Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001223 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001223
Unique NameTCONS_00001223
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2324

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001223 ID=TCONS_00001223|Name=TCONS_00001223|organism=Clytia hemisphaerica|type=transcript|length=2324bp
tttagacataaaaaataaaaaacaatatgCAGCTTAAACACTTAAAAACT
ACACTGGCTCCCCAGGATGGAGCTGCTAAGATCACAGCAATGGCATGGGC
TCCTAACAATACCAAAATGGCAATAGTATCAACTGATCGtgtagttgttc
tttttgatgAACATGGAGAAAAAAGGGACAAATTTGGAACAAAACCTGGT
GATGCTAAAACTGGGAAGAAAGGTTACCAAGTGAAAGGACTAGCATTTTC
TCCTGATTCCACCAAGATAGCTGTTGGACAAACAGATAACATTGTTTTTG
TATACAAGATTGGTGACGAATGgGGCGAAAGAAAAGTTATATGCAACAAG
TTTCTCCAACAGAGTGCTGTTACATGTTTGGTTTGGCCCCCAGAAAATCA
ATATATTATTTTTGGTCTTGCTGATGGAAAGgTCAGGATGGCAAGTctaa
aaaccaacaaatcacaAACTGTCTATGGAACTGGTATCCATTGTATATCT
TTGTGTGTCAGTCCTGATGGGAAAGGTGTTTTGTCAGGGCATGCAGATGG
AGCCATTGTCAGATATATGTTTGAAGATACTGGGACAGGTTTGACCCAGG
GGCAAGTTGTGAAACATGGCTGTCCACCGTATGCCTTGTGTTGGGGCTCA
TCAATCATTGCAGCAGGATGTGATAAAAGAATTGTTGCATATGGAAAAGA
AGGGCGGGTATTACAAAACTTCGACTATTCAAAAGATGATGAGGAAAAAG
AGTTCACAGTTGCAATAGCAAGTCCAAGTGGTCAGTCAGTGGTGGTTGGA
AGTTATGATAGATTACGTGTTTTCAATTGGAGTCCCCGAAGAGGAGCCTG
GGAAGAATCTAAACCAAAAGAGATCAATAATTTATACACCATCAGCTCAC
TTTCTTGGAAAAGAGATGGTTCAAGGCTTTGTGCTGGCACACTCTGTGGT
GGAGTTGAACTGTTTGATTGCTGTTTGAGAAGATCTATTTTCAAGAATAA
ATTTGAAATGACTTATGTTGGGTTGAGCCAGGTTATTGTCAAAAATTTGG
CATCAGGAGCCAGAGTTGTTTTAAAATCACATTATGGATACGAGATTGAT
GAAGTGAAAATAATGGGGAAGGACAGATTTCTTGTTGGACACACTTCAGA
AACATTGCTTGTGGGAGATCTAAACGAAAACAAGCTTAGTGAGCTTCCAT
GGCATAATTCAGGTGGAAATGAGAAGttcttctttgaaaatgaaacaGTT
TGTATGGTATTCAATGCAGGAGAATTATCTTTGATCGAGTATGGTCAAAA
TGAAGTGTTAGCTACAGTCAGAACAGAATTCATGAACCCTCATCTTATAA
GCGTACGTTTGAATGAAAGAAAGCTGAAAGATCAAGAAGACAATAAAAAA
TTGGGTTATTTGATTGACCTGAAAACTATATGTGTCAtgGACTTGATGTC
AGGGATGGTTGTAGCCAATATTTCACATGATgtcaaaattgactggttag
aGATGAATGAGACTGGAAAGAAGCTCTTATTCCGAGACAAAAAACTGAGG
TTATTATTGGCAGATATTCAAAGTGAAACAAAAACCACTATTTCTACATA
TTGCTCTTATGTGCAATGGGTGCCTTTGAGTGATGTTGTGGTAGCTCAAA
GCAGAAGCGATCTTTGTGTTTGGTACAATATTGAATCACCTGAACGAGTG
ACTATCGTTCCCATCAAAGGTGACATCACAGACCTTGAGAAGATCGAGGG
TAAAACAAACGTGATCGTACAAGAAGGTGTACAATCGATCAATTACACAT
TAGACGAAGGGCTAATCGAGTTTGGAACTGCTATGGAAGATGGTGATTAT
