagtttttttgagtcATAAGAGATTTTGCGGCTT GGGTTTTCTTTATCTGAATTTGTGCTACTAAAGAGCTACAGTTAATGTAT GTAGTATGAAAGAGACATAGAGttaaaaaaatagagaaaaaacggttttt aaaaaccctttttttaatCTCTATAAATATAAGAGTGGCTTATTACTGTG ATATTAGAAAAAAAGAGTGCCCTGGACTTGCGTTTTTGTTGTGATAAGCT ATAAAGAGTTAGAGTCAGAGAAAATTTGTCAATGAAGCAGTGACTTGTAT GGGCTTAGATTGAATAATTTATAGAGAATCAAGTGTTTTTTTGGTTTGGT GCCATGGATGTTCGACAATCTCGTTCAAGACCATATTATTCAAGTTATCA GTAAGTTATTGTAGGGTCAGCTATACACGCTCATGCAATGTTTATATTTT GTCCCCAGAAATTGGGGTCTGTCATTCGTCAACATTTGATACGTTTTTTC TCCTTTTCAACTTTTAATTCTGGTGGTTCTGCTACTAGTAAAACAGAGTA AGTTCTTTCGTTTACAGACTACCTGCCACTGAGTTTAAAGTGCTTTTATC GCATTCAAATTTGCTCTGAATGCTTTTCAGTCCATCTAAAATAAACGTAT AATATTAATCAATACCGAGTTTGACCCCTATAATAAAGccggatgagctg gagtttttacaagctggGATGCGATTTTCTTTGTGTGTATTTTACGGAAC AAGCACACCCGATATGttatactttcaaaaaattctctaaCCCCAAGttc cgaagtcccgagttgaactgtgccaacactctccaaagtataagcctttg aaattttgaggatGGTGACGCCTATTAGAAGGCGGTtctctgaaaaatct ttttctttaagAATTCCTTTGATAAGGGGGCCTGGAATTATTTTGGAGAa actgaaattatgacgtcacccgcaaaataactcggaaaaaataacttggg aaaaaataactcggaaattCCAGGCCCCTTCGATAAGTTTCACTGCACTA CGATATTCTAAGTGGCTGAGTCGGTTTTGCTCCAAAAGGTTCTGGAAATG TAGTACAGTAGAGGAAATTTTCCGTTCAAGGAGCTTAGGCATATTTTGTA TCAGTAGCATCAATAAGTTCAACATAGTTCGTTTCAATCGatcaaatcaa attcaaaagagGCTATTAATCTCAATATTACCTACTATGCTTATATCTCT AAGTAGTGGGTAGCTCAAAGGAAGAGCATTCAGCTACGGTGTGTTCGTGG GCTCAATTTATCGACGGGTCGCAAACTAACTATATCTCTTTTTCCCTCCA GGAGAAGCCAAACGGAGAGCATGGCGTCATCCAGCATGGCATCCAGTATC CCAGAAAGCACGAGTAGTGTTGACAGTAGTTCCGACAATGAAGAAATGAG AATCACGCAAGAACAAAGAGAATATTACACCAACCAATTCAAAAGTTTAC AACCCAATGAAGACGATGTTATCAAAGGTAACGATTATCgcaggaaaaaa tctttaaatcacACTCGTGTGAAAACTGATTTCCAAGGGTGAGATTCGGT TCGTTTTCACACTATTTGTTTACACCTTGTTGAATCAATTATCAAACTAA AAACTCAATCTGGAATCACAATCTGACTTAATTCTTCTTAAATTTGAGGT GTTTTAATCTAATACTTAAATCATCATGGTGTAAACACTAAGGGTGCTAT TTACGATTTCACACCCGTGTGAAAACGAACCGAATCTCACCCTGTGAAAT AAGTTTTCACACGAGTGTGATTTAacgattttttcctgtgtattaTGATA GTTAATGTTTTTGTCCGAAAAGTTATACGCCCTTATTTTTCGACCTCGTC CTTCCACAGCCTCAAAGCGTTTAAATAATGATGAAGTTTTGTTAATAATG ATGATTCTAGCTCATTAAACTATAACTGATTCTGTTTCAACTACagtgaa gtttttttttaactcgctggaacctctataactcgataGTTTCCTTAAAA CGAACAAGTTTGTCTTGGAGACTTCCAATGTATTTGTTTCATATCAAGTT GTATAActcattgaatttttttgtctaGGTCCCCAAGCTCGTGATTTCTT CTTGAAGTCGAATCTAGCGATGGAAACTCTTTCTAAGATCTGGTATGTAT GTTTCCCTTGTAGTAATTATCTGTCAATTATAATATATTACCCCCTCTAT ACATGTAAGGTCTTCATTCGATTGATCTTAAACAAGCTCATTACAGCTCG CTTTGGTGCTTTCAATTAGAtttgaactttttcttttcGACGAGATTTGT CAATACAGTGGAAATTTGATTATTGAAACTTGCATATATTTCTCTTTCTC AACAACCCTTAggaatttattttattaatcAAAGTTTTATTCAACCTCGT CCCTGTGTAAaacaggctttatttacgttagtgattgacgccagagaata tcctggtgttggctgatgcgagacTATCATCTCAAAGTGAGAACTTctca aacaacaaaaaagtgaCGCATTCGAAAAGCAGACAATGCCAGGGTACTAT CTGGGGTTATCAGTAATAAGCATAAATAAcagataatacgcagggaatgA GGTTGTGTTTTATTGACAAATTGTTCACAAATAATCGAATAACctcttta aattaaaaatttcaggCATCTATCAGACTTGGATAAAGATGGCGCATTGA ACTTGGAGGAGTTTCAGATTGCAATGCATCTGGTTGTGTTAATTAAACAT GGTTACGAGTTACCGATGGTTTTACCTCCTTCCCTTCTTGGTCAAGAGCA AGGTACGTTGTTAGTCTGCCGTCAAAACATGCCTGGTTATTTTAAAATAT CATAATTTGACTTTATCTTTAGATAGTTGATGATTAGCTTAAGGTTTATT TCCATCTCAAACCATTCTAAGGTTGTTGTTTTTTAGTGGTCGCTAACTGG ATttctatataatatatattcatgatatgcaccactgcaatgtcttctga cattacgtcatggaaccaatagctcattggttggaagtgacgtaaaagca gtcaatacgtcactctCAACCAATCAgttattgggtggaacggaagacat tgcaatggcgcatatcatgaatagaataTTATTTTTATCTCAAATGTCTC CTAATTGGAACAAGTTAACAATACGTTAtaatatataaaggtcagtggtt ataccttgactcgaacaaatttgtgttcgcTGCGaagggttcgagttatg