Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001333 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001333
Unique NameTCONS_00001333
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3218

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001333 ID=TCONS_00001333|Name=TCONS_00001333|organism=Clytia hemisphaerica|type=transcript|length=3218bp
catcaaataGCCGATAGGAAAGTATGTGATAAATGCATATTGTTAATCCT
GTAACATGAAActaattgagaaaaaatctgtATAGTTTTGTCCTgaaatc
agttttttttatgACGCAGCAAGGAGAATATGGAGGCATCATAAATATAT
CGTTGGAGAGAATaattaaaatcagaaaaaaataaactcAGTTTTGGTAT
TGGGCCAAAGCAATTAAAAGCACCTGCGGAAAGACTACTGTTACAAAAAT
GGTGTTGAAGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACATCC
AGGATGGTTTATTCGGTATTACTGATATCGAGGAAATACCTTTACAACAG
AATCCGCAATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTTTC
AGCAGGGAAGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTATAT
ATGACTTTTCTGATTATGACAATAAACGTAACAAAGCTTATAAGGTGTTA
CGAAAAGGTCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGAGCATCT
GTCGAGTTTTGCAGTATTACAGGAATATAATGATACGTTCGTAGAGTTTT
CAGATAATGATATGGAGGATGGGAATATTTTTCCGAGCAGTAAGATGTTG
ATCTCGTATTTTGCAAGGCTTGGAACAGGCGAAGATGATGAAGCTACTAT
TAATCTGAATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAATC
AAGAGGATGCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACTGG
AACACAGATGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAACCA
TGCGGACCATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAATT
ATAAAGAAATGGTTGCATTTCTTATTAAGAAGGGAGcaaaagttCACGCG
AAAACAAGAGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATATAA
TgctgctgacgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGGAT
TAGATTTCTTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGATGT
GAAAAATCATCAGAAATCTTCTTAAAGCTTGGTGTACCAGCTGGggaata
tgatatttccaaccAATCAGTTATGGCATTGATAGTGGACCGATTACCGA
ATCTTGGTTATCAATGTTTAGACCAGTTCATGACCACAGATGATAGTGCG
TACAGTGCATTCTTTCTGGCACATTTAGAAGGGAATATCAAAGGATCATC
AGTGAGGGGACAAACAGTTCTTCAGTGTATTGTCAAGAATAATAACGAAG
AACTGATCATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAGAT
TTGTTCGGACGAACTCACGTTATTATGTCTAACttgttgaatatctttta
cGTTTTATTGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTTTG
ACAAACAATTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTGGT
GTTgtcttttgtttcttgtctATCGTTTACATATGGCGGGAtatcaaact
tttattgatactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCTTA
GGGTTTACAAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAGAA
AGCGAATTTGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAATC
GTTCTTTTATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCACAT
CGTTTGCAATCATTGTAATGTATTTAGTGAACGTGCTGACTCCAAACAAG
ACCTTATTTACTGTCTTCAAATATTTGGCTTCTGTTAACCTATTACTTCT
TTGGATGAGGTTATACAAAACAATGCGACTTAGCAAAATCTTCTCCGAAG
TTGAAATGTTATTAGTTCATATCTTAAAGACTGTGGCGAAGATAGGAACA
TTATATTTGGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCTTTT
TGGTGGGTCTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAGAAT
ACGAAGTTGCCCAAATTatttatGATCTATACCATTCAGCCGTTGTTACA
CATCACGAAATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTTTTATTT
ACTCATGTTTGCAATTATCAATTTCGTTTTCATTGGTGTTATGACGGAGC
AATTTGTGCGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTCGGAGTA
GCAAATGCGTTGATCAATATTGAATTAAGAAGCAGTCATGATAAAAGAAA
AGGATACAGAAAATTTATCAGAGAGAAATGCAATCCTTACTTGGAAGAAG
TATTTGGTAAAGAACGCCATTACAGAGAGGATCGAAATGACAAATACATC
AATATCAGCGTTGGCAGTGTATCAGAACTGTCGGAAAAACTCTCTGACTA
TCTCGaTGATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATATTG
ATTGTTTGCAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACATG
AATTATGGCAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCGAA
AGCCAATAAATCGGCTGAAATTATTAAAGCAGGTTGTGATCCACGGCATC
TAGCAAAAGGAAAACATCTATCCAAACCAAAACAATGAAGATAATCTGGA
ATCTTCTGAAAAGGTTCCGTTCCATCAGATACGAAGGGTCAAATAGGAAT
GATCCAGCTCCATTCAAAGTTAATGCCTTGCTGCCATTTTAATGGTTAAA
ACGTAGTTCATAGATGTTGAAATCTTCACAACTAACTCACTTACTAAAGA
GACTTCAAAGCGAAAACGACAATAACAGAACATCAAAAGATAACTTTATT
TTAAACTTTCTCCGATAAATTTTGTCTTGACTATCAGACAATCTTATTTT
ACGAAAAAGGGTCTAAGCCTATCTTTGGCTTTTGGTTGCTCTGGACTCGA
TCTAGACTCATAAGAATAAATCCATTCTACCTCCCCCACCCTCTGCCGTT
AAGAAATACGGGGAATGTGATAATCGAACAAGTTTATTCAGTccaaacca
ttgagtttaaagcgcgaagggctagagtagaatctctaacatTTATAAGG
CAAGATAAAGTGAAGCCA
Run BLAST on NCBI

protein sequence of TCONS_00001333-protein

>TCONS_00001333-protein ID=TCONS_00001333-protein|Name=TCONS_00001333-protein|organism=Clytia hemisphaerica|type=polypeptide|length=829bp
MVLKKLMNWAGQAKDYIQDGLFGITDIEEIPLQQNPQSPSQKRIRKNVMF
SAGKDKTKLENDGPNIIYDFSDYDNKRNKAYKVLRKGPLEFPEDHLEFEH
LSSFAVLQEYNDTFVEFSDNDMEDGNIFPSSKMLISYFARLGTGEDDEAT
INLNFIQNLIDAGANINQEDAYGQTLFFSIVRDWNTDVAEYALTEGAHIN
HADHYGRTALHVAASINYKEMVAFLIKKGAKVHAKTRGEEQTPLHYAAKY
NAADVIEILISNGAVDGLDFLNRTPFHLAVEHGCEKSSEIFLKLGVPAGE
YDISNQSVMALIVDRLPNLGYQCLDQFMTTDDSAYSAFFLAHLEGNIKGS
SVRGQTVLQCIVKNNNEELIMHPTIQKLLKIKLDLFGRTHVIMSNLLNIF
YVLLATVFIFSVPYDSFDKQFVPFETHVWKICVGVVFCFLSIVYIWRDIK
LLLILNKEDEEYKKDMLRVYKKMEQYCHPAWKTESEFVDREKKRLEESRK
SFFYDGWQCYELVVTFTSFAIIVMYLVNVLTPNKTLFTVFKYLASVNLLL
LWMRLYKTMRLSKIFSEVEMLLVHILKTVAKIGTLYLVLLVPYTFVVYML
FGGSGDEDVRITKTTKEYEVAQIIYDLYHSAVVTHHEINEVANQIFRGFY
LLMFAIINFVFIGVMTEQFVRTYKKALAKVHLGVANALINIELRSSHDKR
KGYRKFIREKCNPYLEEVFGKERHYREDRNDKYINISVGSVSELSEKLSD
YLDDADFLNQPQRSCDIDCLQSLQVELERLSADMNYGKAGLQLKSKEVLA
KANKSAEIIKAGCDPRHLAKGKHLSKPKQ
Run BLAST on NCBI

transcript from alignment at sc0000010:155949..170280+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001333 ID=TCONS_00001333|Name=TCONS_00001333|organism=Clytia hemisphaerica|type=transcript|length=14332bp|location=Sequence derived from alignment at sc0000010:155949..170280+ (Clytia hemisphaerica)
catcaaataGCCGATAGGAAAGTATGTGATAAATGCATATTGTTAATCCT GTAACATGAAActaattgagaaaaaatctgtATAGTTTTGTCCTgaaatc agttttttttatgACGCAGCAAGGAGAATATGGAGGCATCATAAATATAT CGTTGGAGAGAATaattaaaatcagaaaaaaataaactcAGTTTTGGTAT TGGGCCAAAGCAATTAAAAGCACCTGCGGAAAGACTACTGTTACAAAAAT GGTGTTGAAGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACATCC AGGATGGTTTATTCGGTATTACTGATATCGAGGAAATACCTTTACAACAG AATCCGCAATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTTTC AGCAGGGAAGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTATAT ATGACTTTTCTGATNAGATAAAACAAAACTGGAAAATGATGGCCCAAACA TTATATATGACTTTTCTGATTATGACAATAAACGTAACAAAGCTTATAAG GTGTTACGAAAAGGTCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGA GCATCTGTCGAGTTTTGCAGTATTACAGGAATATAATGATACGTTCGTAG AGTTTTCAGATAATGATATGGAGGATGGGAATATTTTTCCGAGCAGTAAG ATGTTGATCTCGTATTTTGCAAGGTAAGTGCTTTAAATTGGTAGTTTTAG CCCAAACAGCTTTCTTTGGAATCTCTTGGGTTCcaataaacggggggagg taagttggaaaattttcgagatttaaTAAACAGAGGGGACTAATTGCCGG GTGGTTGGAAATAGTActttgaaaacccaaaaataaggtaaatataggct aaaatcaggctatttagagcaaaataagagacctctttgacagctgaaat tattcttaaaaattaacaaaCGGGGGGGGGGAGTTTATTTGAAACCTAAG AGTACCGTGTCCGCCACTGTACTGTTTTAGAGGATGTCATGGGCAGTTAA GGTATGATAACTCAAAAAAGTCACAAACTTACAAATGTTGACCAATGATT TTGGTAAACATAGATTCACAATCTAGCTAAGTCTACTATCACTGATTCTC ATTTACATTTTGCGAATGCAGTTAAACGTAAAGGATTTATGGAGACTTAT CTTTAATACCCAGACTTTAATTTTTCTGTTAGGCTAAGCAGAGGATCTCC CATTTTACACACAACCTTGAAATGCTTATTTTAATAGTGagccaattttt ttcatttcaacacAGGCTTGGAACAGGCGAAGATGATGAAGCTACTATTA ATCTGAATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAATCAA GAGGATGCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACTGGAA CACAGATGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAACCATG CGGACCATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAATTAT AAAGAAATGGTTGCATTTCTTATTAAGAAGGGAGGTATGCTCGTCCTGGC TTGAGAAacctattttaatttttatatctttgtttgagttgaggaaattt cgagtttaACCCTTTAAGAGCCACGGTcttatttttcttactttttaagt tttttaagaaaatcgctatttcaaactttaaaggcttatatctccgaaTC CAGAatgagttagaagctcgttcatAGCTCGCTCGTTGAATAGCTTAGAA TTTAGTTTAGAAGTTTAGGCTCCATCGGGAAGGGCGGACTGGGCGGAGGC TaaggggggggtaggttaggggaATAAAGCAgtctgcgcggacctgactg aatgatggaaagtagaaaggtgcccagtggtacaacttcaaatcaaaagt aaaacagggccaaatttgaaGGTTCTATGATCACTCgagtcaaaatctca aaaaagtggatttttgtcaaatttttgcatttctttgAACTTTTGGTTTA