GCTAGGGCTGTTTCGTTTCTGGAAGGATTGGAGATGTCACCTGAAACAGA
AGCTATGTGGAAGACTCTCAGCAAGGTTGCCATGGAGAATAAAGAGCTTT
TCATCGCCGAAAGGTGTTTTGCTGCACTAGGAGATGTTTCTAAAGCTCGC
TATTTACGTGGAATCAACGACTTGATCGATGAACTGAACCCAAGTTATGG
AGATCCTATGTATCATCCGACTATTCGCGCCAAACTGGCCATTTTTGAGA
AACAATTCAAACTTGCAGAAAGTATTTACTTGGAACAAGGACAAGTTGAT
GAAGCGATGGAGATGTACCAAGAAGTTCACAAGTGGGATGAATCTTTGGC
CATCGCCGAAGCCAAAAGACATCCAGAACTAGAGAACCTTAGAAGCTATT
ACTTGCAATATTTGATGAAGTCAGGCCAAGAAGAAAAAGCTGGAGAGGTT
AAAACCTTGAATTTAGTTAACAGA
Run BLAST on NCBI

transcript from alignment at sc0000007:1136849..1147615-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001223 ID=TCONS_00001223|Name=TCONS_00001223|organism=Clytia hemisphaerica|type=transcript|length=10767bp|location=Sequence derived from alignment at sc0000007:1136849..1147615- (Clytia hemisphaerica)
TTTAGACATAAAAAATAAAAAACAATATGCAGCTTAAACACTTAAAAACT ACACTGGCTCCCCAGGTATGAAAACTTTCTTTTTTACAGTGTTGTAACTT TTCTCTTCATATAAAAAACTATTTAGGAATGAAATATTAAAGAACTCAAA ATATAACCATTGCTGAACTTTATCTTTTTCATTTCACCCAGAGGCAAGAC TGTTTAATCCTTTCTAGTATGATTTATTGTTATACCTTTAAATTGTAATT TTTATGAAGGATGGAGCTGCTAAGATCACAGCAATGGCATGGGCTCCTAA CAATACCAAAATGGCAATAGTATCAACTGATCGTGTAGTTGTTCTTTTTG ATGAACATGGAGAAAAAAGGGACAAATTTGGAACAAAACCTGGTGATGCT AAAGTAAGCTCTATCTAAGTCAAAAAATCCCTTTGTGATAGAACAAATAA AAGTTATCACATGATATCGATTACAATATGGGATGTATTATATTAAGTTA AACTTTTTCCTCATATTTTTGAGCCCGTATGCCAGGAAACTATCAAAAAC TTTGAACAAGAAAAATATATCCAATATTGTGCGAGTAAGTTTGATAATTG GTTTAGCATTAACTTGAAAAATACGACCAAACTTTTCTCTCTCCATTTGT GTCTTTTTCTATGTTTTTTTTTCTCTTCATGCATTTTGTTCTTCCTCTAT TTTGATGAAATTAACACCAAAACATTTATAAAAAATCCAAAGGTCATTAA AATGTTAAAAACATTCTTTTGTATAACTCTTCGGATGATTTGCTGCTCTA TCAGCCAATCAGATTGCTCATATTTTTCATGTTGATGAAAAGATTAAATT ATTTTAGTAGTCACATAAGCATAAGCCTTGGATGAAATAATGAATCTTCT TCATTTATTGATTTCAAATCTTTCTTACTATCCACACCAAAGTTACCTTT CTAAATGATTGTTCTTTTAGACTGGGAAGAAAGGTTACCAAGTGAAAGGA CTAGCATTTTCTCCTGATTCCACCAAGATAGCTGTTGGACAAACAGATAA CATTGTTTTTGTATACAAGATTGGTGACGAATGGTAAGACTAAGAACATT GATCTTTCTAAAAACTGAAACATCTACAGTCAGATATTATTTACTTATAT TTGAAGATCGAACATAATATGAAAATGTTATTTATATATATTAATTAATT TTTGATTTTATTTTAGGGGCGAAAGAAAAGTTATATGCAACAAGTTTCTC CAACAGGTAAAGTATCTTTTTAAATTGATTATTATTTCATCACAAGAGAA ATTTTTTTAACATTTGATACCATAGTATTGTATTATCCTATACTGTGTTA AATGAATGATTTTACTTTACACATCTGCTATAATAATATAATTTAATGAG