gatacTCCtctgtaaaatgtttttttttaccaccgggaATCTAGTATTGT ATCCGAATCCATATAATCCGAAAACAGGTGACTTTTTATGTTTCTGTATG ACTTTTAAAACTTGTCCTTTCATTATGTCAGTCCATCAAATGGCAAGTCA AGATGGTGTGGATATGAGCGATGAAGATGAGAAATTGATTTCTGATGACG AAAAACAAGAATCTGGTGATGTACGTAACGCTCTTTACGTCTTGCTATTT ACATATTATGGAACACGATAGAGTTTCAATAGTATTCCAAGATAATTAAG ATAATATTATCCCGAATAGTTACTCCTTCTCGGTTTATAATCCGCTAAAA GTGGTGAATTTTGACAACTCAGAGAAATTGAAAGGTTTTCCTTCACTCCG CTTTTACCATGGGATTAAAAACTGTAGACGTACAGAGGAGACAAAAACGT TCTGACGATTCGCGGATAGGATATAGCGCTAGAAGTGTTGTATAGGGTAT CTTATAAAACTGTTTCTCCTTTATTTCTAGTGGTCCGCTGAATTTGATGC TACGGATGGGGTGAGTTGATTTATGGTTTAGGTCTGGCTGTACTTATAGT GCAGTGACCATtatataattatattttataGATATTTAAATGAGATTTAT CATGTGCTATAGCTCGCTGTTTCAAAATACTACAAATTTCGATTTGGTTA TTCCTTACCACATTCCTTCTCCACATCATTCCATATGATATGTAGGTGAT TTTCTGTACTgctattttcaaaagataacCTCAATCTTTCAGTTTATGGG AACCTTTACTTGAACACTCCTACTTTTTCACTGCAGGCACCAATTGATCG TGGTGAACGTATAGTGCAAACTTACGCGCAACCCTCCCCTACGTCCGTCA CCGTGCCGTCAGAAACTCGCGTACAACCCGTCTCGCACATGATCGAACAA CAACAGATCAACCATGACGACGAAAACGAATTACCTTCCTCGCCTGGTGC CTTGGCTTCTCCTAACGATGTCGCCGCGGCGGGTGGCAAAATGACAGCTA TCGCACGACCCCGTGTAACCGCTAATAAAAACGTTAATCTGATGGATGCG TCACCATGGCAGCTCCTGCCACCACCGTCCGGGAAAACTGGCAAATTCGG TGGCCCGAATGGTGGTACAACCGCGAAGAAAGCCTTGAAAATGGATAGTG TTGATAGTGAATTAGACTCGGCGGGTGTCATCAGTGATAGCGAAAATAAT AAACTGGTCTCGATTGATAATCACATGTCCCAAACGACGTCGCCGACAAA TGGCGACAGTAGTCTGGATAACCTCGACGACGACGAACATTTGACGGACG ACCACGATCACGAACGTTTGAAAGTCAAGAAAAAGGATTCGGCATATTTC AGGAATTTGTCAAAAGAGAAATCGCGTTCGATTGATAGCTTACGGTCAGA TATTTCGGAGAGTAGCATGTTTGAATGGAAGAGACAATCCATTAGACGAG AATCGAGACCAAGGTATGACTCGTTTTCCCAAAGTTGAAACAACTGAATT ATAGTGAGATTATTCTCACTGATTCTGATTTCGAtacattttgttatttt ttatatttattttaagGAAAACGTCTTCTTTGTATTATTCCAATTGCAAA ATCAATCGTTGAAGAACAAGAGTTATTCGGTAGGTAAACTTTCTCGTAAT ACTTTTTCCTTATTAGGTCATTTACAGGGGAAAGCACACACGACACACCG CAATTCGAATCACCGCCCGTCCCACCGCCACGAACGAATAAAGGACACGC CAGGGCGTCATCACTCGATTTTAATCAAATGTTCCATAATCGTTCACCTA GAGTCAGTTCTGGTGAGTGCTAATTGCATTTTCGCGGTTCATTtctctgt tgttttttttacgAGGAAAGTaagagaaaaattgaaacacTTATCAACCT TTAAAGCATTAGAACACTGGGTTCGAGTCTACTAAGATTAATACAGTTAC ATTCTCAAAGACAACGAATTCTGACctaatttttcttgtaaatttcTTTA CCAGTCCCTTCGAAAACAACCGTGCTTTTATGGGTTGATTGACGTCAAAC ATTTGAAATGctaagaaaagtgaaaaagaattgatatttttttagtcACT CGAGCATTAGATATCTGCGAGATAATTGTGCCTGAGTGGTTGTAATCTTT TAGTATTATGACATACATCAATAATAAGTAACTGACTTTCAAATCGTTTA ACGCACGTTGAATTTTCTCTTTTAGAACCGAAATTACAAGTAACGACACC AACTGACGGAACAGGCAAGAATCCGGTAAGCCCTTTGAATTCTACATTCA ATACTACATACACATTATGCTTAATTTTTGCATTATAACTTCACGTAATT TAACGCAGTAACTTcactctattcatgatatttatgacgtaatgttttcg acggaaacaccccggtttttgccagtagtggcaaattggAGCTAtagaaa aattgctcaaaatttgcCACAACTGGCAAAAATGGAGgtttttccgtaga aaacattacgtcatgaatatcaagaattctCACTATATAATATGCATGTG ATTAACATCAATTTTCAGCCACAAAAACCACCACGCTCAAATCCACCAAG CACTTCTTCAACTAATAACTCGTCTGCCGCCCCCACTGCTGCAGCCCGCC CTCGTTCGTCCAAGGGTGATGAATATCATAGGTCACGATCACTTGATGTA AG

Coding sequence (CDS) from alignment at sc0000010:226374..238625+

>TCONS_00001336 ID=TCONS_00001336|Name=TCONS_00001336|organism=Clytia hemisphaerica|type=CDS|length=13338bp|location=Sequence derived from alignment at sc0000010:226374..238625+ (Clytia hemisphaerica)
ATGGCGTCATCCAGCATGGCATCCAGTATCCCAGAAAGCACGAGTAGTGT
TGACAGTAGTTCCGACAATGAAGAAATGAGAATCACGCAAGAACAAAGAG
AATATTACACCAACCAATTCAAAAGTTTACAACCCAATGAAGACGATGTT
ATCAAAGGTCCCCAAGCTCGTGATTTCTTCTTGAAGTCGAATCTAGCGAT
GGAAACTCTTTCTAAGATCTGgCATCTATCAGACTTGGATAAAGATGGCG