AAATCTCGCTgtgaaaactcatttttgaacatttcttgcttgaccatgaa gcgcAATCCAATTTCtatacgagttagaccaaaaatgaggatttctaact caaactggacATTTCAGGAGGGCTCCGCCgaaatttattcaaatatacTT GGCACGGAAAGGGTTGAGTTAGTGAAGATAGCAAAGAGTTTATGTATCTT GTATTTCAATTGGTGCGGTAGCTAGTTTTTTATTTGTCCTTGAACCTTGT TGGACTTTGCCCGTACCAGGTGACAACTGCTTTTTTCTCGGTACCGTTCA GAGATACGGATTGTTCAAGATCGCTTCCAGTCATTTACTGCTAGACAGAT GAGTCTTTATATGTAGTCCGAATACGTTAAAGGGATAAAATCGAGGAAAA ATTCTGTGGGAATTAGTTCATCTTATCTGCCTGACCAAGTAAGAGGAAAT CAATCGAAAAAGCTCTAAATTCCGTTATCCAAGAATTcttcaaaatctca aaagtcCCAAAGATGCATTCTCATACGCAATTTGGAAGTGATTTACCAGT GACATATATGACAGTGCAGAATATGTttctttttcagcaaaagttCACGC GAAAACAAGAGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATATA ATgctgctgacgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGGA TTAGATTTCTTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGTTG GTAACGAATTCTTTTTCTCCCCTTGATCTTCACAATGCTTGATAATTGCT CGCcattgtccctgggacaaaatcagcgtgtcttttgggtatttcccaca ctttttgtcccatgaaacaaaaatgaaaccatgggacacgcactttcttt cttgtgttggtgggatggagcatgttgcattgcacaaaCGTGAAAATAAC TTCTCGTAGCCTGTCGGCTGCAAAATTTGGTCTAATGCGAACCTTTACTA ATTGATACTTAAACTAAAACATTTGTCCTCTCAATTGGAAAAGTCATATA AAacactttctataatttgaatttttccataattcgaaGAAATTCATTGG TCTCTTCaaaatcgaattatagagagatgTTCGACTGTATTTTCCCTGTA TTCTGTTGATTTGCATAGAGAACTCGTGTGTTGCGAATCATCACTTTAGA TTTATATCCACTGAAGAGATCTCGTCGTGTCTAAAAGcactaaaatttga taaataccGTAAAGCGGGCGTAGTTTTTGAGGTCGATTCGCTTTCCTTAT TTTCACGGTATTCGTGGCGCGTTTTATACGGAAAGCACCTAAAAAGACCC GGTTTCTGCCActagttttgaatttaaacaatacaACTATAGTGGCAAAC TCCTGGACTGTTTTTAATGCTTCcaaataaaacattacgtcatgaatacc aggaattcaaaacaaaattatttcaagaAATTATTTCGAAAATACTGTAC AAAATTCTCAATTTGTGATTCTTTACAGGATGTGAAAAATCATCAGAAAT CTTCTTAAAGCTTGGTGTACCAGCTGGggaatatgatatttccaaccAAT CAGTTATGGCATTGATAGTGGACCGATTACCGAATCTTGGTTATCAATGT TTAGACCAGTTCATGACCACAGATGATAGTGCGTACAGTGCATTCTTTCT GGCACATTTAGAAGGGAATATCAAAGGATCATCAGTGAGGGGACAAACAG TTCTTCAGGTAATTTAAGTTTAAGTCAACTATTAGATTTAAGGTGAAAAT ATAGCATGTGTGTCTGCCTGCGTATCTTGTTGTTTTGATGTGAAAGATTG TAAATCCTAACACCCCGACATCCACAATTTTAGGTGAGATAGTTATCATT ATCCTGACCCAACATTTGAATTAACTTGGATTATGTTTTCAAAACACATG GAATTgactattccagaaatagtttgGACCCCCCTATGTTGAGAAGGTGT TGGCGTCCAGGGTggtctttcaaataaaaaacccAGGGAGCCTAGTTTTA AAATGAGTTAGAGTGTAAAAATCCAGAGTTgtcagtaaaacgaggtcgag aaaatagacaaaaaatctAAGAGAgtcctaaaaaattgaaaaaaaatcca gggatcacctttcccaaaaaaagacctcctcaacatagggggtacaattt ttttctggaatagcccaatgatCTTTGGGTTTTGTCTTCATCTTCCTTTC ACACAACCATACTGATTTGGTTGTATGAATCACACTTGACTCTGGTCAGA AATTTTTCATCCCTTTCTTATAACAGTGTATTGTCAAGAATAATAACGAA GAACTGATCATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAGA TTTGTTCGGACGAACTCACGTTATTATGTCTAACttgttgaatatctttt acGTTTTATTGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTTT GACAAACAATTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTGG TGTTgtcttttgtttcttgtctATCGTTTACATATGGCGGGTAAGTGCTG CACGTGTTCTTGAAATAATTAAACTTTGGTTAAGAAGTTTcgtaaaatca gtgtttttcatttgtaattatGCGTAAATCTGATTAATCGCGATAGTAGG GTTCGATTTCCTGATCTTTCTggtttgatttcccgatttggtTTGAGTTT GCGCTCGCTGACCACGATGAAGATGTTTGCATAATGGTTCACTATTAAAA AATANTTCAAATAAAAAACCCAGGGAGCCTAGTTTTAAAATGAGTTAGAG TGTAAAAATCCAGAGTTgtcagtaaaacgaggtcgagaaaatagacaaaa aatctAAGAGAgtcctaaaaaattgaaaaaaaatccagggatcacctttc ccaaaaaaagacctcctcaacatagggggtacaatttttttctggaatag cccaatgatCTTTGGGTTTTGTCTTCATCTTCCTTTCACACAACCATACT GATTTGGTTGTATGAATCACACTTGACTCTGGTCAGAAATTTTTCATCCC TTTCTTATAACAGTGTATTGTCAAGAATAATAACGAAGAACTGATCATGC ATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAGATTTGTTCGGACGA ACTCATGTTATTATGTCTAACttgttgaatatcttttacGTTTTATTGGC AACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTTTGACAAACAATTTG TACCGTTCGAAACACATGTTTGGAAAATATGCGTTGGTGTTgtcttttgt ttcttgtctATCGTTTACATATGGCGGGTAAGTGCTGCACGTGTTCTTGA AATAATTAAACTTTGGTTAAGAAGTTTcgtaaaatcagtgtttttcattt gtaattatGCGTAAATCTGATTAATCGCGATAGTCGGGCtcgatttcccg atctttctggtttgatttcccgatttggtTTGAGTTTGCGCTCGCTGACC ACGATGAAGATGTTTGCATAATGGTTCACtattaaaaaataacaattaac ggagtttgcagccgtcattacggctgttttatttttttgaatcccTGGta tccatgacgtaatgtttggAAGCATAAGAAATAGTCTGGGTGTTTGCCAC TAGTTGtcttgtttaaattcaaaactagTGGCAGAAACCTGGTCTTTTta ggtgcttccgtataaaacattatgtcatgaatatcatgaaaataAGGAAG GTGAATCGACCTCAAAAACTACGCCCGCTTACCAAATTATATTTGCAAAG CAGGTTTTTTTAGCAGGGGATTGTTGACACCATTAAAGCTTCAGTGATGA AGGATCTTATCCCTTAAATGGATTATATTTCGCACGGAttaattttcact aatttttgccgtttttgcgaAACTTTATAAAAAGGCAAAATAACGTGACA TTATCTCATTGGAAAAAATctgttcgagttacggagacaTTTAAAGCGTT AATTTCAATTGtatctttattttattcattGTATGCACCATCGCAAGGTC TTCCAtgaacccaacagctgattggttgaaagtgacgtattgactgattt tacgtcacttacaaccaatcggctgttgggtctgtgatgtaatgtcagaa gacattgcaatggtgcatatcatgaataggatATCAATTGATCATGTTCA TGTCTCGACTAATACCCTAATACCCTAAGCCTTGACACATTGGAACTGCT TTCCAGGCTGGGTCACATGGGGTCGATTCCCTTGTGTTTTGTCCTACGGG AAATTAGTTTTTCAAACCAAGTATCTTTATTTTATAGGAtatcaaacttt tattgatactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCTTAGG GTTTACAAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAGAAAG CGAATTTGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAATCGT TCTTTTATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCACATCG GTAAGTAAAATACACTTTCGGCCGTAGtcgtgcgggcatttttttgtctg ctTTATCCCATTTAGCCTGTTAggcgaaaaccgcttttttatcgcgattt aactgaccataaaacaaagaaaaaatttggtttgtgggaaggtactggct atATCCCAttaaaaccgtcccaatccttttttgacgcatttttctattgt ctataggtgcgaaaaaaggactgggatggttttagtgggataaattGGAC AAAGAATGCCTGCGCGACAAtcggtggctacggtcgaaaaggtgtataca aTGTGTCCATTTTGTCAATGATAGTCATTTTTGAGGGCtgtagtttttta tttaaattattCAAAGATTTAACCTTTCAAGCGCGcaacattttataaaa aatgtgatAATATCCACCTTTTTTGtaatccaaaatttcaaactggcATA AAAGCTTGTACCTTGAGACAATAAGAcaatggttttggtaccatttgaaa ggtatttttatactctttctaaaagcattcAATTCATGCCCTTTAAAATC TAGTTTTCAGGGGTTGTAGCCTGTCACGTGTCAtgtcacgtttatcgctt catAGTACAATGAAtttacggcaatgaattttgaaattagccgtagatat caggtctgtgtacagacaataaGTCTGGGACTCGGTATATTTCCAAATTT ATAGATCGTGTTTACAAGTTTCTTTGATTGGAAGGGTTAATAAGGTTAAT CATCTACTCAAATTACCTTTCCAACGAGAAATGTAATAACATTCACTTTT GCAGATATAGTCCATAAGCTGAGGGTCAAAATGGGCTCGATGAGTTTACT GAATAAATTTTATGTAACATTGAAACTTCCATGTTAGCAAGGTACAATGT GCCATCATATGGAATTGCCCCAATTGTTAAGATNTTATGTAACATTGAAA ATTCCATGTTAGCAAGGTACAATGCCATCATATGGAATTGCCCCAATTGT TAAAATTACCAAACCTACTTTTACAATACACCCAACATCACACAATATCA TTTCACTCTTTGTTTTCAGTTTGCAATCATTGTAATGTATTTAGTGAACG TGCTGACTCCAAACAAGACCTTATTTACTGTCTTCAAATATTTGGCTTCT GTTAACCTATTACTTCTTTGGATGAGGTTATACAAAACAATGCGACTTAG CAAAATCTTCTCCGAAGTTGAAATGTTATTAGGTAAGTGAAATTCATAAC TTAAGGGCTCTGTTCATAGTCAGAAGATTAAGGgttttgaagataaaact ttttattttggttccttgatacttttgataaaaactgTCTTTATAAATTG TTTGGTAATAATTGCCAGGAgtaattgaaaatttaattacaaaaattacg CTATGAActataaaagttcaaaaaatgtgtgttaAGTTAAGGGTgattaa tatttttctttcaaatttttttttgaattgtcaacaaagaattgaactat ttgaaattttcagaaatttttctaaattgatgtatcaagaattatgactg tttttctacgaaaaattgggatgaaaaatttgtcaaaagccactattttc aagattttgagacaaagaagctttaTGAAAATCCATTTTCAGTTTAGTTA TAGATCAGGCAGAAATCTATATTTTGAACATGGCataaatgaaaaattca ctatggtcagaggcCTAAACTTTagggaaaataaattttaacgaACATAA CAGTTTATACAGTATATCTTTTCTTGCGTCTGTTTGTACGACACATTTCA TATTTAAGGGTTGAATGCCAATTTGGGAAATTAGCCTCGCTAGAATGTCa atattcattttcatttaGTTCATATCTTAAAGACTGTGGCGAAGATAGGA ACATTATATTTGGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCT TTTTGGTGGGTCTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAG AATACGAAGTTGCCCAAATTGTAAGCTAAATCCTAAAAGCTCCATTTTTT CTAATCAATTGCCAGGCTAAATGACTGTATCGAAAGTTACAGCATCTAGA AGTAGCTCTATActtgcttcttttttttcacttaaacgGGAGGCCCTACA TAGTCTAGTAAACTTATTATGTCACCCTTCACGCTGAAATGAACCTGGAA AATACTTGACCAAAAAAATAAGCAGTCAGTCAGTCAAAAGtgacattctt ttttttttcccatGTTAGATCTCTGATTGTCTACTTTAATTATTACGAAA AAACACtacttttgaattttcagatttatGATCTATACCATTCAGCCGTT GTTACACATCACGAAATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTT TTATTTACTCATGTTTGCAATTATCAATTTCGTTTTCATTGGTGTTATGA CGGAGCAATTTGTGCGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTC GGAGTAGCAAATGCGTTGATCAATATTGAATTAAGAAGCAGTCATGATAA AAGAAAAGGATACAGAAAATTTATCAGAGAGAAATGCAATCCTTACGTAA GTTTTACCGACCGTAGTTCGATGGTAAAGCATATGGCTTCAGTGCGCACG