GATCAATTTTTACATTAGAGTGCTGTTACATGTTTGGTTTGGCCCCCAGA AAATCAATATATTATTTTTGGTCTTGCTGATGGAAAGGTTTGTGACTTTT GACATTTTGACTTTTATGATGGATGATATCTCTTTTGGGATTCAAATTTT ATAAATTGATAAAGTAAAATAGTTGTCTGTTTGACCATACCTCCTAAATC TATAGGGCTGACAAAATGAATGGCAAAAAAAGTGTTTTTAAAACCAGCCT AATGTCACCCCATAAGTGACCATTTCTTAGCTGAACAGTTAATTTATTTT TTTGAAAACAAATAATTAATTTTACTATACTCATGAATTTTAAAAATCAA AAGGTGATCCTAAAAGTCTCAGCTTTCAAAGATGGTTACATTTAAGAGAT GGTATTGGTAGGAAAGGGAGATCTACTTTTTAACCTGGAAATATATATTG ACGATATAAAGCATACAAACACCTAAAATTTTAGATCACACTTCAAATGA TTGAGTTTGAGAATGATTATTTTCTTCATCTTTCTGTAATGTTTTAAAAT TTCCATTTTTTTTTAGGTCAGGATGGCAAGTCTAAAAACCAACAAATCAC AAACTGTCTATGGAACTGGTATCCATTGTATATCTTTGTGTGTCAGGTTG GCATTCTGTTTTAATTACATAAATGATTTTCAAACTATAAAATGAAAGCA ATATTACTATTATGTTAAGTCTTTGAAGCTTGTAAATGAAGACATAATTG AGTACAGCTTTCAAGAAACTACTTTAACAATTCATATTTAAGCATTTTCA CAACAGATAATAAACTAAAAATTTTTTTGAAAAAGTTTCATTTAATATAA ACATTTTCTTGACTGGACAAATCCAATAACTGTTTCAGGTTAAATTATCT TTGCCATCTGTTCTCTTTTTAGTCCTGATGGGAAAGGTGTTTTGTCAGGG CATGCAGATGGAGCCATTGTCAGATATATGTTTGAAGATACTGGGACAGG TTTGACCCAGGTATTTTACATATTAAATGTTAAAACATTTAAAGTAGACA AACTAAACTAATATTAGGTATATTTCTTTTTGAGAAGTCCGACTGTTACT AGAAGAGTCAATTGCACTTCAGACAAACAATCATTCCAAAGAATAATTTG CAAATTTCTTTTTTTTTGAAGTGCATTACACAAAGAATAATACAAAGAAT TATATGCTATCCTAATATTCAAATCTCAAGATTGGTTCGATTTTTTCCAT AGGGGCAAGTTGTGAAACATGGCTGTCCACCGTATGCCTTGTGTTGGGGC NTACAAGAGAAAATTTTTTAACATTTGATACCACAGTATTGTATTATCCT ATACTGTGTTAAATGAATGATTTTACTTTACACATCTGCTATAATAATAT AATTTAATGAGAATCAATTTTTACATTAGAGTGCTGTTACATGTTTGGTT TGGCCCCCAGAAAATCAATATATTATTTTTGGTCTTGCTGATGGAAAGGT TTGTGACTTATGACATTTTGACTTTTATTATATCATGATATAATGATGGA TGATATCTCTTTTAGGATTCAAATTTTATAAATTGATGAAGTAAAATAGT TGTCTGTTTGACCATACCTCCTAAATCTATAGGGCTGACAAAATGAATTG CAAAAAAAGTGTTTTTAAAACCAGCCTAATGTCACCCCATAAGTGGCCAT TTCTTAGCTGAACAGTTAATTTATTTTTTTGAAAACATATAATTAATTTT ACTATACTCGTGAATTTTAAATATCAAAAGGTGGTCCTAAAAGTCTCAGC TTTCAAGATGGTTACATTTAAGAGATGGTATTGTTAGGAAAGGGAGATCT ACTTTTTAACCTGGAAATATATATTGACGATATAAAGCATACAAACACCT AAAATTTTAGATCACACTTCAAATGATTGAGTTTGAGAATGATTATTTTC TTCATCTTTCTGTAATGTTTTAAAATTTCCATTTTTTTTTAGGTCAGGAT GGCAAGTCTAAAAACCAACAAATCACAAACTGTCTATGGAACTGGTATCC ATTGTATATCTTTGTGTGTCAGGTTGGCATTCTGTTTTAATTACATAAAT GATTTTCAAACTATAAAATGAAAGCAATATTACTATTATGTTAAGTCTTT