CATTGAACTTGGAGGAGTTTCAGATTGCAATGCATCTGGTTGTGTTAATT
AAACATGGTTACGAGTTACCGATGGTTTTACCTCCTTCCCTTCTTGGTCA
AGAGCAAGTCCATCAAATGGCAAGTCAAGATGGTGTGGATATGAGCGATG
AAGATGAGAAATTGATTTCTGATGACGAAAAACAAGAATCTGGTGATTGG
TCCGCTGAATTTGATGCTACGGATGGGGCACCAATTGATCGTGGTGAACG
TATAGTGCAAACTTACGCGCAACCCTCCCCTACGTCCGTCACCGTGCCGT
CAGAAACTCGCGTACAACCCGTCTCGCACATGATCGAACAACAACAGATC
AACCATGACGACGAAAACGAATTACCTTCCTCGCCTGGTGCCTTGGCTTC
TCCTAACGATGTCGCCGCGGCGGGTGGCAAAATGACAGCTATCGCACGAC
CCCGTGTAACCGCTAATAAAAACGTTAATCTGATGGATGCGTCACCATGG
CAGCTCCTGCCACCACCGTCCGGGAAAACTGGCAAATTCGGTGGCCCGAA
TGGTGGTACAACCGCGAAGAAAGCCTTGAAAATGGATAGTGTTGATAGTG
AATTAGACTCGGCGGGTGTCATCAGTGATAGCGAAAATAATAAACTGGTC
TCGATTGATAATCACATGTCCCAAACGACGTCGCCGACAAATGGCGACAG
TAGTCTGGATAACCTCGACGACGACGAACATTTGACGGACGACCACGATC
ACGAACGTTTGAAAGTCAAGAAAAAGGATTCGGCATATTTCAGGAATTTG
TCAAAAGAGAAATCGCGTTCGATTGATAGCTTACGGTCAGATATTTCGGA
GAGTAGCATGTTTGAATGGAAGAGACAATCCATTAGACGAGAATCGAGAC
CAAGGTCATTTACAGGGGAAAGCACACACGACACACCGCAATTCGAATCA
CCGCCCGTCCCACCGCCACGAACGAATAAAGGACACGCCAGGGCGTCATC
ACTCGATTTTAATCAAATGTTCCATAATCGTTCACCTAGAGTCAGTTCTG
AACCGAAATTACAAGTAACGACACCAACTGACGGAACAGGCAAGAATCCG
CCACAAAAACCACCACGCTCAAATCCACCAAGCACTTCTTCAACTAATAA
CTCGTCTGCCGCCCCCACTGCTGCAGCCCGCCCTCGTTCGTCCAAGGGTG
ATGAATATCATAGGTCACGATCACTTGATGTAATGGCGTCATCCAGCATG
GCATCCAGTATCCCAGAAAGCACGAGTAGTGTTGACAGTAGTTCCGACAA
TGAAGAAATGAGAATCACGCAAGAACAAAGAGAATATTACACCAACCAAT
TCAAAAGTTTACAACCCAATGAAGACGATGTTATCAAAGGTCCCCAAGCT
CGTGATTTCTTCTTGAAGTCGAATCTAGCGATGGAAACTCTTTCTAAGAT
CTGgCATCTATCAGACTTGGATAAAGATGGCGCATTGAACTTGGAGGAGT
TTCAGATTGCAATGCATCTGGTTGTGTTAATTAAACATGGTTACGAGTTA
CCGATGGTTTTACCTCCTTCCCTTCTTGGTCAAGAGCAAGTCCATCAAAT
GGCAAGTCAAGATGGTGTGGATATGAGCGATGAAGATGAGAAATTGATTT
CTGATGACGAAAAACAAGAATCTGGTGATTGGTCCGCTGAATTTGATGCT
ACGGATGGGGCACCAATTGATCGTGGTGAACGTATAGTGCAAACTTACGC
GCAACCCTCCCCTACGTCCGTCACCGTGCCGTCAGAAACTCGCGTACAAC
CCGTCTCGCACATGATCGAACAACAACAGATCAACCATGACGACGAAAAC
GAATTACCTTCCTCGCCTGGTGCCTTGGCTTCTCCTAACGATGTCGCCGC
GGCGGGTGGCAAAATGACAGCTATCGCACGACCCCGTGTAACCGCTAATA
AAAACGTTAATCTGATGGATGCGTCACCATGGCAGCTCCTGCCACCACCG
TCCGGGAAAACTGGCAAATTCGGTGGCCCGAATGGTGGTACAACCGCGAA
GAAAGCCTTGAAAATGGATAGTGTTGATAGTGAATTAGACTCGGCGGGTG
TCATCAGTGATAGCGAAAATAATAAACTGGTCTCGATTGATAATCACATG
TCCCAAACGACGTCGCCGACAAATGGCGACAGTAGTCTGGATAACCTCGA
CGACGACGAACATTTGACGGACGACCACGATCACGAACGTTTGAAAGTCA
AGAAAAAGGATTCGGCATATTTCAGGAATTTGTCAAAAGAGAAATCGCGT
TCGATTGATAGCTTACGGTCAGATATTTCGGAGAGTAGCATGTTTGAATG
GAAGAGACAATCCATTAGACGAGAATCGAGACCAAGGTCATTTACAGGGG
AAAGCACACACGACACACCGCAATTCGAATCACCGCCCGTCCCACCGCCA
CGAACGAATAAAGGACACGCCAGGGCGTCATCACTCGATTTTAATCAAAT
GTTCCATAATCGTTCACCTAGAGTCAGTTCTGAACCGAAATTACAAGTAA
CGACACCAACTGACGGAACAGGCAAGAATCCGCCACAAAAACCACCACGC
TCAAATCCACCAAGCACTTCTTCAACTAATAACTCGTCTGCCGCCCCCAC
TGCTGCAGCCCGCCCTCGTTCGTCCAAGGGTGATGAATATCATAGGTCAC
GATCACTTGATGTAATGGCGTCATCCAGCATGGCATCCAGTATCCCAGAA
AGCACGAGTAGTGTTGACAGTAGTTCCGACAATGAAGAAATGAGAATCAC
GCAAGAACAAAGAGAATATTACACCAACCAATTCAAAAGTTTACAACCCA
ATGAAGACGATGTTATCAAAGGTCCCCAAGCTCGTGATTTCTTCTTGAAG
TCGAATCTAGCGATGGAAACTCTTTCTAAGATCTGgCATCTATCAGACTT
GGATAAAGATGGCGCATTGAACTTGGAGGAGTTTCAGATTGCAATGCATC
TGGTTGTGTTAATTAAACATGGTTACGAGTTACCGATGGTTTTACCTCCT
TCCCTTCTTGGTCAAGAGCAAGTCCATCAAATGGCAAGTCAAGATGGTGT
GGATATGAGCGATGAAGATGAGAAATTGATTTCTGATGACGAAAAACAAG
AATCTGGTGATTGGTCCGCTGAATTTGATGCTACGGATGGGGCACCAATT
GATCGTGGTGAACGTATAGTGCAAACTTACGCGCAACCCTCCCCTACGTC
CGTCACCGTGCCGTCAGAAACTCGCGTACAACCCGTCTCGCACATGATCG
