Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001335 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001335
Unique NameTCONS_00001335
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length932

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001335 ID=TCONS_00001335|Name=TCONS_00001335|organism=Clytia hemisphaerica|type=transcript|length=932bp
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
CTGAGGCCACACTGCAACAAGTTACTGACGTCATCAGATTcgtttgttga
aaattttcactctgtgaaaaattgtaaatagtgTATTAAAATTATAAAAC
ATAACAAAGGGTTTGCTAGATTAGAAACCTAAATAATTTTTAACTGTTTT
CGATTTAATTGCTACTTATCTTTTATTTGAAC
Run BLAST on NCBI

protein sequence of TCONS_00001335-protein

>TCONS_00001335-protein ID=TCONS_00001335-protein|Name=TCONS_00001335-protein|organism=Clytia hemisphaerica|type=polypeptide|length=249bp
GGGDNNKVEGAEPHATPNKDGGNSDENLIHVQPKKVSGFISPIHSSIRCD
GTQTVPRTPSGGKAQNKILISATINFHNKQKKMAAQDSIQDTRTELADLL
KKKEELAVSLANLERQIYAFEGSYLEDTQLYGNIIRGWDRLLSQKATGPN
QKIEKRNRKFKESERLFSKSSITSAAAVAGMVQQDDKKENIDRIDSTLHH
SHGEHSGKIMKNSHIRKKKSSKHRIELKLKKGLSKNREVDIDGDEAFDN
Run BLAST on NCBI

transcript from alignment at sc0000010:201773..213990+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001335 ID=TCONS_00001335|Name=TCONS_00001335|organism=Clytia hemisphaerica|type=transcript|length=12218bp|location=Sequence derived from alignment at sc0000010:201773..213990+ (Clytia hemisphaerica)
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg aagaagaaagaagagCTTGCTGTAagtatttttagtttgaaagTAAGAAG GAAATTGCCAATAAAAGAATATGTTTGTTGAGAAATGGTTTTTGAGGTGT GCTTCAGTTTGGCCAGTTGCATagaattgggccattccagaaaaaaaaat taccccctaccgtagagtcgtttaatatcgacatgtgtcttgttatttcg acatagctgtaggctggtcttcgaaataaaaaatcaaacataaacaaata cataccaaagttatcaatcaatcactaaattgtactccatagtgtcctcc cccccctttataaagggggggggaccaattttccaattttgaatgggtga ggggggaaaatgaaaatttgaatagtaaagcgGGGGAaaaacatcgatag ttggcaaatttggtggggggaagtgtgaaatcacttcaattttatctcag TAACCAAGATCATGTGAtttagatcatgattgaaaaattaaccaattttc tttctattttgtctagtattccttttgcagcaaaatttacgtttgtgtca ggttgaaatttgagaaatttatacgggtatatggggggaaaatgatattt tcagaattttctggggggaaagcaaaaaagaggggggaaactaaaaaact gaaaagtcatagatagggggaaaaaaagaggggggagatttaaaaaaatc aggaatttggtggggggaacaaaccctggaggacactatgtacTCTCCCT ATCATTTCACAcgtcatagaccttttttcaaagagaatgtcctgttgaat aattatgtagtccagccataaaaaNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttgtaataattatgc atggttttatcattgtttttctgctggactacataattattcaacagggt ggcctctttgaaaaaaggtctattgttgaAATGTAATAAGAAACTTGAAG TgggttttttttcgaaaagaaaactttaacgatgtataTAGTCACTAGAA ACTAATTtgtaattagcatgctttcattgtCATTCAACGGAACGAAGATA TCCAAATAAATCAAATCAACACTTTGCACGCTAgtaattttttagtagac ctttttaccgtgaaccgaaaataataaaaagaacccggtttccttttgaa