GTATGGGCAAAGGTGGTCTAAATAGATTACGACGCCCCTCAAAACAACAT CACAAATGATGATGCTTCAGTGCGCACGGTATGGGTTAGATGATGCTTTC GTCCgttagagggtcagtaaacgcTAATTATGCACAGAGTCAGGGCGTCA GGGTGGTTTAcggggaaaaaagtggcggtaaaGTTTGGAACAACCCCGGa aaacacctccgccactgcttactccaccccgGGCTAACCACCATTTTCAG ATTTATCCcgtctcctaaactattccctttttcagtgatcttgtgtagac gatagcatcgtctaggtaTGTGTTAAATCCCTacctgggtcataccaaag ccGCAAAGGTACCGAAATAGTACTTGATGTCTCTGCTTAATGTTCATcaa ttattaaaagaaaaagatcaaatgaGAGTGGAGTGACCCAGGGAGAAAAT GTAGTGCCTTTCCACGCGTTTGGGTAGATAACTACTGAAAAAGGAGCCTC CAGCTTCCattactctcaggtgcctatcAAACGTGGGGGTACAAATAAAC GTGGGGGTTGgaattttttcagaattttaataaacgtgggggttggaaat ttgatatGTTTTCGAAAATACCCCTAATTATTGGAAGCAAGAAGATGCAC ATATTTTAAGTGTAACACAACAATAAGTCATATTTTGTCACACCTATAAG TataattatatttgttaaaattgCTTAACTTGATAATTTGTCAACTGTCT AGGTCAACGTCATTAAAAGCCTGCAGAAAATACTTACCTTATCAGCCAAA ACTTAGTCAGCCCCTTcttgactaaattttggcttggtgactaaaatttg ggccgactaaagatttagaaatggccaaaacttaattattagtcggccct tagtgactaaattttgacgaggtgactaaaattagggccgactaataatt aaggctgactaaaattaaggccgacttaGTTTTGGCCATTAAGGTAATCT CCATTTCAAAGATAAGACGCGACTTTGAAATTAGGCGTCCAATGAAAAAT ACTTGATaagaaatttctgaattttaataaacgtgggggtcctaataagg tccgtgggggttggaaaattttcgaaaaattaataagcgtgggggcacgt ttattaggcacctgagagtattATATCGTGACTTAGGAACCTTCTTACTC TCAGTTGTCTAATGTGATGAATACCCAATATGCAACTCTGTTTATTAGTT TGTCTATTTACTATGCAACCCCCAAATCTTCGACTAGTTGAATCCTACCA TTGAATTTacatcattttttatctttccttAGCAGCCTACCAAAAGGTAG AGAAGAGTGCCAATTCTGTCCTTGGATTTCTctgctttttctaaagattt tttcttttccttgttgctgagcatcaagtagaGAAACATCAGAAGATTTT TAGTATGACCCAACTGGGGTCGAATCCACAACATCGCACTATCTTAATGC TATAGCCTTGTAGAAATACCTTTTAGAGCCTTTTCTCTCTTGTTTGGGTT CTTGAAcagcaatagaccttatcggagtttctgattttcctaaaaaaagc gatgcattgtgggattgtttcgagtgtgttacaatagaaatctcttagga attcctcgagggaattctattgtaatacaatTGAaataatcccacaatgc atcgcttttttagaaaaatcgaaaactccaataaggtctattctttttat ttctattaGTTGGAAGAAGTATTTGGTAAAGAACGCCATTACAGAGAGGA TCGAAATGACAAATACATCAATATCAGCGTTGGCAGTGTATCAGAACTGT CGGAAAAACTCTCTGACTATCTCGGTAAGAGTTAGGCCGCCAGAATCCCC CTAATTTGTTTTGTTCTAAGGAAAACGAATCAGACTCAGAAATCAAGACC GCTTAGCAATTTTTTGGAACCGTTGTCGTTGAGTTTCAATGATCTTATGG TACACAAGGTCTTAAATTTgcttttttctcgattttggtGACAAAAATTC GCTTTTCAGAAGTGTTTTTTCAAGTCTGATTAGCATTCCTTACAGCACGT CATTGGTAAGAATTAGACCATGTCTTGACCTACTGAATCAGTTTCTTTTT GCGGCCAAATCAAATTCTCAACTTCTCTTCTCTGCTTCTCAAAATCTCAG ACACTCTCCTTCGTAAATGCTTTGgcaatttttgattttgcacaattatc ttcatttttagacattttcgGGCACGATTTTTCTTTCAATCATAGCcgtt ttgatataattttgttagttttaagccCTATTAACATATCtctgagttta aaatttgagctctGAGAAGGATATATCAATAAAGCTAAGGTAAGAAGCAG AGATACAGATCTAAGATGCAGAGTTTCAAGTCTTTGAGGCAGTGAGATTC ATATTTGAGAAGCAGAGTTTTAGATCTGGGAATGTGAGAAGCAAATCTCA AAAGCTGAGATCATGAGAGGTATTTTTCGGCCAATCATCCATGGCAGTAC CTTTACGGCCAATCACAATTTTAGCTTCTCAAATCTAAAATCAGCCTCTC AGATCAAGGCTCAGATTTAGAATTCGGCTTCTCAGATTATAATTTCAACT TCTCAGTTTTATGATATCTTTTTACTATtaaagtttttcttcttcaaaaa ttataaattgattATTTTGCTTCTCAAATCATCTTTCCAGCTTCTCAGAT CATCTTTTCAGCTCCTCAGATCATCTTTTCAGCTTCTCAGATTAACTTTA TAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTGGGAA TAAATATAAGCTGAACAGCTGATTTGAGAAGCTGAAAGGCTgagagtaaa aatttgaaaagtagaaTCGATGATTGGCCGAAAAATACCTCTCATGGCAA AGGTACACTGATCCCACTGTTCTAACATATTCTTAGTTGCTGGAACTCTC TAATTATGATTTATTAATTTGGGCTTTCCCAGTAAAGATTCGCACCACCT TGACAGAAAAAATGACCATTATTTAGAGGGGGTTGAATTGTTTCTGGAAA AAGCTGAAAGGGTCAACTGTCTTGCAACTGCAGTTTTGGTGACTTCTGGT AAACTTGTGCGAAATCCCAATTCTGCGATTGGGCTGGAATTACAAAaaat tttggaggtgggtcggtcggtcggtcggaagaAATTATATTCTGACGATT TATAAAATTTTCGTCAATGGTAGGGTTAACAGTTTTTGACGTATTCGATT TTTTAAGAGTCAAACTTTTCCTTTGCCATTGCTTTAGCTCGTATAAAACA TGGCTAAATGGAAAGAGCGCTAACAGGAAATTCaagattcttatgcttga gtcagacaagatacgagttttgatttcattatttgaagttaaaaaaaaaa atttttaaatagcaataactttttttgggtcggcaggtttcgaaATAGTG TCAGGCGGGTGATGACAAaccatcattttttaaattccagCCTTAGTAAG TATTTACGTAGTGCGATaaaatgaatgctaaaaatGCAGGTCTTTGACAA TCAAACGACTACTTACTCAAAGGTAAGATTGAAGCTTGTCATGTGAATGA TTTCTAGGAGCGTATTTCGGTAACCAGGTTATTATCTCCATCTATAAAAC CGACTTtgccagctggtacacaacgttgtttcaacgttcatctaacgttg tatggacattttgaacgttagataaacgttgaaacaacgttgtctgGAAG CAGGgttcgtttttttcttttggaaatattcctttctcttcttttttaga TGATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATATTGATTGTT TGCAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACATGAATTAT GGCAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCGAAAGCCAA TAAATCGGCTGAAATTATTAAAGCAGGTAAAAAATTACATATTGTATATT TACCTATATATGATTTAAAAGATAGAgacttaaggcttggggacgaTATA TGTTTTTGCAAAATTGATTCTAATCAATTTTGCTTTATTGTCCCAgagac aaaatcagcgtgtcttttgggtatgtCCTTCCccttttgtcccatgaaac aaaaaaagaaaccatgggacatgcacttttttcttgtgttggtaggatgg agcatgttgcattgcaccaacgcgaaaaaacttttttttagttATTTTCC CTGATAAAGCTATATGGTAAAAATCAATCATTTTCACGAAATTCAGGTTG TGATCCACGGCATCTAGCAAAAGGAAAACATCTATCCAAACCAAAACAAT GAAGATAATCTGGAATCTTCTGAAAAGGTTCCGTTCCATCAGATACGAAG GGTCAAATAGGAATGATCCAGCTCCATTCAAAGTTAATGCCTTGCTGCCA TTTTAATGGTTAAAACGTAGTTCATAGATGTTGAAATCTTCACAACTAAC TCACTTACTAAAGAGACTTCAAAGCGAAAACGACAATAACAGAACATCAA AAGATAACTTTATTTTAAACTTTCTCCGATAAATTTTGTCTTGACTATCA GACAATCTTATTTTACGAAAAAGGGTCTAAGCCTATCTTTGGCTTTTGGT TGCTCTGGACTCGATCTAGACTCATAAGAATAAATCCATTCTACCTCCCC CACCCTCTGCCGTTAAGAAATACGGGGAATGTGATAATCGAACAAGTTTA TTCAGTccaaaccattgagtttaaagcgcgaagggctagagtagaatctc taacatTTATAAGGCAAGATAAAGTGAAGCCA

Coding sequence (CDS) from alignment at sc0000010:155949..170280+

>TCONS_00001333 ID=TCONS_00001333|Name=TCONS_00001333|organism=Clytia hemisphaerica|type=CDS|length=32370bp|location=Sequence derived from alignment at sc0000010:155949..170280+ (Clytia hemisphaerica)
ATGGTGTTGAAGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACAT
CCAGGATGGTTTATTCGGTATTACTGATATCGAGGAAATACCTTTACAAC
AGAATCCGCAATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTT
TCAGCAGGGAAGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTAT
ATATGACTTTTCTGATTATGACAATAAACGTAACAAAGCTTATAAGGTGT
TACGAAAAGGTCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGAGCAT
CTGTCGAGTTTTGCAGTATTACAGGAATATAATGATACGTTCGTAGAGTT
TTCAGATAATGATATGGAGGATGGGAATATTTTTCCGAGCAGTAAGATGT
TGATCTCGTATTTTGCAAGGCTTGGAACAGGCGAAGATGATGAAGCTACT
ATTAATCTGAATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAA
TCAAGAGGATGCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACT
GGAACACAGATGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAAC
CATGCGGACCATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAA
TTATAAAGAAATGGTTGCATTTCTTATTAAGAAGGGAGcaaaagttCACG
CGAAAACAAGAGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATAT
AATgctgctgacgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGG
ATTAGATTTCTTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGAT
GTGAAAAATCATCAGAAATCTTCTTAAAGCTTGGTGTACCAGCTGGggaa
tatgatatttccaaccAATCAGTTATGGCATTGATAGTGGACCGATTACC
GAATCTTGGTTATCAATGTTTAGACCAGTTCATGACCACAGATGATAGTG
CGTACAGTGCATTCTTTCTGGCACATTTAGAAGGGAATATCAAAGGATCA
TCAGTGAGGGGACAAACAGTTCTTCAGTGTATTGTCAAGAATAATAACGA
AGAACTGATCATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAG
ATTTGTTCGGACGAACTCACGTTATTATGTCTAACttgttgaatatcttt
tacGTTTTATTGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTT
TGACAAACAATTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTG
GTGTTgtcttttgtttcttgtctATCGTTTACATATGGCGGGAtatcaaa
cttttattgatactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCT
TAGGGTTTACAAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAG
AAAGCGAATTTGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAA
TCGTTCTTTTATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCAC
ATCGTTTGCAATCATTGTAATGTATTTAGTGAACGTGCTGACTCCAAACA
AGACCTTATTTACTGTCTTCAAATATTTGGCTTCTGTTAACCTATTACTT
CTTTGGATGAGGTTATACAAAACAATGCGACTTAGCAAAATCTTCTCCGA
AGTTGAAATGTTATTAGTTCATATCTTAAAGACTGTGGCGAAGATAGGAA
CATTATATTTGGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCTT
TTTGGTGGGTCTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAGA
ATACGAAGTTGCCCAAATTatttatGATCTATACCATTCAGCCGTTGTTA
CACATCACGAAATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTTTTAT
TTACTCATGTTTGCAATTATCAATTTCGTTTTCATTGGTGTTATGACGGA
GCAATTTGTGCGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTCGGAG
TAGCAAATGCGTTGATCAATATTGAATTAAGAAGCAGTCATGATAAAAGA
AAAGGATACAGAAAATTTATCAGAGAGAAATGCAATCCTTACTTGGAAGA
AGTATTTGGTAAAGAACGCCATTACAGAGAGGATCGAAATGACAAATACA
TCAATATCAGCGTTGGCAGTGTATCAGAACTGTCGGAAAAACTCTCTGAC
TATCTCGaTGATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATAT
TGATTGTTTGCAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACA
TGAATTATGGCAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCG
AAAGCCAATAAATCGGCTGAAATTATTAAAGCAGGTTGTGATCCACGGCA
TCTAGCAAAAGGAAAACATCTATCCAAACCAAAACAATGAATGGTGTTGA
AGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACATCCAGGATGGT
TTATTCGGTATTACTGATATCGAGGAAATACCTTTACAACAGAATCCGCA
ATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTTTCAGCAGGGA
AGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTATATATGACTTT
TCTGATTATGACAATAAACGTAACAAAGCTTATAAGGTGTTACGAAAAGG
TCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGAGCATCTGTCGAGTT
TTGCAGTATTACAGGAATATAATGATACGTTCGTAGAGTTTTCAGATAAT
GATATGGAGGATGGGAATATTTTTCCGAGCAGTAAGATGTTGATCTCGTA
TTTTGCAAGGCTTGGAACAGGCGAAGATGATGAAGCTACTATTAATCTGA
ATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAATCAAGAGGAT
GCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACTGGAACACAGA
TGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAACCATGCGGACC
ATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAATTATAAAGAA
ATGGTTGCATTTCTTATTAAGAAGGGAGcaaaagttCACGCGAAAACAAG
AGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATATAATgctgctg
acgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGGATTAGATTTC
TTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGATGTGAAAAATC
ATCAGAAATCTTCTTAAAGCTTGGTGTACCAGCTGGggaatatgatattt
ccaaccAATCAGTTATGGCATTGATAGTGGACCGATTACCGAATCTTGGT
TATCAATGTTTAGACCAGTTCATGACCACAGATGATAGTGCGTACAGTGC
ATTCTTTCTGGCACATTTAGAAGGGAATATCAAAGGATCATCAGTGAGGG
GACAAACAGTTCTTCAGTGTATTGTCAAGAATAATAACGAAGAACTGATC
ATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAGATTTGTTCGG
ACGAACTCACGTTATTATGTCTAACttgttgaatatcttttacGTTTTAT
TGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTTTGACAAACAA
TTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTGGTGTTgtctt
ttgtttcttgtctATCGTTTACATATGGCGGGAtatcaaacttttattga
tactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCTTAGGGTTTAC
AAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAGAAAGCGAATT
TGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAATCGTTCTTTT
ATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCACATCGTTTGCA
ATCATTGTAATGTATTTAGTGAACGTGCTGACTCCAAACAAGACCTTATT
TACTGTCTTCAAATATTTGGCTTCTGTTAACCTATTACTTCTTTGGATGA
GGTTATACAAAACAATGCGACTTAGCAAAATCTTCTCCGAAGTTGAAATG
TTATTAGTTCATATCTTAAAGACTGTGGCGAAGATAGGAACATTATATTT
GGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCTTTTTGGTGGGT
CTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAGAATACGAAGTT
GCCCAAATTatttatGATCTATACCATTCAGCCGTTGTTACACATCACGA
AATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTTTTATTTACTCATGT
TTGCAATTATCAATTTCGTTTTCATTGGTGTTATGACGGAGCAATTTGTG
CGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTCGGAGTAGCAAATGC
GTTGATCAATATTGAATTAAGAAGCAGTCATGATAAAAGAAAAGGATACA
GAAAATTTATCAGAGAGAAATGCAATCCTTACTTGGAAGAAGTATTTGGT
AAAGAACGCCATTACAGAGAGGATCGAAATGACAAATACATCAATATCAG
CGTTGGCAGTGTATCAGAACTGTCGGAAAAACTCTCTGACTATCTCGaTG
ATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATATTGATTGTTTG
CAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACATGAATTATGG
CAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCGAAAGCCAATA
AATCGGCTGAAATTATTAAAGCAGGTTGTGATCCACGGCATCTAGCAAAA
GGAAAACATCTATCCAAACCAAAACAATGAATGGTGTTGAAGAAACTAAT
GAACTGGGCTGGCCAAGCTAAAGATTACATCCAGGATGGTTTATTCGGTA
TTACTGATATCGAGGAAATACCTTTACAACAGAATCCGCAATCTCCTAGT
CAAAAACGGATTCGAAAAAATGTCATGTTTTCAGCAGGGAAGGATAAAAC
AAAGCTTGAAAATGATGGCCCAAACATTATATATGACTTTTCTGATTATG
ACAATAAACGTAACAAAGCTTATAAGGTGTTACGAAAAGGTCCTTTAGAG
TTCCCAGAAGATCATCTGGAGTTCGAGCATCTGTCGAGTTTTGCAGTATT
ACAGGAATATAATGATACGTTCGTAGAGTTTTCAGATAATGATATGGAGG
ATGGGAATATTTTTCCGAGCAGTAAGATGTTGATCTCGTATTTTGCAAGG
CTTGGAACAGGCGAAGATGATGAAGCTACTATTAATCTGAATTTCATACA
AAATCTCATCGACGCTGGTGCTAACATCAATCAAGAGGATGCGTACGGTC
AAACTCTATTCTTCTCTATCGTAAGAGACTGGAACACAGATGTGGCGGAG
TACGCCCTCACAGAAGGGGCGCATATAAACCATGCGGACCATTATGGGCG
TACCGCCTTACACGTTGCTGCCTCAATAAATTATAAAGAAATGGTTGCAT
TTCTTATTAAGAAGGGAGcaaaagttCACGCGAAAACAAGAGGTGAAGAA
CAAACTCCTTTACATTATGCTGCCAAATATAATgctgctgacgtcatcga
aatTCTGATCAGTAATGGTGCAGTCGATGGATTAGATTTCTTGAATCGAA
CGCCTTTTCATTTGGCTGTTGAACATGGATGTGAAAAATCATCAGAAATC
TTCTTAAAGCTTGGTGTACCAGCTGGggaatatgatatttccaaccAATC
AGTTATGGCATTGATAGTGGACCGATTACCGAATCTTGGTTATCAATGTT
TAGACCAGTTCATGACCACAGATGATAGTGCGTACAGTGCATTCTTTCTG
GCACATTTAGAAGGGAATATCAAAGGATCATCAGTGAGGGGACAAACAGT
TCTTCAGTGTATTGTCAAGAATAATAACGAAGAACTGATCATGCATCCAA
CCATTCAAAAGCTGCTCAAAATCAAACTAGATTTGTTCGGACGAACTCAC
GTTATTATGTCTAACttgttgaatatcttttacGTTTTATTGGCAACTGT
GTTCATCTTTTCGGTGCCGTATGATAGTTTTGACAAACAATTTGTACCGT
TCGAAACACATGTTTGGAAAATATGCGTTGGTGTTgtcttttgtttcttg
tctATCGTTTACATATGGCGGGAtatcaaacttttattgatactAAACAA
AGAAGACGAGGAGTACAAAAAAGACATGCTTAGGGTTTACAAGAAAATGG
AGCAGTATTGTCATCCTGCATGGAAAACAGAAAGCGAATTTGTTGATCGG
GAAAAGAAACGGCTTGAAGAAAGTCGAAAATCGTTCTTTTATGACGGATG
GCAGTGTTATGAGCTCGTTGTAACTTTCACATCGTTTGCAATCATTGTAA
TGTATTTAGTGAACGTGCTGACTCCAAACAAGACCTTATTTACTGTCTTC
AAATATTTGGCTTCTGTTAACCTATTACTTCTTTGGATGAGGTTATACAA
AACAATGCGACTTAGCAAAATCTTCTCCGAAGTTGAAATGTTATTAGTTC
ATATCTTAAAGACTGTGGCGAAGATAGGAACATTATATTTGGTATTGCTG
GTACCATATACTTTCGTTGTTTACATGCTTTTTGGTGGGTCTGGTGATGA
GGATGTCAGAATCACCAAGACAACAAAAGAATACGAAGTTGCCCAAATTa
tttatGATCTATACCATTCAGCCGTTGTTACACATCACGAAATCAATGAG
GTTGCAAACCAAATCTTCCGTGGTTTTTATTTACTCATGTTTGCAATTAT
CAATTTCGTTTTCATTGGTGTTATGACGGAGCAATTTGTGCGCACGTACA
AGAAAGCACTTGCAAAAGTCCACCTCGGAGTAGCAAATGCGTTGATCAAT
ATTGAATTAAGAAGCAGTCATGATAAAAGAAAAGGATACAGAAAATTTAT
CAGAGAGAAATGCAATCCTTACTTGGAAGAAGTATTTGGTAAAGAACGCC
ATTACAGAGAGGATCGAAATGACAAATACATCAATATCAGCGTTGGCAGT
GTATCAGAACTGTCGGAAAAACTCTCTGACTATCTCGaTGATGCCGACTT
TCTAAATCAACCACAAAGGTCTTGTGATATTGATTGTTTGCAGAGTCTTC
AGGTAGAGTTGGAACGCCTCTCGGCAGACATGAATTATGGCAAAGCAGGG
TTACAGTTGAAATCGAAAGAAGTATTGGCGAAAGCCAATAAATCGGCTGA
AATTATTAAAGCAGGTTGTGATCCACGGCATCTAGCAAAAGGAAAACATC
TATCCAAACCAAAACAATGAATGGTGTTGAAGAAACTAATGAACTGGGCT
GGCCAAGCTAAAGATTACATCCAGGATGGTTTATTCGGTATTACTGATAT
CGAGGAAATACCTTTACAACAGAATCCGCAATCTCCTAGTCAAAAACGGA
TTCGAAAAAATGTCATGTTTTCAGCAGGGAAGGATAAAACAAAGCTTGAA
AATGATGGCCCAAACATTATATATGACTTTTCTGATTATGACAATAAACG
TAACAAAGCTTATAAGGTGTTACGAAAAGGTCCTTTAGAGTTCCCAGAAG
ATCATCTGGAGTTCGAGCATCTGTCGAGTTTTGCAGTATTACAGGAATAT
AATGATACGTTCGTAGAGTTTTCAGATAATGATATGGAGGATGGGAATAT
TTTTCCGAGCAGTAAGATGTTGATCTCGTATTTTGCAAGGCTTGGAACAG
GCGAAGATGATGAAGCTACTATTAATCTGAATTTCATACAAAATCTCATC
GACGCTGGTGCTAACATCAATCAAGAGGATGCGTACGGTCAAACTCTATT
CTTCTCTATCGTAAGAGACTGGAACACAGATGTGGCGGAGTACGCCCTCA
CAGAAGGGGCGCATATAAACCATGCGGACCATTATGGGCGTACCGCCTTA
CACGTTGCTGCCTCAATAAATTATAAAGAAATGGTTGCATTTCTTATTAA
GAAGGGAGcaaaagttCACGCGAAAACAAGAGGTGAAGAACAAACTCCTT
TACATTATGCTGCCAAATATAATgctgctgacgtcatcgaaatTCTGATC
AGTAATGGTGCAGTCGATGGATTAGATTTCTTGAATCGAACGCCTTTTCA
TTTGGCTGTTGAACATGGATGTGAAAAATCATCAGAAATCTTCTTAAAGC
TTGGTGTACCAGCTGGggaatatgatatttccaaccAATCAGTTATGGCA
TTGATAGTGGACCGATTACCGAATCTTGGTTATCAATGTTTAGACCAGTT
CATGACCACAGATGATAGTGCGTACAGTGCATTCTTTCTGGCACATTTAG
AAGGGAATATCAAAGGATCATCAGTGAGGGGACAAACAGTTCTTCAGTGT
ATTGTCAAGAATAATAACGAAGAACTGATCATGCATCCAACCATTCAAAA
GCTGCTCAAAATCAAACTAGATTTGTTCGGACGAACTCACGTTATTATGT
CTAACttgttgaatatcttttacGTTTTATTGGCAACTGTGTTCATCTTT
TCGGTGCCGTATGATAGTTTTGACAAACAATTTGTACCGTTCGAAACACA
TGTTTGGAAAATATGCGTTGGTGTTgtcttttgtttcttgtctATCGTTT
ACATATGGCGGGAtatcaaacttttattgatactAAACAAAGAAGACGAG
GAGTACAAAAAAGACATGCTTAGGGTTTACAAGAAAATGGAGCAGTATTG
TCATCCTGCATGGAAAACAGAAAGCGAATTTGTTGATCGGGAAAAGAAAC