GAAGCTTGTAAATGAAGACATAATTGAGTACAGCTTTCAAGAAACTACTT TAACAATTCATATTTAAGCATTTTCACAACAGATAATAAACTAAAAATTT TTTTGAAAAAGTTTCATTTAATATAAACATTTTCTTGACTGGACAAATCC AATAACTGTTTCAGGTTAAATTATCTTTGCCATCTGTTCTCTTTTTAGTC CTGATGGGAAAGGTGTTTTGTCAGGGCATGCAGATGGAGCCATTGTCAGA TATATGTTTGAAGATACTGGGACAGGTTTGACCCAGGTATTTTACATATT AAATGTTAAAACATTTAAAGTAGACAAACTAAACTAATATTAGGTATATT TCTTTTTGAGAAGTCCGACTGTTACTAGAAGAGTCAATTGCACTTCAGAC AAACAATCATTCCAAAGAATAATTTGCAAATTTCTTTTTTTTTGAAGTGC ATTACACAAAGAATAATACAAAGAATTATATGCTATCCTAATATTCAAAT CTCAAGATTGGTTCGATTTTTTCCATAGGGGCAAGTTGTGAAACATGGCT GTCCACCGTATGCCTTGTGTTGGGGCTCATCAATCATTGCAGCAGGATGT GATAAAAGAATTGTTGCATATGGAAAAGAAGGTATTGTTTTTTGAGCTTA TGTTTCACGAGAAAATCATTTTTATTTAACAAATGATTAATCCTAATATT TCATTTCCCTAAACTCTCTTTAGGGCGGGTATTACAAAACTTCGACTATT CAAAAGATGATGAGGAAAAAGAGTTCACAGTTGCAATAGCAAGTCCAAGT GGTCAGTCAGTGGTGGTTGGAAGTTATGATAGATTACGTGTTTTCAATTG GAGTCCCCGAAGAGGAGCCTGGGAAGAATCTAAACCAAAAGAGATCAATA ATTTATACACCATCAGCTCACTTTCTTGGAAAAGAGATGGTTCAAGGCTT TGTGCTGTAAGTTAGATAATTCCCTCTTATTTTTTGTCCTGCTGGAATAT AGGTTTTAATACATAAAGACAGTTTGACTTACATATGGATGAAAAGTTTC AATTAGTATTCTACATGCAAATATAAAGAATTTTTTTAAATGGTATTTAC AAATATATCATAATACAGTAGCTAAATCTTACTGAATAATATTATTTCTG ACTTCAGGGCACACTCTGTGGTGGAGTTGAACTGTTTGATTGCTGTTTGA GAAGATCTATTTTCAAGAATAAATTTGAAATGACTTATGTTGGGTTGAGC CAGGTAAAATGAAGGATTTTTTGTTATACTTTTGAAGATATTAACCCTTC AACCCTTTCAGACCCGGTACACACGATTTAAATCTGCCAAAATACCAAGT CCTGACCACTTGATTTAAAAGGGCATACACCGGATGCTGTTAGAAAGAGT ACAAAAATATCTTTTCAATGGTACAAAAACCATTGCCTAAGTCTCAAGTT AAAACCTTTTATGCCAATTTGAAAATTTGGAAAAAATGTTGCGCGCTGGA AAGGTTAAGAAAAAATTAAATAAGAATCTGTATTTTGTAAAAAATATCTA AAAAATTGTCCAGAGGAAAACCAATTTTCTCTGTCTGTGCGAGAGTGTGG AACATATAACATAGTTGAAAATAACACATCATCTTTCTTATGAAAATTTC TGCCAACTGGCCTTTTTCAACATAAAAATGAATTTAATGTTCTTCATTCG CCGCTGTGAGGAGACATTCTTAATGTTAGCAAAGGAAAGCTTACGTTCTG CTCTCTAAAGAGCAAATCATCTCGTTTCGGTTCTCTAGCCTTCAGAATTT CTCGACTGACTAGTTGGTCACTATCCTTGTTTTTTTTTAGCCACAGTGCT AGCTGGTTGCAATTGAGGTCAAAAAAAGAAATGTTCTGAACAGATGCGAT TCAAGCGCAGGCCCTGGCCATAAGGAATGGCCTTTTTTGAATGAAATGCA CAATTATAAAAAAATATTTAGTTATTTTCACTAACATTACAAATACAAAG AAACTTTGTTATTATTAATGCTAACTGTTGATTTCTAGGTTATTGTCAAA AATTTGGCATCAGGAGCCAGAGTTGTTTTAAAATCACATTATGGATACGA GGTTTGTATATAAATAATTTTTATAAGTAGAAAATCTATCATCAATATTT CTGCCTAATCAACTTTTTCTCAAGAATCTGTAATATCATATTTTAAAGTT