tttaatctGACCGTcatactggccatcacggcgtgcggcctcttagcgcc tagagcgtgtgtttttgataaataaggaaggggaaaccaggctaagcgca caaattatttttatcacgtgacttgaagcgtaataaaattgtaaaatttt gatgatgGGCACGAGAAAGTTAcaaggaagtttgcatgcgtttcgtgtgc tgtgtaaaactgctcataatttggctgtttttttaattgaaaggattgca atgtttattggacttctagtttgatggatgaacttgtttgataagaatga taccaagaattttattcaaggtttgttttgattattttacagatccggtg tcgactttagaagacgcatgtcgatattagacgattctacggtaatggat gacatcaatttttgaaataaattttggcacggaattccaggcaaactttg aagagaaagtatcggaattccatgaattttacttaattttgcattaaagt attggaattccatgatttttttaggttacagtaacggaattccacggttt tgataggtattttgtaaatttgttacagAAATTCCgaactttcttgaaag caatttgctacggaaattccatgtcgtccattggggggtaacgaataaaa aactggaatggcccattgacAGTTGCAAAATTCTGCTAATTTTTTCGCAA CGCTTCCAAAAAAAGGTGCCTAAAAGCTGCGCTACAAAGTATGCAACGCT TCCAATCAAAGTCTGTGATTGAAAACTTTGAATACcagagtatttttttt ttgaatgacaGTCAAAATCAGGCAATATTATAGATAGTCTGGGAAAATCC TTCAAATTGCACGCAACATCTGAGAGTCCCCTCtgttagcaactccagaa gtcatgcaactttcgttgacgtcaaaccaaatgtttcatttttcggTGAA CTTTGAaccttttgaactttttttctatgtatgctaacgCGTTCctgttt ttactaaatgaaagcccgtgatcttagctttccagcggtatataacactg tggacacgggctagacggcaaattggtaaaatgccgaacgttttgcaaaa ttttgaatattgtttgccgaagggagaaaaaaaattgcaactattgatga acaaatgtgtccggaaacggaggaaaatgtatttgaaggctgaaactttt tatgtttatcagaaaaagggtgaggaattcaaaaatcacattcactaatt ttagttctttcattttcatgtagtttttttcacttttttgcttcttttgc atgggaatgtcccaaaaaaaagtttttatgtctgccgaaatggattttct tttcatttggggtttctcctttcaggaaaacttattctttactcataagt ttttgttcctccatttccagaggccccttgaaaatgggccctaccacctt ttttgacacatttcaaccttttccaagctacttttcttcaaaaacaaaaa taaaacaatgcaatgtcttctttttcaaaaaaatatatatctttcgttat tttgataaatatactaaatattttacaaatatttttatgtaataatattc taacaccatcaaagaattctccctccaaatttcaggtctctagctacact agaaaaagagatatgcaaaattgaagaagcaagactggaaaatttctttt ttttcttttttgatacattttttcgaatttttccaagctattttttgaca tttttagtcaaatttttgacactaaaatttgaatatctttacaaccactt atcctctggaggcctatgacccctcattttctttctttttcaaagctcta caagataggataggttttgaaaaaaaaattaaaatttgaaaaatcttctg gagttgctacctCTGTCTGCGTGTCCAGTCAGGGACCAATCTAGTTTAAC CTagtacaaaaacaaacctcaaaaaaaaaggttaaaattaTTAAAGTGAA GAAAAGTTAGAGGGGAAACTTCAGGTGGTAAGATCATCACTGATGCCGAA ATTTTCTCAGAAGACGCCAACATTTGggtgtttaaaataaaaatggcaAT TACAGTATTGCTCTTTTTTGCAATTATTgtcgaaaacggcaattttttca acgatgaaatgctgaatcagcagaaaagtaaaaaaagtaaataaatgaaa attgctgttttcggcaattattgccgctttgggaaataaaagttgatttt attattgagcacgtggtatttgacactcTCGCAATAAATAGGTCCACTGT GCCTCcttcagttttgttttcaactggtttttgccggaaatgcagatagc aaaatcgagtcatatgtaaacaaacttacGACGAGggttttgttttcctt ttctgactgtgtttcggcatcgatgcaggatcctTGTTGcatattatttt agaatttttcatgttattgagcaatgaaaaattgaaaaaatcacttttaa aaatctgaaaaaccttTTCCTTgatgcaattttacaattttcaaacacct ctgacatctttgcccttataaggacgacaaattttgctgactctgcattt catcgttgaaaaaatttccgttttcggcaataattgctaaaaagagcaat