GGCTTGAAGAAAGTCGAAAATCGTTCTTTTATGACGGATGGCAGTGTTAT
GAGCTCGTTGTAACTTTCACATCGTTTGCAATCATTGTAATGTATTTAGT
GAACGTGCTGACTCCAAACAAGACCTTATTTACTGTCTTCAAATATTTGG
CTTCTGTTAACCTATTACTTCTTTGGATGAGGTTATACAAAACAATGCGA
CTTAGCAAAATCTTCTCCGAAGTTGAAATGTTATTAGTTCATATCTTAAA
GACTGTGGCGAAGATAGGAACATTATATTTGGTATTGCTGGTACCATATA
CTTTCGTTGTTTACATGCTTTTTGGTGGGTCTGGTGATGAGGATGTCAGA
ATCACCAAGACAACAAAAGAATACGAAGTTGCCCAAATTatttatGATCT
ATACCATTCAGCCGTTGTTACACATCACGAAATCAATGAGGTTGCAAACC
AAATCTTCCGTGGTTTTTATTTACTCATGTTTGCAATTATCAATTTCGTT
TTCATTGGTGTTATGACGGAGCAATTTGTGCGCACGTACAAGAAAGCACT
TGCAAAAGTCCACCTCGGAGTAGCAAATGCGTTGATCAATATTGAATTAA
GAAGCAGTCATGATAAAAGAAAAGGATACAGAAAATTTATCAGAGAGAAA
TGCAATCCTTACTTGGAAGAAGTATTTGGTAAAGAACGCCATTACAGAGA
GGATCGAAATGACAAATACATCAATATCAGCGTTGGCAGTGTATCAGAAC
TGTCGGAAAAACTCTCTGACTATCTCGaTGATGCCGACTTTCTAAATCAA
CCACAAAGGTCTTGTGATATTGATTGTTTGCAGAGTCTTCAGGTAGAGTT
GGAACGCCTCTCGGCAGACATGAATTATGGCAAAGCAGGGTTACAGTTGA
AATCGAAAGAAGTATTGGCGAAAGCCAATAAATCGGCTGAAATTATTAAA
GCAGGTTGTGATCCACGGCATCTAGCAAAAGGAAAACATCTATCCAAACC
AAAACAATGAATGGTGTTGAAGAAACTAATGAACTGGGCTGGCCAAGCTA
AAGATTACATCCAGGATGGTTTATTCGGTATTACTGATATCGAGGAAATA
CCTTTACAACAGAATCCGCAATCTCCTAGTCAAAAACGGATTCGAAAAAA
TGTCATGTTTTCAGCAGGGAAGGATAAAACAAAGCTTGAAAATGATGGCC
CAAACATTATATATGACTTTTCTGATTATGACAATAAACGTAACAAAGCT
TATAAGGTGTTACGAAAAGGTCCTTTAGAGTTCCCAGAAGATCATCTGGA
GTTCGAGCATCTGTCGAGTTTTGCAGTATTACAGGAATATAATGATACGT
TCGTAGAGTTTTCAGATAATGATATGGAGGATGGGAATATTTTTCCGAGC
AGTAAGATGTTGATCTCGTATTTTGCAAGGCTTGGAACAGGCGAAGATGA
TGAAGCTACTATTAATCTGAATTTCATACAAAATCTCATCGACGCTGGTG
CTAACATCAATCAAGAGGATGCGTACGGTCAAACTCTATTCTTCTCTATC
GTAAGAGACTGGAACACAGATGTGGCGGAGTACGCCCTCACAGAAGGGGC
GCATATAAACCATGCGGACCATTATGGGCGTACCGCCTTACACGTTGCTG
CCTCAATAAATTATAAAGAAATGGTTGCATTTCTTATTAAGAAGGGAGca
aaagttCACGCGAAAACAAGAGGTGAAGAACAAACTCCTTTACATTATGC
TGCCAAATATAATgctgctgacgtcatcgaaatTCTGATCAGTAATGGTG
CAGTCGATGGATTAGATTTCTTGAATCGAACGCCTTTTCATTTGGCTGTT
GAACATGGATGTGAAAAATCATCAGAAATCTTCTTAAAGCTTGGTGTACC
AGCTGGggaatatgatatttccaaccAATCAGTTATGGCATTGATAGTGG
ACCGATTACCGAATCTTGGTTATCAATGTTTAGACCAGTTCATGACCACA
GATGATAGTGCGTACAGTGCATTCTTTCTGGCACATTTAGAAGGGAATAT
CAAAGGATCATCAGTGAGGGGACAAACAGTTCTTCAGTGTATTGTCAAGA
ATAATAACGAAGAACTGATCATGCATCCAACCATTCAAAAGCTGCTCAAA
ATCAAACTAGATTTGTTCGGACGAACTCACGTTATTATGTCTAACttgtt
gaatatcttttacGTTTTATTGGCAACTGTGTTCATCTTTTCGGTGCCGT
ATGATAGTTTTGACAAACAATTTGTACCGTTCGAAACACATGTTTGGAAA
ATATGCGTTGGTGTTgtcttttgtttcttgtctATCGTTTACATATGGCG
GGAtatcaaacttttattgatactAAACAAAGAAGACGAGGAGTACAAAA
AAGACATGCTTAGGGTTTACAAGAAAATGGAGCAGTATTGTCATCCTGCA
TGGAAAACAGAAAGCGAATTTGTTGATCGGGAAAAGAAACGGCTTGAAGA
AAGTCGAAAATCGTTCTTTTATGACGGATGGCAGTGTTATGAGCTCGTTG
TAACTTTCACATCGTTTGCAATCATTGTAATGTATTTAGTGAACGTGCTG
ACTCCAAACAAGACCTTATTTACTGTCTTCAAATATTTGGCTTCTGTTAA
CCTATTACTTCTTTGGATGAGGTTATACAAAACAATGCGACTTAGCAAAA
TCTTCTCCGAAGTTGAAATGTTATTAGTTCATATCTTAAAGACTGTGGCG
AAGATAGGAACATTATATTTGGTATTGCTGGTACCATATACTTTCGTTGT
TTACATGCTTTTTGGTGGGTCTGGTGATGAGGATGTCAGAATCACCAAGA
CAACAAAAGAATACGAAGTTGCCCAAATTatttatGATCTATACCATTCA
GCCGTTGTTACACATCACGAAATCAATGAGGTTGCAAACCAAATCTTCCG
TGGTTTTTATTTACTCATGTTTGCAATTATCAATTTCGTTTTCATTGGTG
TTATGACGGAGCAATTTGTGCGCACGTACAAGAAAGCACTTGCAAAAGTC
CACCTCGGAGTAGCAAATGCGTTGATCAATATTGAATTAAGAAGCAGTCA
TGATAAAAGAAAAGGATACAGAAAATTTATCAGAGAGAAATGCAATCCTT
ACTTGGAAGAAGTATTTGGTAAAGAACGCCATTACAGAGAGGATCGAAAT
GACAAATACATCAATATCAGCGTTGGCAGTGTATCAGAACTGTCGGAAAA
ACTCTCTGACTATCTCGaTGATGCCGACTTTCTAAATCAACCACAAAGGT
CTTGTGATATTGATTGTTTGCAGAGTCTTCAGGTAGAGTTGGAACGCCTC
TCGGCAGACATGAATTATGGCAAAGCAGGGTTACAGTTGAAATCGAAAGA
AGTATTGGCGAAAGCCAATAAATCGGCTGAAATTATTAAAGCAGGTTGTG
ATCCACGGCATCTAGCAAAAGGAAAACATCTATCCAAACCAAAACAATGA
ATGGTGTTGAAGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACAT
CCAGGATGGTTTATTCGGTATTACTGATATCGAGGAAATACCTTTACAAC
AGAATCCGCAATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTT
TCAGCAGGGAAGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTAT
ATATGACTTTTCTGATTATGACAATAAACGTAACAAAGCTTATAAGGTGT
TACGAAAAGGTCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGAGCAT
CTGTCGAGTTTTGCAGTATTACAGGAATATAATGATACGTTCGTAGAGTT
TTCAGATAATGATATGGAGGATGGGAATATTTTTCCGAGCAGTAAGATGT
TGATCTCGTATTTTGCAAGGCTTGGAACAGGCGAAGATGATGAAGCTACT
ATTAATCTGAATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAA
TCAAGAGGATGCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACT
GGAACACAGATGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAAC
CATGCGGACCATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAA
TTATAAAGAAATGGTTGCATTTCTTATTAAGAAGGGAGcaaaagttCACG
CGAAAACAAGAGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATAT
AATgctgctgacgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGG
ATTAGATTTCTTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGAT
GTGAAAAATCATCAGAAATCTTCTTAAAGCTTGGTGTACCAGCTGGggaa
tatgatatttccaaccAATCAGTTATGGCATTGATAGTGGACCGATTACC
GAATCTTGGTTATCAATGTTTAGACCAGTTCATGACCACAGATGATAGTG
CGTACAGTGCATTCTTTCTGGCACATTTAGAAGGGAATATCAAAGGATCA
TCAGTGAGGGGACAAACAGTTCTTCAGTGTATTGTCAAGAATAATAACGA
AGAACTGATCATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAG
ATTTGTTCGGACGAACTCACGTTATTATGTCTAACttgttgaatatcttt
tacGTTTTATTGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTT
TGACAAACAATTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTG
GTGTTgtcttttgtttcttgtctATCGTTTACATATGGCGGGAtatcaaa
cttttattgatactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCT
TAGGGTTTACAAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAG
AAAGCGAATTTGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAA
TCGTTCTTTTATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCAC
ATCGTTTGCAATCATTGTAATGTATTTAGTGAACGTGCTGACTCCAAACA
AGACCTTATTTACTGTCTTCAAATATTTGGCTTCTGTTAACCTATTACTT
CTTTGGATGAGGTTATACAAAACAATGCGACTTAGCAAAATCTTCTCCGA
AGTTGAAATGTTATTAGTTCATATCTTAAAGACTGTGGCGAAGATAGGAA
CATTATATTTGGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCTT
TTTGGTGGGTCTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAGA
ATACGAAGTTGCCCAAATTatttatGATCTATACCATTCAGCCGTTGTTA
CACATCACGAAATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTTTTAT
TTACTCATGTTTGCAATTATCAATTTCGTTTTCATTGGTGTTATGACGGA
GCAATTTGTGCGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTCGGAG
TAGCAAATGCGTTGATCAATATTGAATTAAGAAGCAGTCATGATAAAAGA
AAAGGATACAGAAAATTTATCAGAGAGAAATGCAATCCTTACTTGGAAGA
AGTATTTGGTAAAGAACGCCATTACAGAGAGGATCGAAATGACAAATACA
TCAATATCAGCGTTGGCAGTGTATCAGAACTGTCGGAAAAACTCTCTGAC
TATCTCGaTGATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATAT
TGATTGTTTGCAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACA
TGAATTATGGCAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCG
AAAGCCAATAAATCGGCTGAAATTATTAAAGCAGGTTGTGATCCACGGCA
TCTAGCAAAAGGAAAACATCTATCCAAACCAAAACAATGAATGGTGTTGA
AGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACATCCAGGATGGT
TTATTCGGTATTACTGATATCGAGGAAATACCTTTACAACAGAATCCGCA
ATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTTTCAGCAGGGA
AGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTATATATGACTTT
TCTGATTATGACAATAAACGTAACAAAGCTTATAAGGTGTTACGAAAAGG
TCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGAGCATCTGTCGAGTT
TTGCAGTATTACAGGAATATAATGATACGTTCGTAGAGTTTTCAGATAAT
GATATGGAGGATGGGAATATTTTTCCGAGCAGTAAGATGTTGATCTCGTA
TTTTGCAAGGCTTGGAACAGGCGAAGATGATGAAGCTACTATTAATCTGA
ATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAATCAAGAGGAT
GCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACTGGAACACAGA
TGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAACCATGCGGACC
ATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAATTATAAAGAA
ATGGTTGCATTTCTTATTAAGAAGGGAGcaaaagttCACGCGAAAACAAG
AGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATATAATgctgctg
acgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGGATTAGATTTC
TTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGATGTGAAAAATC
ATCAGAAATCTTCTTAAAGCTTGGTGTACCAGCTGGggaatatgatattt