ATATTTCTTGGCCCATTATTATCCCTTGCTGATGTTTTTAGATTGATGAA GTGAAAATAATGGGGAAGGACNTTGTCCACCGTATGCCTTGTGTTGGGGC TCATCAATCATTGCAGCAGGATGTGATAAAAGAATTGTTGCATATGGAAA AGAAGGTTTTGTTTTTTGAGCTTATGTTTCACGAGAAAATCATTTTTATT TAACAAATGATTAATCCTAATATTTCATTTCCCTAAACTCTCTTTAGGGC GGGTATTACAAAACTTCGACTATTCAAAAGATGATGAGGAAAAAGAGTTC ACAGTTGCAATAGCAAGTCCAAGTGGTCAGTCAGTGGTGGTTGGAAGTTA TGATAGATTACGTGTTTTCAATTGGAGTCCCCGAAGAGGAGCCTGGGAAG AATCTAAACCAAAAGAGATCAATAATTTATACACCATCAGCTCACTTTCT TGGAAAAGAGATGGTTCAAGGCTTTGTGCTGTAAGTTAGATAATTCCCTC TTATTTTTTGTCCTGCTGGAATATAGGTTTTAATACATAAAGACAGTTTG ACTTACATATGGATGAAAAGTTTCAATTACTATTCTACATGCAAATATAA AGAATTTTTTTAAATGGTATTTACAAATATATCATAATACAGTAGCTACA TCTTACTGAATAATATTATTTCTGACTTCAGGGCACACTCTGTGGTGGAG TTGAACTGTTTGATTGCTGTTTGAGAAGATCTATTTTCAAGAATAAATTT GAAATGACTTATGTTGGGTTGAGCCAGGTAAAATGAAGGATTTTTTGTTA TACTTTTGAAGATATTAACCCTTCAACCCTTTCAGACCCGGTACACACGA TTTAAATCTGCCAAAATACCAAGTCCTGACCACTTGATTTAAAAGGGCAT ACACCGGATGCTGTTAGAAAGAGTACAAAAATATCTTTTCAATGGTACAA AAACCATTGCCTAACTCTCAAGTTAAAACCTTTTATGCCAATTTGAAAAT TTGGAAAAAATGTTGCGCGCTGGAAAGGTTAAGAAAAAATTAAATAAGAA TCTGTATTTTGTAAAAAATATCTAAAAAATTGTCCAGAGGAAAACCAATT TTCTCTGTCTGTGCGAGAGTGTGGAACATATAACATAGTTGAAAATAACA CATCATCTTTCTTATGAAAATTTCTGCCAACTGGCCTTTTTCAACATAAA AATGAATTTAATGTTCTTCATTCGCCGCTGTGAGGAGACATTCTTAATGT TAGCAAAGGAAAGCTTACGTTCTGCTCTCTAAAGAGCAAATCATCTCGTT TCGGTTCTCTAGCCTTCAGAATTTCTCGACTGACTAGTTGGTCACTATCC TTGTTTTTTTTTAGCCACAGTGCTAGCTGGTTGCAATTGAGGTCAAAAAA AGAAATGTTCTGAACAGATGCGATTCAAGCGCAGGCCCTGGCCATAAGGA ATGGCCTTTTTTGAATGAAATGCACAATTATAAAAAAATATTTAGTTATT TTCACTAACATTACAAATACAAAGAAACTTTGTTATTATTAATGCTAACT GTTGATTTCTAGGTTATTGTCAAAAATTTGGCATCAGGAGCCAGAGTTGT TTTAAAATCACATTATGGATACGAGGTTTGTATATAAATAATTTTTATAA GTAGAAAATCTATCATCAATATTTCTGCCTAATCAACTTTTTCTCAAGAA TCTGTAATATCATATTTTAAAGTTATATTTCTTGGCCCATTATTATCCCT TGCTGATGTTTTTAGATTGATGAAGTGAAAATAATGGGGAAGGACAGATT TCTTGTTGGACACACTTCAGAAACATTGCTTGTGGGAGATCTAAACGAAA ACAAGCTTAGTGAGGTAAGTTCCTTCCTCAAGAACTATTTTTGAAATTAA TATCATAAGATCTTTCAAGTGACATTATGGAACATAAAAAATAACAGAAC TTGATTTTGATAATTATACTGTTTTGTTTTTATGATTCAGCTTCCATGGC ATAATTCAGGTGGAAATGAGAAGTTCTTCTTTGAAAATGAAACAGTAAGT TTGTTTAAAATTCAATACATTTTTCTTTTGGAAAAAGTAAAACAAAGAAA GTAGATTACTTCAAAACAATTTTAAATCTTTCAAAGGTTCCTTAGCTTGC CACTGCTAAAATCATACCTTGTTAGCATTACGAGTTTCAGGACTTCTATG