aattgctgtttttatcttaaacacccaactggcCAATCCTGCCAAATTTC TAGTCAATTAGATaactatttcaaaagttatcaaaaatatttgttttgat gcaCGCAGGGCTAATCTTGTATTAATCTTAAATCATAAATCgttgaaaag aatttaaaaagttgaaaaagttaaaaatgaaaaagaaaaagatcctTCTT CGTGTTAGAAACTTTATTATTAGTATAGAGATACTTTGTAGCCTCCTGAT TTCGCCTTTATGATTATTTATACGTTCTAAATTGAAAGTAACATCATCTG GAAGGTAGCTCGTTGGAGTTAAACACCCTACTTTTTGCAGGTGTGTTTTC AATTCGGTGGGCcttcttctttttaattttcaatgcaATATTGTTGGTCA TGATTTTCTTATCAGCAATCAATTATATAATACATACTATTTCGccttgt ttatgattttttgaacgTATATCATTGATGAAAGTGACAGCCTCTAGAAA GTAGCTCGTTTGAGTTAAACACTCTGCTTTTTGCTGTTTTCAAATTCAAC GAGTCATCttctttgtaaatttgttaTGTGCAATCAATATTGTATTCTTC TTTACCAGGTCAGTTTGGCCAACCTTGAACGACAAATTTATGCATTCGAA GGAAGCTACCTTGAAGATACACAATTGTATGGAAATATAATCCGAGGATG GGATCGACTGCTCTCTCAGAAGTGAGTATCTAATAGTCGTACGTTTTTGT AATAGAACTAAATAGATTGGATTGAATAGGATTCCTTATTGTTACTATTC CTGAAAAAGAAATCCTGATAAAGTCCCCTGTTGTGGATGTCCAATCTTTA AGTTAACTTTGACAACCTAAAAATGCTGCAACTTAAGTAACTTCCCTTGA AATTCCAGAAAGTTTAAGGTTTAAAATTCCAAAGGGCGAACTTTTATCAG TTTTTAATACATAATGACTGGTGAGGGCTTTACTGAGATGTATTGCTCGA GGTCAAATATCGAACCGAGCTCGCCaggtttctttgaaaatacagtGAAG tgtccataactcgaacctctgtaAGCCAgctgtctctttaactcgagcaA CTTTGCTGGTCCCTCCGGTTAACAATTCCTTAAAAACCTTAacccataac tcaaaatttccttaactgTAGAAAGGGGATTGAAGGAAACGAATTAGTTT CAATAATGGCAAAGGCCACATCTAAATATATTGTTTGTAATACATTAGat ctaaatgaaaagaaagaagaatataAACTAATCTGAACATCTCCCCTTCC CGGAGAGGTCATGGCCACTGTAGATAGTGTTcggtttctttttatatata cagTTCAACGTTTCTTTATATATATATACAGTTCAACGTTTCTTTATATA CAGTTCAATGGCTCTTTCCCCTATCGGCGGGGAGCAAGTGGTTGTTGTTC CAAGAGGCCAGGCGCGTTATGAGATGCTAATCGTCGTAGGATATTTGATG ACGATCTGGTAACTGTTGCTTGTGTTGAATGTGCTGGCTGAGGCTGAGCG GGCATAGGAACTGTTGGATGAGGAATAGTTGGAGGAGTAGTCTCTAATAG TGANTTGGATGAGGAATAGTTGGAGGAGTGGTCTCTAATGGTGAGGCTGG AAGCAGATTGGTGGGTGTGGGTAGTGCTGTTGGTGATACAAATGTTGCTG GTCGAAGGAAGCGACGATTTTGCAGTGTCACCCTCCCTGAGCCATTGGTT CTGACTGTATTGTCTGTTAGGGAGTGTTTCTACAATTATccagtgttaaa agttcttccgtctcagacggatttccgtctcagcgAAGTATAATAAAAGG CTTTTCTGTCTCAAAATcctgcataattcaccaaaagttcaagaatatgt gctaattttctgtgtaaaatccattttccgtctcagacgaaaatcttgct ttgaccactgattATCCCAGAGCGAATCCATCGGCGTTGATGCTTCTTAC TACGGTTTTGGATGACGACAGTGGTTCCAACGGATAGGGACGGTAATGTT TTGGCGTGTCTGTTGTACTTCTTACTGACGACATGGTTTCGTTTGGAGAA TGCTTCTTCCCGTTGTCTTGCTNCAAGTGGATATCAGGGTGGCACTGGTG GCTTCATTGGTTCCAAAATGATACAGGCAGTTTCAGCCGCTATATTTATC AATAATCGTCAGATATTGGTGACTTGCAATAATGAAATAATCACCGGTGA TTATTTGGAATGGGTATTGCGGTGGAGGGCTTGGATGATCGGTTCCGTGG GCTGACTGGGTGAGTGACTGATACAAGTTTTACAGCAGTCATGGATTCGT TGGATATCTTTGTTGATTCCCGGCCAAAAGATACAATCTTTGACTCGAGC CTGCATGCCTGTGCAGCCTTGATGGGCGGAATGGAGGGCTTGAAGGATCT GATGGCGGAGGTTCTTGGGTATCACGAGGCGTTTGTCTAACATTATGAGA CCATTCCAAAGCGATAGACGATTTCTAACTTCCCAGAATGGTCGTAGATT AGCAGGTAGGCTTTCACGGGCTGTTGGGAAGCCGTCCTGGATGGTTTGTA