AACAACAACAGATCAACCATGACGACGAAAACGAATTACCTTCCTCGCCT
GGTGCCTTGGCTTCTCCTAACGATGTCGCCGCGGCGGGTGGCAAAATGAC
AGCTATCGCACGACCCCGTGTAACCGCTAATAAAAACGTTAATCTGATGG
ATGCGTCACCATGGCAGCTCCTGCCACCACCGTCCGGGAAAACTGGCAAA
TTCGGTGGCCCGAATGGTGGTACAACCGCGAAGAAAGCCTTGAAAATGGA
TAGTGTTGATAGTGAATTAGACTCGGCGGGTGTCATCAGTGATAGCGAAA
ATAATAAACTGGTCTCGATTGATAATCACATGTCCCAAACGACGTCGCCG
ACAAATGGCGACAGTAGTCTGGATAACCTCGACGACGACGAACATTTGAC
GGACGACCACGATCACGAACGTTTGAAAGTCAAGAAAAAGGATTCGGCAT
ATTTCAGGAATTTGTCAAAAGAGAAATCGCGTTCGATTGATAGCTTACGG
TCAGATATTTCGGAGAGTAGCATGTTTGAATGGAAGAGACAATCCATTAG
ACGAGAATCGAGACCAAGGTCATTTACAGGGGAAAGCACACACGACACAC
CGCAATTCGAATCACCGCCCGTCCCACCGCCACGAACGAATAAAGGACAC
GCCAGGGCGTCATCACTCGATTTTAATCAAATGTTCCATAATCGTTCACC
TAGAGTCAGTTCTGAACCGAAATTACAAGTAACGACACCAACTGACGGAA
CAGGCAAGAATCCGCCACAAAAACCACCACGCTCAAATCCACCAAGCACT
TCTTCAACTAATAACTCGTCTGCCGCCCCCACTGCTGCAGCCCGCCCTCG
TTCGTCCAAGGGTGATGAATATCATAGGTCACGATCACTTGATGTAATGG
CGTCATCCAGCATGGCATCCAGTATCCCAGAAAGCACGAGTAGTGTTGAC
AGTAGTTCCGACAATGAAGAAATGAGAATCACGCAAGAACAAAGAGAATA
TTACACCAACCAATTCAAAAGTTTACAACCCAATGAAGACGATGTTATCA
AAGGTCCCCAAGCTCGTGATTTCTTCTTGAAGTCGAATCTAGCGATGGAA
ACTCTTTCTAAGATCTGgCATCTATCAGACTTGGATAAAGATGGCGCATT
GAACTTGGAGGAGTTTCAGATTGCAATGCATCTGGTTGTGTTAATTAAAC
ATGGTTACGAGTTACCGATGGTTTTACCTCCTTCCCTTCTTGGTCAAGAG
CAAGTCCATCAAATGGCAAGTCAAGATGGTGTGGATATGAGCGATGAAGA
TGAGAAATTGATTTCTGATGACGAAAAACAAGAATCTGGTGATTGGTCCG
CTGAATTTGATGCTACGGATGGGGCACCAATTGATCGTGGTGAACGTATA
GTGCAAACTTACGCGCAACCCTCCCCTACGTCCGTCACCGTGCCGTCAGA
AACTCGCGTACAACCCGTCTCGCACATGATCGAACAACAACAGATCAACC
ATGACGACGAAAACGAATTACCTTCCTCGCCTGGTGCCTTGGCTTCTCCT
AACGATGTCGCCGCGGCGGGTGGCAAAATGACAGCTATCGCACGACCCCG
TGTAACCGCTAATAAAAACGTTAATCTGATGGATGCGTCACCATGGCAGC
TCCTGCCACCACCGTCCGGGAAAACTGGCAAATTCGGTGGCCCGAATGGT
GGTACAACCGCGAAGAAAGCCTTGAAAATGGATAGTGTTGATAGTGAATT
AGACTCGGCGGGTGTCATCAGTGATAGCGAAAATAATAAACTGGTCTCGA
TTGATAATCACATGTCCCAAACGACGTCGCCGACAAATGGCGACAGTAGT
CTGGATAACCTCGACGACGACGAACATTTGACGGACGACCACGATCACGA
ACGTTTGAAAGTCAAGAAAAAGGATTCGGCATATTTCAGGAATTTGTCAA
AAGAGAAATCGCGTTCGATTGATAGCTTACGGTCAGATATTTCGGAGAGT
AGCATGTTTGAATGGAAGAGACAATCCATTAGACGAGAATCGAGACCAAG
GTCATTTACAGGGGAAAGCACACACGACACACCGCAATTCGAATCACCGC
CCGTCCCACCGCCACGAACGAATAAAGGACACGCCAGGGCGTCATCACTC
GATTTTAATCAAATGTTCCATAATCGTTCACCTAGAGTCAGTTCTGAACC
GAAATTACAAGTAACGACACCAACTGACGGAACAGGCAAGAATCCGCCAC
AAAAACCACCACGCTCAAATCCACCAAGCACTTCTTCAACTAATAACTCG
TCTGCCGCCCCCACTGCTGCAGCCCGCCCTCGTTCGTCCAAGGGTGATGA
ATATCATAGGTCACGATCACTTGATGTAATGGCGTCATCCAGCATGGCAT
CCAGTATCCCAGAAAGCACGAGTAGTGTTGACAGTAGTTCCGACAATGAA
GAAATGAGAATCACGCAAGAACAAAGAGAATATTACACCAACCAATTCAA
AAGTTTACAACCCAATGAAGACGATGTTATCAAAGGTCCCCAAGCTCGTG
ATTTCTTCTTGAAGTCGAATCTAGCGATGGAAACTCTTTCTAAGATCTGg
CATCTATCAGACTTGGATAAAGATGGCGCATTGAACTTGGAGGAGTTTCA
GATTGCAATGCATCTGGTTGTGTTAATTAAACATGGTTACGAGTTACCGA
TGGTTTTACCTCCTTCCCTTCTTGGTCAAGAGCAAGTCCATCAAATGGCA
AGTCAAGATGGTGTGGATATGAGCGATGAAGATGAGAAATTGATTTCTGA
TGACGAAAAACAAGAATCTGGTGATTGGTCCGCTGAATTTGATGCTACGG
ATGGGGCACCAATTGATCGTGGTGAACGTATAGTGCAAACTTACGCGCAA
CCCTCCCCTACGTCCGTCACCGTGCCGTCAGAAACTCGCGTACAACCCGT
CTCGCACATGATCGAACAACAACAGATCAACCATGACGACGAAAACGAAT
TACCTTCCTCGCCTGGTGCCTTGGCTTCTCCTAACGATGTCGCCGCGGCG
GGTGGCAAAATGACAGCTATCGCACGACCCCGTGTAACCGCTAATAAAAA
CGTTAATCTGATGGATGCGTCACCATGGCAGCTCCTGCCACCACCGTCCG
GGAAAACTGGCAAATTCGGTGGCCCGAATGGTGGTACAACCGCGAAGAAA
GCCTTGAAAATGGATAGTGTTGATAGTGAATTAGACTCGGCGGGTGTCAT