TGTTACTTTGTTATTGTTTTAATCAATTAGGTTTGTATGGTATTCAATGC AGGAGAATTATCTTTGATCGAGTATGGTCAAAATGAAGTGTTAGCTACAG TCAGAACAGAATTCATGAACCCTCATCTTATAAGGTAATGATTTTTCAAA TGCAGATATGAAACGATTGTGAAATGTATTCTAGGGTTATGATATTTAGA ATTTGATTTTTGAATAGTCTATTCCATTAAACAAATTTCTTTAGATATTT CAGAATAATTTACCCTGCTGCCTCACATTCCTGCCTTGGTATTTTTACCG GAAAGAATTGAAACTCCATTCTTTCTTACCAGCCATCCCTCTGTAAGAAC TAGACTGGACGCTAGTCAGTATGATTCTCAATAGCAGTATTTCTTGACTT AACTTTTTCAGCGTACGTTTGAATGAAAGAAAGCTGAAAGATCAAGAAGA CAATAAAAAATTGGGTTATTTGATTGACCTGAAAACTATATGTGTCAGTA AGTAAACGTTTTGTAAAAAATCGACTATTTTGGCATTATTAGCAGCATTT CTCATTTCTATCGGGTGAATACAGATTTGAAATATTTGGGCTATTATGCT AAGCTCAGTTGTAAATTAGCCTTAGGATTTTAGTTTTTTTTTACTTTAAA TTTCTTTAATTTTCAGTGGACTTGATGTCAGGGATGGTTGTAGCCAATAT TTCACATGATGTCAAAATTGACTGGTTAGAGGTACTCCACTCTCATCTCT TATTGTCTCTAAGTTATGAATTTCCAAGATAATATATTTATATTTAGATG CAAATCTCAAGAGTTTGAGTGGTTGACAAATCTTGAATTTTCTCTGTTTA TAGATGAATGAGACTGGAAAGAAGCTCTTATTCCGAGACAAAAAACTGAG GGTAAGTAATTTAGATAATTTCCGATACTCTTCCTCAAATTAGGACAGTT GTTTTAAAGTGTGAAGTGATTTCTGGTTTCAACTTCTAATTATAGTACAC TTACCTCTCAACTTTTAGTTATTATTGGCAGATATTCAAAGTGAAACAAA AACCACTATTTCTACATATTGCTCTTATGTGCAATGGGTGCCTTTGAGTG ATGTTGTGGTAGCTCAAAGCAGAAGCGATCTTTGTGTTTGGTACAATATT GAATCACCTGAACGAGTGACTATCGTTCCCATCAAAGTAAGAGACCATTT TGTTCATTTCCTCTCAAAGGCTTAACGGCGATCAAAAATAAACTATTTAA AAACTATTTTTTATGTCTTTTGATTCTTTCTAATGACTTGTAATAATGAC TTGTAATTTGAGGGGTCGTTTGTTAAATTTGGTCAACTAGGTAAAAAGCT ATGGCCTAAATGCTAAAATATTACTTTTCAAAAAAGTAAAAAAAATGGCG AAAAATGAGGGTATTAAATCATCATAAAGATATCATAAAGAAATCTTTCT TTTATCAATTTATTAACGATCGAAGTCTCTTCGTCCTCTTCGTGGCCAGT TTCCAAGAAAGGTGGTCAACAATCGAGGAGATGTTGAGTGACCCCTAAGT TCGCCTGAGCTTACAGTGTGTGATTTCTTTTTGTGGGGTTACACGAAACA AGAAATCTGGGAGCAACTCACAAATTTGCAATTCCAGACCCTTGATCAAT GAAAGCTTCAATCAAATATGAAGACTTGGCAAATCGATTTTATATTATTT TCTCATGATAAAAAATTACATTAATTGACTTTGTGACCCTTGTTTTACAC GGTTTAGCCTACGATCGAGGCACCCTTATTCTGGATTTGTTATTCGAATT TCAAATCAAAGTTGAAAAGACACTGGTTTGGAATGTTAAGTTAAACTTTC CTTGCATGTTTAGGGTGACATCACAGACCTTGAGAAGATCGAGGGTAAAA CAAACGTGATCGTACAAGAAGGTGTACAATCGATCAATTACACATTAGAC GAAGGGCTAATCGAGTTTGGAACTGCTATGGAAGATGGTGATTATGCTAG GTTTGTCTTATTGGTTATTTTAATTAGATTTTAAGACATTGATCTTCTAA TGCTGCAGCAAATTTTTTAACATAAACAAACTTATTAAGATAAGGGTTAT TTTTTATTGAGATTTTCTTCTCAAAATGCTTCAACTGAGAGATTTTACCT GTCGTCTTTTCTTCGTTGTATTACTTTTTTTTGCTCAGAAATCTGATATA