GCAGTAACGAGTAGTCAGTATCAGTTGATCCATGTTCACGAATCTGATCG AGAGTAAGGAGTTGAACATGGTCAGTTGTTTGGCAATTATTGATGGCGGA AATGGCACTGACTTCTGAATCGATGTCTGGATTACGATCATCTTCTGTCA TGGTAGCAGTAGTTGTCGTTTGTCGCCACACTTTCATGGTCTCCTTAAAT TAGTTNTAGCAGTAGTTGTCGTTTGACGCCACACTTTCATGGTCTCCTTA AATGAGTCGATGGAAGCTACGCTGGCAGGGTTCCTGGACATGGCATCGGG TCCACGCATCCATTTTAAAGGGCAATACAGGATGGTGAATCTGAATTTGA GGGAACGGCTCTTTAGGTGCATTTTTTGTGTCACATTTACTATGCTGTTG TAGTAGTAAATACCCATATCCGTCCTTGCTCCAATCAGTTTGTAAACAAG TTGTGCGCTTATAGTCGAACGAACGAATACCTTCACTAACACTTGCGATT AACAATTGCTTTGATTCAATAAAAAGTTTGTTCAAAGTCTCATTGAATGT TAGAAAGTTTGGATGGTTGTTGATGATACTTGTTTGGGTGACATCGTCAC ATGCGTTGTAAACCATTGATGCAATCTGGTTTGCTGGGATCCCTGCTATT TGTTTGTAAACAGCCCAATCGATTTTGAATTTGCGAAACTGCGGATGAGT CATGTCAGACGTAATGGAAGGTAGTTTTGCGGATTTATGTGAGGCGGTTG GTACGACAGAAGGAGTTGGATTAGTTGTAGCATACTTAGTCGAGTCTGGG GTACTGCTACTACTGACGTGTTGGAGAATCTTCATTATATCCCCAATAAC TGTATTGCCCAGGTCTCTAAGGAATGACCTGTCCATAGATTAGAGGGCAA TATCTCTAATGTCATTCGATTCTCTGTGAAGCTCTTTGCATACTGGCGTG CAGCTTCttctatggcgcgccaaaaggctttttaatactaactttttttt ataatatcaactttcttttataatactaaattttttttataataccaact ttcactTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNataaaaa aaaagttggtattataaaagaaaaattgatattataaaaaaaagttggta ttataaaaaaaagttggtattataaaaaaaagttagtattataaaaaaaa gttagtattaaaaagccttttggcgcgccatattCTTCTGGGATTCCAAT ATATTGTTTGTAATACATTAGatctaaatgaaaagaaagaagaatataAA CTAATCTGAAcattaactcgaacaaatttttgttccccgtgcgtgttcga gctATGGAGTCCCTACTGCAACTGACGTCACAGGgattttttttaacgat gaGCAACTCCGTGCTGTGTAAGCCCGTCGTTATGTGAAAAGAGCATTTAT TCCATTGCGTAAAAACTCGTACAGACTGCctcaaaaaacaaaatgaaatg gAAGTTCACCCCATTGTACTATCCATTTTTTATCCAAGTTTGTCatttaa aatgtttcttttagacaataaattgttctctttaatgaatGGTCACAAAG AAAAGAGAAATgagttgattttcaaatttttatagaGCCACCGGACCAAA TCAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGT TTTCGAAATCATCAATTACATCAGCTGCTGTAAGTAATGCTTTGCTCgat aatttaaaaaatgtgtattttggAATAAAGTGGTGTACATCATCTACCGT ATGAAAACGACCCGGGCGTTTATTGAAGTTTTtgttttaggaggggcgtt tgaaagaaggggcgtttattaaataatttataGACAAGATTACATTAGTC ACTGGTCTAAACTAGTTCGAATACCAAAATCGTACAATTATTATTGTAAA TCTAAGTTTTTCTTCGTATTATATACTACTTGTTTCAAAAAAACGCCTCT CCTAGGAGAAGCGTTCATTTGGGGAGCgttcattaaaaaatttttattca aggAGGGGCGTTTAATCGAGGGGGTGTTTTaaagaagggggtgtttacGG TATCTGATTTGACCAAGTTCGTTGTTGTCAGTTTTCATTCCCTTCTTCCA TGTCCGAAAATTCGACCTTTGGTGTGTCTTTTACCAACTCAGTTACTATG TTAAACCAGAGATCGTATAACTTTCATATAATGTTAGTTGAACGCTGACT GCAGGCTGGTGTCCTAACTAATCTCCTCAGCTTCTATAATTCTATTTTTA ATCCTATGTGCTAGTTCTCCAATGTATCGTTGGTATTAGAAGGAAGGTCG TTTTACCTTTTGCTATAATATAATCCTCcggaatttttttgaatattttc aggcGGTAGCTGGTATGGTACAACAAGACGATAAAAGTAAGACATTGTCG TTTGAATATTATTTCATATTACTATTGAAATAGCGACCATTGTTCTAAAT AAGAAAATCGGAATATTTATACTGGACCCTATGAATTAAATGAACCCTCT AATTATTAAAAAACCATTTGCTAATCTAAGATCTGCGATATCTGGATAAT