CAGTGATAGCGAAAATAATAAACTGGTCTCGATTGATAATCACATGTCCC
AAACGACGTCGCCGACAAATGGCGACAGTAGTCTGGATAACCTCGACGAC
GACGAACATTTGACGGACGACCACGATCACGAACGTTTGAAAGTCAAGAA
AAAGGATTCGGCATATTTCAGGAATTTGTCAAAAGAGAAATCGCGTTCGA
TTGATAGCTTACGGTCAGATATTTCGGAGAGTAGCATGTTTGAATGGAAG
AGACAATCCATTAGACGAGAATCGAGACCAAGGTCATTTACAGGGGAAAG
CACACACGACACACCGCAATTCGAATCACCGCCCGTCCCACCGCCACGAA
CGAATAAAGGACACGCCAGGGCGTCATCACTCGATTTTAATCAAATGTTC
CATAATCGTTCACCTAGAGTCAGTTCTGAACCGAAATTACAAGTAACGAC
ACCAACTGACGGAACAGGCAAGAATCCGCCACAAAAACCACCACGCTCAA
ATCCACCAAGCACTTCTTCAACTAATAACTCGTCTGCCGCCCCCACTGCT
GCAGCCCGCCCTCGTTCGTCCAAGGGTGATGAATATCATAGGTCACGATC
ACTTGATGTAATGGCGTCATCCAGCATGGCATCCAGTATCCCAGAAAGCA
CGAGTAGTGTTGACAGTAGTTCCGACAATGAAGAAATGAGAATCACGCAA
GAACAAAGAGAATATTACACCAACCAATTCAAAAGTTTACAACCCAATGA
AGACGATGTTATCAAAGGTCCCCAAGCTCGTGATTTCTTCTTGAAGTCGA
ATCTAGCGATGGAAACTCTTTCTAAGATCTGgCATCTATCAGACTTGGAT
AAAGATGGCGCATTGAACTTGGAGGAGTTTCAGATTGCAATGCATCTGGT
TGTGTTAATTAAACATGGTTACGAGTTACCGATGGTTTTACCTCCTTCCC
TTCTTGGTCAAGAGCAAGTCCATCAAATGGCAAGTCAAGATGGTGTGGAT
ATGAGCGATGAAGATGAGAAATTGATTTCTGATGACGAAAAACAAGAATC
TGGTGATTGGTCCGCTGAATTTGATGCTACGGATGGGGCACCAATTGATC
GTGGTGAACGTATAGTGCAAACTTACGCGCAACCCTCCCCTACGTCCGTC
ACCGTGCCGTCAGAAACTCGCGTACAACCCGTCTCGCACATGATCGAACA
ACAACAGATCAACCATGACGACGAAAACGAATTACCTTCCTCGCCTGGTG
CCTTGGCTTCTCCTAACGATGTCGCCGCGGCGGGTGGCAAAATGACAGCT
ATCGCACGACCCCGTGTAACCGCTAATAAAAACGTTAATCTGATGGATGC
GTCACCATGGCAGCTCCTGCCACCACCGTCCGGGAAAACTGGCAAATTCG
GTGGCCCGAATGGTGGTACAACCGCGAAGAAAGCCTTGAAAATGGATAGT
GTTGATAGTGAATTAGACTCGGCGGGTGTCATCAGTGATAGCGAAAATAA
TAAACTGGTCTCGATTGATAATCACATGTCCCAAACGACGTCGCCGACAA
ATGGCGACAGTAGTCTGGATAACCTCGACGACGACGAACATTTGACGGAC
GACCACGATCACGAACGTTTGAAAGTCAAGAAAAAGGATTCGGCATATTT
CAGGAATTTGTCAAAAGAGAAATCGCGTTCGATTGATAGCTTACGGTCAG
ATATTTCGGAGAGTAGCATGTTTGAATGGAAGAGACAATCCATTAGACGA
GAATCGAGACCAAGGTCATTTACAGGGGAAAGCACACACGACACACCGCA
ATTCGAATCACCGCCCGTCCCACCGCCACGAACGAATAAAGGACACGCCA
GGGCGTCATCACTCGATTTTAATCAAATGTTCCATAATCGTTCACCTAGA
GTCAGTTCTGAACCGAAATTACAAGTAACGACACCAACTGACGGAACAGG
CAAGAATCCGCCACAAAAACCACCACGCTCAAATCCACCAAGCACTTCTT
CAACTAATAACTCGTCTGCCGCCCCCACTGCTGCAGCCCGCCCTCGTTCG
TCCAAGGGTGATGAATATCATAGGTCACGATCACTTGATGTAATGGCGTC
ATCCAGCATGGCATCCAGTATCCCAGAAAGCACGAGTAGTGTTGACAGTA
GTTCCGACAATGAAGAAATGAGAATCACGCAAGAACAAAGAGAATATTAC
ACCAACCAATTCAAAAGTTTACAACCCAATGAAGACGATGTTATCAAAGG
TCCCCAAGCTCGTGATTTCTTCTTGAAGTCGAATCTAGCGATGGAAACTC
TTTCTAAGATCTGgCATCTATCAGACTTGGATAAAGATGGCGCATTGAAC
TTGGAGGAGTTTCAGATTGCAATGCATCTGGTTGTGTTAATTAAACATGG
TTACGAGTTACCGATGGTTTTACCTCCTTCCCTTCTTGGTCAAGAGCAAG
TCCATCAAATGGCAAGTCAAGATGGTGTGGATATGAGCGATGAAGATGAG
AAATTGATTTCTGATGACGAAAAACAAGAATCTGGTGATTGGTCCGCTGA
ATTTGATGCTACGGATGGGGCACCAATTGATCGTGGTGAACGTATAGTGC
AAACTTACGCGCAACCCTCCCCTACGTCCGTCACCGTGCCGTCAGAAACT
CGCGTACAACCCGTCTCGCACATGATCGAACAACAACAGATCAACCATGA
CGACGAAAACGAATTACCTTCCTCGCCTGGTGCCTTGGCTTCTCCTAACG
ATGTCGCCGCGGCGGGTGGCAAAATGACAGCTATCGCACGACCCCGTGTA
ACCGCTAATAAAAACGTTAATCTGATGGATGCGTCACCATGGCAGCTCCT
GCCACCACCGTCCGGGAAAACTGGCAAATTCGGTGGCCCGAATGGTGGTA
CAACCGCGAAGAAAGCCTTGAAAATGGATAGTGTTGATAGTGAATTAGAC
TCGGCGGGTGTCATCAGTGATAGCGAAAATAATAAACTGGTCTCGATTGA
TAATCACATGTCCCAAACGACGTCGCCGACAAATGGCGACAGTAGTCTGG
ATAACCTCGACGACGACGAACATTTGACGGACGACCACGATCACGAACGT
TTGAAAGTCAAGAAAAAGGATTCGGCATATTTCAGGAATTTGTCAAAAGA
GAAATCGCGTTCGATTGATAGCTTACGGTCAGATATTTCGGAGAGTAGCA
TGTTTGAATGGAAGAGACAATCCATTAGACGAGAATCGAGACCAAGGTCA
TTTACAGGGGAAAGCACACACGACACACCGCAATTCGAATCACCGCCCGT