ccaaccAATCAGTTATGGCATTGATAGTGGACCGATTACCGAATCTTGGT
TATCAATGTTTAGACCAGTTCATGACCACAGATGATAGTGCGTACAGTGC
ATTCTTTCTGGCACATTTAGAAGGGAATATCAAAGGATCATCAGTGAGGG
GACAAACAGTTCTTCAGTGTATTGTCAAGAATAATAACGAAGAACTGATC
ATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAGATTTGTTCGG
ACGAACTCACGTTATTATGTCTAACttgttgaatatcttttacGTTTTAT
TGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTTTGACAAACAA
TTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTGGTGTTgtctt
ttgtttcttgtctATCGTTTACATATGGCGGGAtatcaaacttttattga
tactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCTTAGGGTTTAC
AAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAGAAAGCGAATT
TGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAATCGTTCTTTT
ATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCACATCGTTTGCA
ATCATTGTAATGTATTTAGTGAACGTGCTGACTCCAAACAAGACCTTATT
TACTGTCTTCAAATATTTGGCTTCTGTTAACCTATTACTTCTTTGGATGA
GGTTATACAAAACAATGCGACTTAGCAAAATCTTCTCCGAAGTTGAAATG
TTATTAGTTCATATCTTAAAGACTGTGGCGAAGATAGGAACATTATATTT
GGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCTTTTTGGTGGGT
CTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAGAATACGAAGTT
GCCCAAATTatttatGATCTATACCATTCAGCCGTTGTTACACATCACGA
AATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTTTTATTTACTCATGT
TTGCAATTATCAATTTCGTTTTCATTGGTGTTATGACGGAGCAATTTGTG
CGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTCGGAGTAGCAAATGC
GTTGATCAATATTGAATTAAGAAGCAGTCATGATAAAAGAAAAGGATACA
GAAAATTTATCAGAGAGAAATGCAATCCTTACTTGGAAGAAGTATTTGGT
AAAGAACGCCATTACAGAGAGGATCGAAATGACAAATACATCAATATCAG
CGTTGGCAGTGTATCAGAACTGTCGGAAAAACTCTCTGACTATCTCGaTG
ATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATATTGATTGTTTG
CAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACATGAATTATGG
CAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCGAAAGCCAATA
AATCGGCTGAAATTATTAAAGCAGGTTGTGATCCACGGCATCTAGCAAAA
GGAAAACATCTATCCAAACCAAAACAATGAATGGTGTTGAAGAAACTAAT
GAACTGGGCTGGCCAAGCTAAAGATTACATCCAGGATGGTTTATTCGGTA
TTACTGATATCGAGGAAATACCTTTACAACAGAATCCGCAATCTCCTAGT
CAAAAACGGATTCGAAAAAATGTCATGTTTTCAGCAGGGAAGGATAAAAC
AAAGCTTGAAAATGATGGCCCAAACATTATATATGACTTTTCTGATTATG
ACAATAAACGTAACAAAGCTTATAAGGTGTTACGAAAAGGTCCTTTAGAG
TTCCCAGAAGATCATCTGGAGTTCGAGCATCTGTCGAGTTTTGCAGTATT
ACAGGAATATAATGATACGTTCGTAGAGTTTTCAGATAATGATATGGAGG
ATGGGAATATTTTTCCGAGCAGTAAGATGTTGATCTCGTATTTTGCAAGG
CTTGGAACAGGCGAAGATGATGAAGCTACTATTAATCTGAATTTCATACA
AAATCTCATCGACGCTGGTGCTAACATCAATCAAGAGGATGCGTACGGTC
AAACTCTATTCTTCTCTATCGTAAGAGACTGGAACACAGATGTGGCGGAG
TACGCCCTCACAGAAGGGGCGCATATAAACCATGCGGACCATTATGGGCG
TACCGCCTTACACGTTGCTGCCTCAATAAATTATAAAGAAATGGTTGCAT
TTCTTATTAAGAAGGGAGcaaaagttCACGCGAAAACAAGAGGTGAAGAA
CAAACTCCTTTACATTATGCTGCCAAATATAATgctgctgacgtcatcga
aatTCTGATCAGTAATGGTGCAGTCGATGGATTAGATTTCTTGAATCGAA
CGCCTTTTCATTTGGCTGTTGAACATGGATGTGAAAAATCATCAGAAATC
TTCTTAAAGCTTGGTGTACCAGCTGGggaatatgatatttccaaccAATC
AGTTATGGCATTGATAGTGGACCGATTACCGAATCTTGGTTATCAATGTT
TAGACCAGTTCATGACCACAGATGATAGTGCGTACAGTGCATTCTTTCTG
GCACATTTAGAAGGGAATATCAAAGGATCATCAGTGAGGGGACAAACAGT
TCTTCAGTGTATTGTCAAGAATAATAACGAAGAACTGATCATGCATCCAA
CCATTCAAAAGCTGCTCAAAATCAAACTAGATTTGTTCGGACGAACTCAC
GTTATTATGTCTAACttgttgaatatcttttacGTTTTATTGGCAACTGT
GTTCATCTTTTCGGTGCCGTATGATAGTTTTGACAAACAATTTGTACCGT
TCGAAACACATGTTTGGAAAATATGCGTTGGTGTTgtcttttgtttcttg
tctATCGTTTACATATGGCGGGAtatcaaacttttattgatactAAACAA
AGAAGACGAGGAGTACAAAAAAGACATGCTTAGGGTTTACAAGAAAATGG
AGCAGTATTGTCATCCTGCATGGAAAACAGAAAGCGAATTTGTTGATCGG
GAAAAGAAACGGCTTGAAGAAAGTCGAAAATCGTTCTTTTATGACGGATG
GCAGTGTTATGAGCTCGTTGTAACTTTCACATCGTTTGCAATCATTGTAA
TGTATTTAGTGAACGTGCTGACTCCAAACAAGACCTTATTTACTGTCTTC
AAATATTTGGCTTCTGTTAACCTATTACTTCTTTGGATGAGGTTATACAA
AACAATGCGACTTAGCAAAATCTTCTCCGAAGTTGAAATGTTATTAGTTC
ATATCTTAAAGACTGTGGCGAAGATAGGAACATTATATTTGGTATTGCTG
GTACCATATACTTTCGTTGTTTACATGCTTTTTGGTGGGTCTGGTGATGA
GGATGTCAGAATCACCAAGACAACAAAAGAATACGAAGTTGCCCAAATTa
tttatGATCTATACCATTCAGCCGTTGTTACACATCACGAAATCAATGAG
GTTGCAAACCAAATCTTCCGTGGTTTTTATTTACTCATGTTTGCAATTAT
CAATTTCGTTTTCATTGGTGTTATGACGGAGCAATTTGTGCGCACGTACA
AGAAAGCACTTGCAAAAGTCCACCTCGGAGTAGCAAATGCGTTGATCAAT
ATTGAATTAAGAAGCAGTCATGATAAAAGAAAAGGATACAGAAAATTTAT
CAGAGAGAAATGCAATCCTTACTTGGAAGAAGTATTTGGTAAAGAACGCC
ATTACAGAGAGGATCGAAATGACAAATACATCAATATCAGCGTTGGCAGT
GTATCAGAACTGTCGGAAAAACTCTCTGACTATCTCGaTGATGCCGACTT
TCTAAATCAACCACAAAGGTCTTGTGATATTGATTGTTTGCAGAGTCTTC
AGGTAGAGTTGGAACGCCTCTCGGCAGACATGAATTATGGCAAAGCAGGG
TTACAGTTGAAATCGAAAGAAGTATTGGCGAAAGCCAATAAATCGGCTGA
AATTATTAAAGCAGGTTGTGATCCACGGCATCTAGCAAAAGGAAAACATC
TATCCAAACCAAAACAATGAATGGTGTTGAAGAAACTAATGAACTGGGCT
GGCCAAGCTAAAGATTACATCCAGGATGGTTTATTCGGTATTACTGATAT
CGAGGAAATACCTTTACAACAGAATCCGCAATCTCCTAGTCAAAAACGGA
TTCGAAAAAATGTCATGTTTTCAGCAGGGAAGGATAAAACAAAGCTTGAA
AATGATGGCCCAAACATTATATATGACTTTTCTGATTATGACAATAAACG
TAACAAAGCTTATAAGGTGTTACGAAAAGGTCCTTTAGAGTTCCCAGAAG
ATCATCTGGAGTTCGAGCATCTGTCGAGTTTTGCAGTATTACAGGAATAT
AATGATACGTTCGTAGAGTTTTCAGATAATGATATGGAGGATGGGAATAT
TTTTCCGAGCAGTAAGATGTTGATCTCGTATTTTGCAAGGCTTGGAACAG
GCGAAGATGATGAAGCTACTATTAATCTGAATTTCATACAAAATCTCATC
GACGCTGGTGCTAACATCAATCAAGAGGATGCGTACGGTCAAACTCTATT
CTTCTCTATCGTAAGAGACTGGAACACAGATGTGGCGGAGTACGCCCTCA
CAGAAGGGGCGCATATAAACCATGCGGACCATTATGGGCGTACCGCCTTA
CACGTTGCTGCCTCAATAAATTATAAAGAAATGGTTGCATTTCTTATTAA
GAAGGGAGcaaaagttCACGCGAAAACAAGAGGTGAAGAACAAACTCCTT
TACATTATGCTGCCAAATATAATgctgctgacgtcatcgaaatTCTGATC
AGTAATGGTGCAGTCGATGGATTAGATTTCTTGAATCGAACGCCTTTTCA
TTTGGCTGTTGAACATGGATGTGAAAAATCATCAGAAATCTTCTTAAAGC
TTGGTGTACCAGCTGGggaatatgatatttccaaccAATCAGTTATGGCA
TTGATAGTGGACCGATTACCGAATCTTGGTTATCAATGTTTAGACCAGTT
CATGACCACAGATGATAGTGCGTACAGTGCATTCTTTCTGGCACATTTAG
AAGGGAATATCAAAGGATCATCAGTGAGGGGACAAACAGTTCTTCAGTGT
ATTGTCAAGAATAATAACGAAGAACTGATCATGCATCCAACCATTCAAAA
GCTGCTCAAAATCAAACTAGATTTGTTCGGACGAACTCACGTTATTATGT
CTAACttgttgaatatcttttacGTTTTATTGGCAACTGTGTTCATCTTT
TCGGTGCCGTATGATAGTTTTGACAAACAATTTGTACCGTTCGAAACACA
TGTTTGGAAAATATGCGTTGGTGTTgtcttttgtttcttgtctATCGTTT
ACATATGGCGGGAtatcaaacttttattgatactAAACAAAGAAGACGAG
GAGTACAAAAAAGACATGCTTAGGGTTTACAAGAAAATGGAGCAGTATTG
TCATCCTGCATGGAAAACAGAAAGCGAATTTGTTGATCGGGAAAAGAAAC
GGCTTGAAGAAAGTCGAAAATCGTTCTTTTATGACGGATGGCAGTGTTAT
GAGCTCGTTGTAACTTTCACATCGTTTGCAATCATTGTAATGTATTTAGT
GAACGTGCTGACTCCAAACAAGACCTTATTTACTGTCTTCAAATATTTGG
CTTCTGTTAACCTATTACTTCTTTGGATGAGGTTATACAAAACAATGCGA
CTTAGCAAAATCTTCTCCGAAGTTGAAATGTTATTAGTTCATATCTTAAA
GACTGTGGCGAAGATAGGAACATTATATTTGGTATTGCTGGTACCATATA
CTTTCGTTGTTTACATGCTTTTTGGTGGGTCTGGTGATGAGGATGTCAGA
ATCACCAAGACAACAAAAGAATACGAAGTTGCCCAAATTatttatGATCT
ATACCATTCAGCCGTTGTTACACATCACGAAATCAATGAGGTTGCAAACC
AAATCTTCCGTGGTTTTTATTTACTCATGTTTGCAATTATCAATTTCGTT
TTCATTGGTGTTATGACGGAGCAATTTGTGCGCACGTACAAGAAAGCACT
TGCAAAAGTCCACCTCGGAGTAGCAAATGCGTTGATCAATATTGAATTAA
GAAGCAGTCATGATAAAAGAAAAGGATACAGAAAATTTATCAGAGAGAAA
TGCAATCCTTACTTGGAAGAAGTATTTGGTAAAGAACGCCATTACAGAGA
GGATCGAAATGACAAATACATCAATATCAGCGTTGGCAGTGTATCAGAAC
TGTCGGAAAAACTCTCTGACTATCTCGaTGATGCCGACTTTCTAAATCAA
CCACAAAGGTCTTGTGATATTGATTGTTTGCAGAGTCTTCAGGTAGAGTT
GGAACGCCTCTCGGCAGACATGAATTATGGCAAAGCAGGGTTACAGTTGA
AATCGAAAGAAGTATTGGCGAAAGCCAATAAATCGGCTGAAATTATTAAA
GCAGGTTGTGATCCACGGCATCTAGCAAAAGGAAAACATCTATCCAAACC
AAAACAATGAATGGTGTTGAAGAAACTAATGAACTGGGCTGGCCAAGCTA
AAGATTACATCCAGGATGGTTTATTCGGTATTACTGATATCGAGGAAATA
CCTTTACAACAGAATCCGCAATCTCCTAGTCAAAAACGGATTCGAAAAAA
TGTCATGTTTTCAGCAGGGAAGGATAAAACAAAGCTTGAAAATGATGGCC
CAAACATTATATATGACTTTTCTGATTATGACAATAAACGTAACAAAGCT
TATAAGGTGTTACGAAAAGGTCCTTTAGAGTTCCCAGAAGATCATCTGGA
GTTCGAGCATCTGTCGAGTTTTGCAGTATTACAGGAATATAATGATACGT
TCGTAGAGTTTTCAGATAATGATATGGAGGATGGGAATATTTTTCCGAGC
AGTAAGATGTTGATCTCGTATTTTGCAAGGCTTGGAACAGGCGAAGATGA
TGAAGCTACTATTAATCTGAATTTCATACAAAATCTCATCGACGCTGGTG
CTAACATCAATCAAGAGGATGCGTACGGTCAAACTCTATTCTTCTCTATC
GTAAGAGACTGGAACACAGATGTGGCGGAGTACGCCCTCACAGAAGGGGC
GCATATAAACCATGCGGACCATTATGGGCGTACCGCCTTACACGTTGCTG
CCTCAATAAATTATAAAGAAATGGTTGCATTTCTTATTAAGAAGGGAGca
aaagttCACGCGAAAACAAGAGGTGAAGAACAAACTCCTTTACATTATGC