TCTTGggatgattttgatatttttctcctgAAAGGTAGATACAAAATGTC GcattatgagaaaaataaaaaaaactaaccTTACTCTCAAGGGTCTAAAA TGAGGGAAATATCTTCGTAGAAAGTTTTACAGGCGCTGAAAAGATATCGA AAAATCAACGGGTGAAGAGGAGGGGGCATTTATTTGGAACTCGAGATAAC ACTCTAAACCCCTTtttgattgtaaaaaaaatattatcaattTAACGATC AaacttctttcattttcatttttagaagagAATATTGACAGGATCGATTC AACTTTACATCATTCACATGGTGAACACTCTGGCAAAATCATGAAAAGTA AGAATTCTGTTCCTCTTCAGCCTTTCATTAGTTGACCTTAATCTATAACT CGAAATCGTTCGAAAGTTAGATATTAGATCAAGAAGGCCCTAATCTTGAG GTTGCAGGTTCTGTCCATAATGTCGAtgccaatgaagtataagcccgaag ggctagaagtcaatctctttggtaggatttgaagccaacacatcctacca aagttgcgcggccttgagcgacccacctggtttttacacaaatgacagat tgaaactaaaatttaccgcttaatttcgaaaaatatatcactcgaaaaca aaggaattgctagattcaatctgtcatcaaaaatacggcgcgtATCTTGA GGCTTcgaatttttcttgcctgagaaaggttagagattgacctctagccc ttcgggcttgaaactcaatgggcgatgcttgatatttttatttttctgtc tTTCCTTCAGACAGCCACATCCGAAAGAAAAAGAGTAGCAAACACAGGTA AAAACAATTAGAGTTAAACTCCTTTTATATGAAAGTCTTATTGGGCCATT CTATTAAATTTCCatagggggtggacgaaccttttcaagtaaaaaatata atttttgaaaatgtgtggatacccccaaTGGCAAAATTTGCTACGTAGCC TGTTCTTaactcttcttcgctgactgTAAAGATAACGCGATGTTCGGTTT GTTACGTTTAGGCAACTATAGTGACGTTACATTTAACGCATCAATGTAAT GCTatctttcatttaaaaaaagtgcACTCCTTTGTTTTCTCCGATTTTAT CCCAGAAAACTAGGACAAAGTGAGACACAGAATCTCGCTAACCGAAACAG TATGAGACACggcaagttttttttcaaaatatgaaaagcGCCGCCCGTGG GCGGGTTGGTACAGGCTACTTTTACGACACTTGACTTCTTTTTGTAGCAG CTTGAAAAGGACTGGGGGAAAGTTTACCGGgtacattttttgttttttgt ttcaggattgagttgaaattgaaaaagggGCTGAGCAAGAATCGGGAAGT GGACATCGATGTAAGCATATTTTTTCCCCTTTTGAATGATAATTTTTGTA TAATACagcggagtctctttaactcgaacctctataactcgattgtctcc ttaactcgaacaaatttgtgttccccttgCGTGCTCGAATTATAGAGAAT CTACTGTGTAGAAGTATTTAGCATAAGATTTTGCTCTAGCGCAAAAGTTC TTACAATCATAGTCAGAATAATTTGGATTTCGCGGTATTTCGTCGTTTTC AGAATTTCGGTTATGATGAAAAGGGCGATTTTAGCTTTCTACTTTATTCT GAtgcatatttcgattttggattTTATTGCTTTCCAGTATTCCTTGCCTT GttggaatatcttttttcaGAATGTATTGACAACTGCCAATTTTTATTGA AGAGTTTCTGAATGTTATGTATGTCAGCGTTTGTAatgattttgttcgat tttgttCTTTAGGGAGACGAAGCATTCGATAATTGACTGAGGCCACACTG CAACAAGTTACTGACGTCATCAGATTcgtttgttgaaaattttcactctg tgaaaaattgtaaatagtgTATTAAAATTATAAAACATAACAAAGGGTTT GCTAGATTAGAAACCTAAATAATTTTTAACTGTTTTCGATTTAATTGCTA CTTATCTTTTATTTGAAC

Coding sequence (CDS) from alignment at sc0000010:201773..213990+

>TCONS_00001335 ID=TCONS_00001335|Name=TCONS_00001335|organism=Clytia hemisphaerica|type=CDS|length=6000bp|location=Sequence derived from alignment at sc0000010:201773..213990+ (Clytia hemisphaerica)
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
GGGGGAGGGGACAACAACAAGGTTGAAGGTGCGGAACCCCACGCGACCCC
GAACAAAGACGGAGGTAACTCGGACGAGAATCTTATACACGTGCAACCTA
AGAAagtaagtggcttcatttcccccATCCATTCGTCCATTCGGTGTGAC
GGAACACAAACGGTTCCACGTACGCCCTCGGGCGGCAAAGCTCAAAACAA
AATACTTATATCCGCCACAATAAATTTTcacaacaaacaaaaaaagatgg