CCCACCGCCACGAACGAATAAAGGACACGCCAGGGCGTCATCACTCGATT
TTAATCAAATGTTCCATAATCGTTCACCTAGAGTCAGTTCTGAACCGAAA
TTACAAGTAACGACACCAACTGACGGAACAGGCAAGAATCCGCCACAAAA
ACCACCACGCTCAAATCCACCAAGCACTTCTTCAACTAATAACTCGTCTG
CCGCCCCCACTGCTGCAGCCCGCCCTCGTTCGTCCAAGGGTGATGAATAT
CATAGGTCACGATCACTTGATGTAATGGCGTCATCCAGCATGGCATCCAG
TATCCCAGAAAGCACGAGTAGTGTTGACAGTAGTTCCGACAATGAAGAAA
TGAGAATCACGCAAGAACAAAGAGAATATTACACCAACCAATTCAAAAGT
TTACAACCCAATGAAGACGATGTTATCAAAGGTCCCCAAGCTCGTGATTT
CTTCTTGAAGTCGAATCTAGCGATGGAAACTCTTTCTAAGATCTGgCATC
TATCAGACTTGGATAAAGATGGCGCATTGAACTTGGAGGAGTTTCAGATT
GCAATGCATCTGGTTGTGTTAATTAAACATGGTTACGAGTTACCGATGGT
TTTACCTCCTTCCCTTCTTGGTCAAGAGCAAGTCCATCAAATGGCAAGTC
AAGATGGTGTGGATATGAGCGATGAAGATGAGAAATTGATTTCTGATGAC
GAAAAACAAGAATCTGGTGATTGGTCCGCTGAATTTGATGCTACGGATGG
GGCACCAATTGATCGTGGTGAACGTATAGTGCAAACTTACGCGCAACCCT
CCCCTACGTCCGTCACCGTGCCGTCAGAAACTCGCGTACAACCCGTCTCG
CACATGATCGAACAACAACAGATCAACCATGACGACGAAAACGAATTACC
TTCCTCGCCTGGTGCCTTGGCTTCTCCTAACGATGTCGCCGCGGCGGGTG
GCAAAATGACAGCTATCGCACGACCCCGTGTAACCGCTAATAAAAACGTT
AATCTGATGGATGCGTCACCATGGCAGCTCCTGCCACCACCGTCCGGGAA
AACTGGCAAATTCGGTGGCCCGAATGGTGGTACAACCGCGAAGAAAGCCT
TGAAAATGGATAGTGTTGATAGTGAATTAGACTCGGCGGGTGTCATCAGT
GATAGCGAAAATAATAAACTGGTCTCGATTGATAATCACATGTCCCAAAC
GACGTCGCCGACAAATGGCGACAGTAGTCTGGATAACCTCGACGACGACG
AACATTTGACGGACGACCACGATCACGAACGTTTGAAAGTCAAGAAAAAG
GATTCGGCATATTTCAGGAATTTGTCAAAAGAGAAATCGCGTTCGATTGA
TAGCTTACGGTCAGATATTTCGGAGAGTAGCATGTTTGAATGGAAGAGAC
AATCCATTAGACGAGAATCGAGACCAAGGTCATTTACAGGGGAAAGCACA
CACGACACACCGCAATTCGAATCACCGCCCGTCCCACCGCCACGAACGAA
TAAAGGACACGCCAGGGCGTCATCACTCGATTTTAATCAAATGTTCCATA
ATCGTTCACCTAGAGTCAGTTCTGAACCGAAATTACAAGTAACGACACCA
ACTGACGGAACAGGCAAGAATCCGCCACAAAAACCACCACGCTCAAATCC
ACCAAGCACTTCTTCAACTAATAACTCGTCTGCCGCCCCCACTGCTGCAG
CCCGCCCTCGTTCGTCCAAGGGTGATGAATATCATAGGTCACGATCACTT
GATGTAATGGCGTCATCCAGCATGGCATCCAGTATCCCAGAAAGCACGAG
TAGTGTTGACAGTAGTTCCGACAATGAAGAAATGAGAATCACGCAAGAAC
AAAGAGAATATTACACCAACCAATTCAAAAGTTTACAACCCAATGAAGAC
GATGTTATCAAAGGTCCCCAAGCTCGTGATTTCTTCTTGAAGTCGAATCT
AGCGATGGAAACTCTTTCTAAGATCTGgCATCTATCAGACTTGGATAAAG
ATGGCGCATTGAACTTGGAGGAGTTTCAGATTGCAATGCATCTGGTTGTG
TTAATTAAACATGGTTACGAGTTACCGATGGTTTTACCTCCTTCCCTTCT
TGGTCAAGAGCAAGTCCATCAAATGGCAAGTCAAGATGGTGTGGATATGA
GCGATGAAGATGAGAAATTGATTTCTGATGACGAAAAACAAGAATCTGGT
GATTGGTCCGCTGAATTTGATGCTACGGATGGGGCACCAATTGATCGTGG
TGAACGTATAGTGCAAACTTACGCGCAACCCTCCCCTACGTCCGTCACCG
TGCCGTCAGAAACTCGCGTACAACCCGTCTCGCACATGATCGAACAACAA
CAGATCAACCATGACGACGAAAACGAATTACCTTCCTCGCCTGGTGCCTT
GGCTTCTCCTAACGATGTCGCCGCGGCGGGTGGCAAAATGACAGCTATCG
CACGACCCCGTGTAACCGCTAATAAAAACGTTAATCTGATGGATGCGTCA
CCATGGCAGCTCCTGCCACCACCGTCCGGGAAAACTGGCAAATTCGGTGG
CCCGAATGGTGGTACAACCGCGAAGAAAGCCTTGAAAATGGATAGTGTTG
ATAGTGAATTAGACTCGGCGGGTGTCATCAGTGATAGCGAAAATAATAAA
CTGGTCTCGATTGATAATCACATGTCCCAAACGACGTCGCCGACAAATGG
CGACAGTAGTCTGGATAACCTCGACGACGACGAACATTTGACGGACGACC
ACGATCACGAACGTTTGAAAGTCAAGAAAAAGGATTCGGCATATTTCAGG
AATTTGTCAAAAGAGAAATCGCGTTCGATTGATAGCTTACGGTCAGATAT
TTCGGAGAGTAGCATGTTTGAATGGAAGAGACAATCCATTAGACGAGAAT
CGAGACCAAGGTCATTTACAGGGGAAAGCACACACGACACACCGCAATTC
GAATCACCGCCCGTCCCACCGCCACGAACGAATAAAGGACACGCCAGGGC
GTCATCACTCGATTTTAATCAAATGTTCCATAATCGTTCACCTAGAGTCA
GTTCTGAACCGAAATTACAAGTAACGACACCAACTGACGGAACAGGCAAG
AATCCGCCACAAAAACCACCACGCTCAAATCCACCAAGCACTTCTTCAAC
TAATAACTCGTCTGCCGCCCCCACTGCTGCAGCCCGCCCTCGTTCGTCCA