TGCCAAATATAATgctgctgacgtcatcgaaatTCTGATCAGTAATGGTG
CAGTCGATGGATTAGATTTCTTGAATCGAACGCCTTTTCATTTGGCTGTT
GAACATGGATGTGAAAAATCATCAGAAATCTTCTTAAAGCTTGGTGTACC
AGCTGGggaatatgatatttccaaccAATCAGTTATGGCATTGATAGTGG
ACCGATTACCGAATCTTGGTTATCAATGTTTAGACCAGTTCATGACCACA
GATGATAGTGCGTACAGTGCATTCTTTCTGGCACATTTAGAAGGGAATAT
CAAAGGATCATCAGTGAGGGGACAAACAGTTCTTCAGTGTATTGTCAAGA
ATAATAACGAAGAACTGATCATGCATCCAACCATTCAAAAGCTGCTCAAA
ATCAAACTAGATTTGTTCGGACGAACTCACGTTATTATGTCTAACttgtt
gaatatcttttacGTTTTATTGGCAACTGTGTTCATCTTTTCGGTGCCGT
ATGATAGTTTTGACAAACAATTTGTACCGTTCGAAACACATGTTTGGAAA
ATATGCGTTGGTGTTgtcttttgtttcttgtctATCGTTTACATATGGCG
GGAtatcaaacttttattgatactAAACAAAGAAGACGAGGAGTACAAAA
AAGACATGCTTAGGGTTTACAAGAAAATGGAGCAGTATTGTCATCCTGCA
TGGAAAACAGAAAGCGAATTTGTTGATCGGGAAAAGAAACGGCTTGAAGA
AAGTCGAAAATCGTTCTTTTATGACGGATGGCAGTGTTATGAGCTCGTTG
TAACTTTCACATCGTTTGCAATCATTGTAATGTATTTAGTGAACGTGCTG
ACTCCAAACAAGACCTTATTTACTGTCTTCAAATATTTGGCTTCTGTTAA
CCTATTACTTCTTTGGATGAGGTTATACAAAACAATGCGACTTAGCAAAA
TCTTCTCCGAAGTTGAAATGTTATTAGTTCATATCTTAAAGACTGTGGCG
AAGATAGGAACATTATATTTGGTATTGCTGGTACCATATACTTTCGTTGT
TTACATGCTTTTTGGTGGGTCTGGTGATGAGGATGTCAGAATCACCAAGA
CAACAAAAGAATACGAAGTTGCCCAAATTatttatGATCTATACCATTCA
GCCGTTGTTACACATCACGAAATCAATGAGGTTGCAAACCAAATCTTCCG
TGGTTTTTATTTACTCATGTTTGCAATTATCAATTTCGTTTTCATTGGTG
TTATGACGGAGCAATTTGTGCGCACGTACAAGAAAGCACTTGCAAAAGTC
CACCTCGGAGTAGCAAATGCGTTGATCAATATTGAATTAAGAAGCAGTCA
TGATAAAAGAAAAGGATACAGAAAATTTATCAGAGAGAAATGCAATCCTT
ACTTGGAAGAAGTATTTGGTAAAGAACGCCATTACAGAGAGGATCGAAAT
GACAAATACATCAATATCAGCGTTGGCAGTGTATCAGAACTGTCGGAAAA
ACTCTCTGACTATCTCGaTGATGCCGACTTTCTAAATCAACCACAAAGGT
CTTGTGATATTGATTGTTTGCAGAGTCTTCAGGTAGAGTTGGAACGCCTC
TCGGCAGACATGAATTATGGCAAAGCAGGGTTACAGTTGAAATCGAAAGA
AGTATTGGCGAAAGCCAATAAATCGGCTGAAATTATTAAAGCAGGTTGTG
ATCCACGGCATCTAGCAAAAGGAAAACATCTATCCAAACCAAAACAATGA
ATGGTGTTGAAGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACAT
CCAGGATGGTTTATTCGGTATTACTGATATCGAGGAAATACCTTTACAAC
AGAATCCGCAATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTT
TCAGCAGGGAAGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTAT
ATATGACTTTTCTGATTATGACAATAAACGTAACAAAGCTTATAAGGTGT
TACGAAAAGGTCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGAGCAT
CTGTCGAGTTTTGCAGTATTACAGGAATATAATGATACGTTCGTAGAGTT
TTCAGATAATGATATGGAGGATGGGAATATTTTTCCGAGCAGTAAGATGT
TGATCTCGTATTTTGCAAGGCTTGGAACAGGCGAAGATGATGAAGCTACT
ATTAATCTGAATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAA
TCAAGAGGATGCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACT
GGAACACAGATGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAAC
CATGCGGACCATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAA
TTATAAAGAAATGGTTGCATTTCTTATTAAGAAGGGAGcaaaagttCACG
CGAAAACAAGAGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATAT
AATgctgctgacgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGG
ATTAGATTTCTTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGAT
GTGAAAAATCATCAGAAATCTTCTTAAAGCTTGGTGTACCAGCTGGggaa
tatgatatttccaaccAATCAGTTATGGCATTGATAGTGGACCGATTACC
GAATCTTGGTTATCAATGTTTAGACCAGTTCATGACCACAGATGATAGTG
CGTACAGTGCATTCTTTCTGGCACATTTAGAAGGGAATATCAAAGGATCA
TCAGTGAGGGGACAAACAGTTCTTCAGTGTATTGTCAAGAATAATAACGA
AGAACTGATCATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAG
ATTTGTTCGGACGAACTCACGTTATTATGTCTAACttgttgaatatcttt
tacGTTTTATTGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTT
TGACAAACAATTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTG
GTGTTgtcttttgtttcttgtctATCGTTTACATATGGCGGGAtatcaaa
cttttattgatactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCT
TAGGGTTTACAAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAG
AAAGCGAATTTGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAA
TCGTTCTTTTATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCAC
ATCGTTTGCAATCATTGTAATGTATTTAGTGAACGTGCTGACTCCAAACA
AGACCTTATTTACTGTCTTCAAATATTTGGCTTCTGTTAACCTATTACTT
CTTTGGATGAGGTTATACAAAACAATGCGACTTAGCAAAATCTTCTCCGA
AGTTGAAATGTTATTAGTTCATATCTTAAAGACTGTGGCGAAGATAGGAA
CATTATATTTGGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCTT
TTTGGTGGGTCTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAGA
ATACGAAGTTGCCCAAATTatttatGATCTATACCATTCAGCCGTTGTTA
CACATCACGAAATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTTTTAT
TTACTCATGTTTGCAATTATCAATTTCGTTTTCATTGGTGTTATGACGGA
GCAATTTGTGCGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTCGGAG
TAGCAAATGCGTTGATCAATATTGAATTAAGAAGCAGTCATGATAAAAGA
AAAGGATACAGAAAATTTATCAGAGAGAAATGCAATCCTTACTTGGAAGA
AGTATTTGGTAAAGAACGCCATTACAGAGAGGATCGAAATGACAAATACA
TCAATATCAGCGTTGGCAGTGTATCAGAACTGTCGGAAAAACTCTCTGAC
TATCTCGaTGATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATAT
TGATTGTTTGCAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACA
TGAATTATGGCAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCG
AAAGCCAATAAATCGGCTGAAATTATTAAAGCAGGTTGTGATCCACGGCA
TCTAGCAAAAGGAAAACATCTATCCAAACCAAAACAATGAATGGTGTTGA
AGAAACTAATGAACTGGGCTGGCCAAGCTAAAGATTACATCCAGGATGGT
TTATTCGGTATTACTGATATCGAGGAAATACCTTTACAACAGAATCCGCA
ATCTCCTAGTCAAAAACGGATTCGAAAAAATGTCATGTTTTCAGCAGGGA
AGGATAAAACAAAGCTTGAAAATGATGGCCCAAACATTATATATGACTTT
TCTGATTATGACAATAAACGTAACAAAGCTTATAAGGTGTTACGAAAAGG
TCCTTTAGAGTTCCCAGAAGATCATCTGGAGTTCGAGCATCTGTCGAGTT
TTGCAGTATTACAGGAATATAATGATACGTTCGTAGAGTTTTCAGATAAT
GATATGGAGGATGGGAATATTTTTCCGAGCAGTAAGATGTTGATCTCGTA
TTTTGCAAGGCTTGGAACAGGCGAAGATGATGAAGCTACTATTAATCTGA
ATTTCATACAAAATCTCATCGACGCTGGTGCTAACATCAATCAAGAGGAT
GCGTACGGTCAAACTCTATTCTTCTCTATCGTAAGAGACTGGAACACAGA
TGTGGCGGAGTACGCCCTCACAGAAGGGGCGCATATAAACCATGCGGACC
ATTATGGGCGTACCGCCTTACACGTTGCTGCCTCAATAAATTATAAAGAA
ATGGTTGCATTTCTTATTAAGAAGGGAGcaaaagttCACGCGAAAACAAG
AGGTGAAGAACAAACTCCTTTACATTATGCTGCCAAATATAATgctgctg
acgtcatcgaaatTCTGATCAGTAATGGTGCAGTCGATGGATTAGATTTC
TTGAATCGAACGCCTTTTCATTTGGCTGTTGAACATGGATGTGAAAAATC
ATCAGAAATCTTCTTAAAGCTTGGTGTACCAGCTGGggaatatgatattt
ccaaccAATCAGTTATGGCATTGATAGTGGACCGATTACCGAATCTTGGT
TATCAATGTTTAGACCAGTTCATGACCACAGATGATAGTGCGTACAGTGC
ATTCTTTCTGGCACATTTAGAAGGGAATATCAAAGGATCATCAGTGAGGG
GACAAACAGTTCTTCAGTGTATTGTCAAGAATAATAACGAAGAACTGATC
ATGCATCCAACCATTCAAAAGCTGCTCAAAATCAAACTAGATTTGTTCGG
ACGAACTCACGTTATTATGTCTAACttgttgaatatcttttacGTTTTAT
TGGCAACTGTGTTCATCTTTTCGGTGCCGTATGATAGTTTTGACAAACAA
TTTGTACCGTTCGAAACACATGTTTGGAAAATATGCGTTGGTGTTgtctt
ttgtttcttgtctATCGTTTACATATGGCGGGAtatcaaacttttattga
tactAAACAAAGAAGACGAGGAGTACAAAAAAGACATGCTTAGGGTTTAC
AAGAAAATGGAGCAGTATTGTCATCCTGCATGGAAAACAGAAAGCGAATT
TGTTGATCGGGAAAAGAAACGGCTTGAAGAAAGTCGAAAATCGTTCTTTT
ATGACGGATGGCAGTGTTATGAGCTCGTTGTAACTTTCACATCGTTTGCA
ATCATTGTAATGTATTTAGTGAACGTGCTGACTCCAAACAAGACCTTATT
TACTGTCTTCAAATATTTGGCTTCTGTTAACCTATTACTTCTTTGGATGA
GGTTATACAAAACAATGCGACTTAGCAAAATCTTCTCCGAAGTTGAAATG
TTATTAGTTCATATCTTAAAGACTGTGGCGAAGATAGGAACATTATATTT
GGTATTGCTGGTACCATATACTTTCGTTGTTTACATGCTTTTTGGTGGGT
CTGGTGATGAGGATGTCAGAATCACCAAGACAACAAAAGAATACGAAGTT
GCCCAAATTatttatGATCTATACCATTCAGCCGTTGTTACACATCACGA
AATCAATGAGGTTGCAAACCAAATCTTCCGTGGTTTTTATTTACTCATGT
TTGCAATTATCAATTTCGTTTTCATTGGTGTTATGACGGAGCAATTTGTG
CGCACGTACAAGAAAGCACTTGCAAAAGTCCACCTCGGAGTAGCAAATGC
GTTGATCAATATTGAATTAAGAAGCAGTCATGATAAAAGAAAAGGATACA
GAAAATTTATCAGAGAGAAATGCAATCCTTACTTGGAAGAAGTATTTGGT
AAAGAACGCCATTACAGAGAGGATCGAAATGACAAATACATCAATATCAG
CGTTGGCAGTGTATCAGAACTGTCGGAAAAACTCTCTGACTATCTCGaTG
ATGCCGACTTTCTAAATCAACCACAAAGGTCTTGTGATATTGATTGTTTG
CAGAGTCTTCAGGTAGAGTTGGAACGCCTCTCGGCAGACATGAATTATGG
CAAAGCAGGGTTACAGTTGAAATCGAAAGAAGTATTGGCGAAAGCCAATA
AATCGGCTGAAATTATTAAAGCAGGTTGTGATCCACGGCATCTAGCAAAA
GGAAAACATCTATCCAAACCAAAACAATGAATGGTGTTGAAGAAACTAAT
GAACTGGGCTGGCCAAGCTAAAGATTACATCCAGGATGGTTTATTCGGTA
TTACTGATATCGAGGAAATACCTTTACAACAGAATCCGCAATCTCCTAGT
CAAAAACGGATTCGAAAAAATGTCATGTTTTCAGCAGGGAAGGATAAAAC
AAAGCTTGAAAATGATGGCCCAAACATTATATATGACTTTTCTGATTATG
ACAATAAACGTAACAAAGCTTATAAGGTGTTACGAAAAGGTCCTTTAGAG
TTCCCAGAAGATCATCTGGAGTTCGAGCATCTGTCGAGTTTTGCAGTATT
ACAGGAATATAATGATACGTTCGTAGAGTTTTCAGATAATGATATGGAGG