cggctcaagacAGCATCCAAGACACAAGGACTGAACTTGCAGATCTtttg
aagaagaaagaagagCTTGCTGTCAGTTTGGCCAACCTTGAACGACAAAT
TTATGCATTCGAAGGAAGCTACCTTGAAGATACACAATTGTATGGAAATA
TAATCCGAGGATGGGATCGACTGCTCTCTCAGAAaGCCACCGGACCAAAT
CAGAAGATCGAGAAAAGAAACAGGAAATTCAAAGAATCTGAAAGGTTGTT
TTCGAAATCATCAATTACATCAGCTGCTgcGGTAGCTGGTATGGTACAAC
AAGACGATAAAAaagagAATATTGACAGGATCGATTCAACTTTACATCAT
TCACATGGTGAACACTCTGGCAAAATCATGAAAAACAGCCACATCCGAAA
GAAAAAGAGTAGCAAACACAGgattgagttgaaattgaaaaagggGCTGA
GCAAGAATCGGGAAGTGGACATCGATGGAGACGAAGCATTCGATAATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000721XLOC_000721Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001335-exon-sc0000010-1491911889:201773..202093TCONS_00001335-exon-sc0000010-1491911889:201773..202093Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:201773..202093TCONS_00001335-exon-sc0000010-1510915933:201773..202093Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:201773..202093TCONS_00001335-exon-sc0000010-1575043694:201773..202093Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1491911889:206631..206743TCONS_00001335-exon-sc0000010-1491911889:206631..206743Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:206631..206743TCONS_00001335-exon-sc0000010-1510915933:206631..206743Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:206631..206743TCONS_00001335-exon-sc0000010-1575043694:206631..206743Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1491911889:210958..211051TCONS_00001335-exon-sc0000010-1491911889:210958..211051Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:210958..211051TCONS_00001335-exon-sc0000010-1510915933:210958..211051Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:210958..211051TCONS_00001335-exon-sc0000010-1575043694:210958..211051Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1491911889:211725..211758TCONS_00001335-exon-sc0000010-1491911889:211725..211758Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:211725..211758TCONS_00001335-exon-sc0000010-1510915933:211725..211758Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:211725..211758TCONS_00001335-exon-sc0000010-1575043694:211725..211758Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1491911889:212198..212269TCONS_00001335-exon-sc0000010-1491911889:212198..212269Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:212198..212269TCONS_00001335-exon-sc0000010-1510915933:212198..212269Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:212198..212269TCONS_00001335-exon-sc0000010-1575043694:212198..212269Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1491911889:212733..212769TCONS_00001335-exon-sc0000010-1491911889:212733..212769Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