AGGGTGATGAATATCATAGGTCACGATCACTTGATGTA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000722XLOC_000722Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001336-exon-sc0000010-1491911889:226374..226584TCONS_00001336-exon-sc0000010-1491911889:226374..226584Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:226374..226584TCONS_00001336-exon-sc0000010-1510915933:226374..226584Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:226374..226584TCONS_00001336-exon-sc0000010-1575043694:226374..226584Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:226991..227592TCONS_00001336-exon-sc0000010-1491911889:226991..227592Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:226991..227592TCONS_00001336-exon-sc0000010-1510915933:226991..227592Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:226991..227592TCONS_00001336-exon-sc0000010-1575043694:226991..227592Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:227843..228125TCONS_00001336-exon-sc0000010-1491911889:227843..228125Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:227843..228125TCONS_00001336-exon-sc0000010-1510915933:227843..228125Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:227843..228125TCONS_00001336-exon-sc0000010-1575043694:227843..228125Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:228404..228460TCONS_00001336-exon-sc0000010-1491911889:228404..228460Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:228404..228460TCONS_00001336-exon-sc0000010-1510915933:228404..228460Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:228404..228460TCONS_00001336-exon-sc0000010-1575043694:228404..228460Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:229949..230257TCONS_00001336-exon-sc0000010-1491911889:229949..230257Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:229949..230257TCONS_00001336-exon-sc0000010-1510915933:229949..230257Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:229949..230257TCONS_00001336-exon-sc0000010-1575043694:229949..230257Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:233925..234100TCONS_00001336-exon-sc0000010-1491911889:233925..234100Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:233925..234100TCONS_00001336-exon-sc0000010-1510915933:233925..234100Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:233925..234100TCONS_00001336-exon-sc0000010-1575043694:233925..234100Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:234702..234765TCONS_00001336-exon-sc0000010-1491911889:234702..234765Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:234702..234765TCONS_00001336-exon-sc0000010-1510915933:234702..234765Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:234702..234765TCONS_00001336-exon-sc0000010-1575043694:234702..234765Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:235289..235425TCONS_00001336-exon-sc0000010-1491911889:235289..235425Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:235289..235425TCONS_00001336-exon-sc0000010-1510915933:235289..235425Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:235289..235425TCONS_00001336-exon-sc0000010-1575043694:235289..235425Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:236005..236093TCONS_00001336-exon-sc0000010-1491911889:236005..236093Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:236005..236093TCONS_00001336-exon-sc0000010-1510915933:236005..236093Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:236005..236093TCONS_00001336-exon-sc0000