ATGGGAATATTTTTCCGAGCAGTAAGATGTTGATCTCGTATTTTGCAAGG
CTTGGAACAGGCGAAGATGATGAAGCTACTATTAATCTGAATTTCATACA
AAATCTCATCGACGCTGGTGCTAACATCAATCAAGAGGATGCGTACGGTC
AAACTCTATTCTTCTCTATCGTAAGAGACTGGAACACAGATGTGGCGGAG
TACGCCCTCACAGAAGGGGCGCATATAAACCATGCGGACCATTATGGGCG
TACCGCCTTACACGTTGCTGCCTCAATAAATTATAAAGAAATGGTTGCAT
TTCTTATTAAGAAGGGAGcaaaagttCACGCGAAAACAAGAGGTGAAGAA
CAAACTCCTTTACATTATGCTGCCAAATATAATgctgctgacgtcatcga
aatTCTGATCAGTAATGGTGCAGTCGATGGATTAGATTTCTTGAATCGAA
CGCCTTTTCATTTGGCTGTTGAACATGGATGTGAAAAATCATCAGAAATC
TTCTTAAAGCTTGGTGTACCAGCTGGggaatatgatatttccaaccAATC
AGTTATGGCATTGATAGTGGACCGATTACCGAATCTTGGTTATCAATGTT
TAGACCAGTTCATGACCACAGATGATAGTGCGTACAGTGCATTCTTTCTG
GCACATTTAGAAGGGAATATCAAAGGATCATCAGTGAGGGGACAAACAGT
TCTTCAGTGTATTGTCAAGAATAATAACGAAGAACTGATCATGCATCCAA
CCATTCAAAAGCTGCTCAAAATCAAACTAGATTTGTTCGGACGAACTCAC
GTTATTATGTCTAACttgttgaatatcttttacGTTTTATTGGCAACTGT
GTTCATCTTTTCGGTGCCGTATGATAGTTTTGACAAACAATTTGTACCGT
TCGAAACACATGTTTGGAAAATATGCGTTGGTGTTgtcttttgtttcttg
tctATCGTTTACATATGGCGGGAtatcaaacttttattgatactAAACAA
AGAAGACGAGGAGTACAAAAAAGACATGCTTAGGGTTTACAAGAAAATGG
AGCAGTATTGTCATCCTGCATGGAAAACAGAAAGCGAATTTGTTGATCGG
GAAAAGAAACGGCTTGAAGAAAGTCGAAAATCGTTCTTTTATGACGGATG
GCAGTGTTATGAGCTCGTTGTAACTTTCACATCGTTTGCAATCATTGTAA
TGTATTTAGTGAACGTGCTGACTCCAAACAAGACCTTATTTACTGTCTTC
AAATATTTGGCTTCTGTTAACCTATTACTTCTTTGGATGAGGTTATACAA
AACAATGCGACTTAGCAAAATCTTCTCCGAAGTTGAAATGTTATTAGTTC
ATATCTTAAAGACTGTGGCGAAGATAGGAACATTATATTTGGTATTGCTG
GTACCATATACTTTCGTTGTTTACATGCTTTTTGGTGGGTCTGGTGATGA
GGATGTCAGAATCACCAAGACAACAAAAGAATACGAAGTTGCCCAAATTa
tttatGATCTATACCATTCAGCCGTTGTTACACATCACGAAATCAATGAG
GTTGCAAACCAAATCTTCCGTGGTTTTTATTTACTCATGTTTGCAATTAT
CAATTTCGTTTTCATTGGTGTTATGACGGAGCAATTTGTGCGCACGTACA
AGAAAGCACTTGCAAAAGTCCACCTCGGAGTAGCAAATGCGTTGATCAAT
ATTGAATTAAGAAGCAGTCATGATAAAAGAAAAGGATACAGAAAATTTAT
CAGAGAGAAATGCAATCCTTACTTGGAAGAAGTATTTGGTAAAGAACGCC
ATTACAGAGAGGATCGAAATGACAAATACATCAATATCAGCGTTGGCAGT
GTATCAGAACTGTCGGAAAAACTCTCTGACTATCTCGaTGATGCCGACTT
TCTAAATCAACCACAAAGGTCTTGTGATATTGATTGTTTGCAGAGTCTTC
AGGTAGAGTTGGAACGCCTCTCGGCAGACATGAATTATGGCAAAGCAGGG
TTACAGTTGAAATCGAAAGAAGTATTGGCGAAAGCCAATAAATCGGCTGA
AATTATTAAAGCAGGTTGTGATCCACGGCATCTAGCAAAAGGAAAACATC
TATCCAAACCAAAACAATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000719XLOC_000719Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001333-exon-sc0000010-1491911889:155949..156391TCONS_00001333-exon-sc0000010-1491911889:155949..156391Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:155949..156391TCONS_00001333-exon-sc0000010-1510915933:155949..156391Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:155949..156391TCONS_00001333-exon-sc0000010-1575043694:155949..156391Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:156448..156671TCONS_00001333-exon-sc0000010-1491911889:156448..156671Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:156448..156671TCONS_00001333-exon-sc0000010-1510915933:156448..156671Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:156448..156671TCONS_00001333-exon-sc0000010-1575043694:156448..156671Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:157264..157532TCONS_00001333-exon-sc0000010-1491911889:157264..157532Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:157264..157532TCONS_00001333-exon-sc0000010-1510915933:157264..157532Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:157264..157532TCONS_00001333-exon-sc0000010-1575043694:157264..157532Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:158586..158744TCONS_00001333-exon-sc0000010-1491911889:158586..158744Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:158586..158744TCONS_00001333-exon-sc0000010-1510915933:158586..158744Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:158586..158744TCONS_00001333-exon-sc0000010-1575043694:158586..158744Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:159527..159756TCONS_00001333-exon-sc0000010-1491911889:159527..159756Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:159527..159756TCONS_00001333-exon-sc0000010-1510915933:159527..159756Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:159527..159756TCONS_00001333-exon-sc0000010-1575043694:159527..159756Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:160325..160588TCONS_00001333-exon-sc0000010-1491911889:160325..160588Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:160325..160588TCONS_00001333-exon-sc0000010-1510915933:160325..160588Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:160325..160588TCONS_00001333-exon-sc0000010-1575043694:160325..160588Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:162386..162598TCONS_00001333-exon-sc0000010-1491911889:162386..162598Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:162386..162598TCONS_00001333-exon-sc0000010-1510915933:162386..162598Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:162386..162598TCONS_00001333-exon-sc0000010-1575043694:162386..162598Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:163668..163830TCONS_00001333-exon-sc0000010-1491911889:163668..163830Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:163668..163830TCONS_00001333-exon-sc0000010-1510915933:163668..163830Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:163668..163830TCONS_00001333-exon-sc0000010-1575043694:163668..163830Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:164467..164618TCONS_00001333-exon-sc0000010-1491911889:164467..164618Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:164467..164618TCONS_00001333-exon-sc0000010-1510915933:164467..164618Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:164467..164618TCONS_00001333-exon-sc0000010-1575043694:164467..164618Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:164922..165194TCONS_00001333-exon-sc0000010-1491911889:164922..165194Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:164922..165194TCONS_00001333-exon-sc0000010-1510915933:164922..165194Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:164922..165194TCONS_00001333-exon-sc0000010-1575043694:164922..165194Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:167008..167122TCONS_00001333-exon-sc0000010-1491911889:167008..167122Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:167008..167122TCONS_00001333-exon-sc0000010-1510915933:167008..167122Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:167008..167122TCONS_00001333-exon-sc0000010-1575043694:167008..167122Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:169248..169424TCONS_00001333-exon-sc0000010-1491911889:169248..169424Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:169248..169424TCONS_00001333-exon-sc0000010-1510915933:169248..169424Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:169248..169424TCONS_00001333-exon-sc0000010-1575043694:169248..169424Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1491911889:169745..170280TCONS_00001333-exon-sc0000010-1491911889:169745..170280Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1510915933:169745..170280TCONS_00001333-exon-sc0000010-1510915933:169745..170280Clytia hemisphaericaexon
TCONS_00001333-exon-sc0000010-1575043694:169745..170280TCONS_00001333-exon-sc0000010-1575043694:169745..170280Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001333-proteinTCONS_00001333-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:155949..170280 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0353716 0.0402417 0.0333746 0.0195911 0.079501 0.0816696 0.075793 0.0638609 0.00496783 0.123069 0.0179181 0.0157049 0 0.415318 0.0267802 0.0359241 6.96583 8.27376 0.244405 0.341003 15.0591 13.5618 2.00078 3.25697 7.97711 2.14306 3.41127 2.84692 0.0130866 0.0199997
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001333 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top