:212733..212769TCONS_00001335-exon-sc0000010-1510915933:212733..212769Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:212733..212769TCONS_00001335-exon-sc0000010-1575043694:212733..212769Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1491911889:213278..213332TCONS_00001335-exon-sc0000010-1491911889:213278..213332Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:213278..213332TCONS_00001335-exon-sc0000010-1510915933:213278..213332Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:213278..213332TCONS_00001335-exon-sc0000010-1575043694:213278..213332Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1491911889:213785..213990TCONS_00001335-exon-sc0000010-1491911889:213785..213990Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1510915933:213785..213990TCONS_00001335-exon-sc0000010-1510915933:213785..213990Clytia hemisphaericaexon
TCONS_00001335-exon-sc0000010-1575043694:213785..213990TCONS_00001335-exon-sc0000010-1575043694:213785..213990Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001335-proteinTCONS_00001335-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:201773..213990 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
115.707 102.736 119.398 116.214 86.3569 68.7633 78.2915 81.6233 72.8596 61.1558 63.6845 60.4262 41.3486 44.4322 38.7584 34.776 55.4394 58.0318 37.0355 42.4122 57.2173 57.5528 72.0728 67.5707 100.891 99.1644 40.7747 37.843 33.0052 36.3461
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR015418Eaf6
Vocabulary: Cellular Component
TermDefinition
GO:0000123histone acetyltransferase complex
Vocabulary: Biological Process
TermDefinition
GO:0016573histone acetylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016573 histone acetylation
cellular_component GO:0000123 histone acetyltransferase complex
Blast
BLAST of TCONS_00001335 vs. Swiss-Prot (Human)
Match: EAF6 (Chromatin modification-related protein MEAF6 OS=Homo sapiens GN=MEAF6 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 9.310e-33
Identity = 72/109 (66.06%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  220 INFHNKQKKMAAQDSIQDTRTXXXXXXXXXXXXXVSLANLERQIYAFEGSYLEDTQLYGNIIRGWDRLLSQKATGPNQKIEKRNRKFKESERLFSKSSITSAAAVAGMV 546
            +  HNK    AA   I DTR ELA+L+K+K+ELA +LANLERQIYAFEGSYLEDTQ+YGNIIRGWDR L+ +    N K ++RNRKFKE+ERLFSKSS+TSAAAV+ + 
Sbjct:    1 MAMHNK----AAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNS-NSKNDRRNRKFKEAERLFSKSSVTSAAAVSALA 104          
The following BLAST results are available for this feature:
BLAST of TCONS_00001335 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
EAF69.310e-3366.06Chromatin modification-related protein MEAF6 OS=Ho... [more]
back to top