010-1575043694:236005..236093Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:236404..236433TCONS_00001336-exon-sc0000010-1491911889:236404..236433Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:236404..236433TCONS_00001336-exon-sc0000010-1510915933:236404..236433Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:236404..236433TCONS_00001336-exon-sc0000010-1575043694:236404..236433Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:236710..237386TCONS_00001336-exon-sc0000010-1491911889:236710..237386Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:236710..237386TCONS_00001336-exon-sc0000010-1510915933:236710..237386Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:236710..237386TCONS_00001336-exon-sc0000010-1575043694:236710..237386Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:237590..237735TCONS_00001336-exon-sc0000010-1491911889:237590..237735Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:237590..237735TCONS_00001336-exon-sc0000010-1510915933:237590..237735Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:237590..237735TCONS_00001336-exon-sc0000010-1575043694:237590..237735Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:238149..238198TCONS_00001336-exon-sc0000010-1491911889:238149..238198Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:238149..238198TCONS_00001336-exon-sc0000010-1510915933:238149..238198Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:238149..238198TCONS_00001336-exon-sc0000010-1575043694:238149..238198Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1491911889:238492..238625TCONS_00001336-exon-sc0000010-1491911889:238492..238625Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1510915933:238492..238625TCONS_00001336-exon-sc0000010-1510915933:238492..238625Clytia hemisphaericaexon
TCONS_00001336-exon-sc0000010-1575043694:238492..238625TCONS_00001336-exon-sc0000010-1575043694:238492..238625Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001336-proteinTCONS_00001336-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:226374..238625 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.6441 13.6413 6.26029 7.57723 39.3528 29.7879 27.3675 31.4503 12.1447 17.4115 10.6413 8.66142 9.51883 10.4007 10.6179 9.14658 12.7318 11.7359 10.1053 10.0924 7.99621 12.155 12.5141 12.9356 15.4455 15.7188 11.6731 9.26541 13.6055 15.8612
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000261EH_dom
IPR018247EF_Hand_1_Ca_BS
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005509 calcium ion binding
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001336 vs. Swiss-Prot (Human)
Match: REPS2 (RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens GN=REPS2 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 5.639e-25
Identity = 53/92 (57.61%), Postives = 64/92 (69.57%), Query Frame = 3
Query: 1548 NEEMRITQEQREYYTNQFKSLQPNEDDVIKGPQARDFFLKSNLAMETLSKIWHLSDLDKDGALNLEEFQIAMHLVVLIKHGYELPMVLPPSL 1823
            +E  RIT+EQREYY NQF+SLQP+    I G  A++FF KS L++  LS IW LSD D DGAL L EF  A HL+V  K+GY LP  LPP+L
Sbjct:  273 DEPWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTL 364          
The following BLAST results are available for this feature:
BLAST of TCONS_00001336 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
REPS25.639e-2557.61RalBP1-associated Eps domain-containing protein 2 ... [more]
back to top