AAATTGTATTTTGTTCAGGGCTGTTTCGTTTCTGGAAGGATTGGAGATGT CACCTGAAACAGAAGCTATGTGGAAGACTCTCAGCAAGGTTGCCATGGAG AATAAAGAGCTTTTCATCGCCGAAAGGTAAGACATAAATATGATCCAACA ATCATGATTCAATGCATAGTCCGAAACATTTTTTCTACAAAGGCTCTTTT AAGAGGATTCTGTAATGGGGTTCTTAAACTTTTCAAAATATATTTTTGCT TTGTAGGTGTTTTGCTGCACTAGGAGATGTTTCTAAAGCTCGCTATTTAC GTGGAATCAACGACTTGATCGATGAACTGAACCCAAGTTATGGAGATCCT ATGTATCATCCGACTATTCGCGCCAAACTGGCCATTTTTGAGAAACAATT CAAACTTGCAGAAAGTATTTACTTGGAACAAGGACAAGTTGATGAAGCGA TGGAGATGTACCAAGAAGTTCACAAGTGGGATGAATCTTTGGCCATCGCC GAAGCCAAAAGACATCCAGAACTAGAGAACCTTAGAAGCTATTACTTGCA ATATTTGATGAAGTCAGGCCAAGAAGAAAAAGCTGGAGAGGTTAAAACCT TGAATTTAGTTAACAGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000661XLOC_000661Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001223-exon-sc0000007-1575043694:1147551..1147615TCONS_00001223-exon-sc0000007-1575043694:1147551..1147615Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1147213..1147356TCONS_00001223-exon-sc0000007-1575043694:1147213..1147356Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1146533..1146645TCONS_00001223-exon-sc0000007-1575043694:1146533..1146645Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1146360..1146399TCONS_00001223-exon-sc0000007-1575043694:1146360..1146399Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1144718..1144786TCONS_00001223-exon-sc0000007-1575043694:1144718..1144786Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1144144..1144223TCONS_00001223-exon-sc0000007-1575043694:1144144..1144223Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1143780..1143867TCONS_00001223-exon-sc0000007-1575043694:1143780..1143867Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1143435..1143537TCONS_00001223-exon-sc0000007-1575043694:1143435..1143537Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1143110..1143342TCONS_00001223-exon-sc0000007-1575043694:1143110..1143342Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1141089..1141184TCONS_00001223-exon-sc0000007-1575043694:1141089..1141184Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1140241..1140303TCONS_00001223-exon-sc0000007-1575043694:1140241..1140303Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1140002..1140100TCONS_00001223-exon-sc0000007-1575043694:1140002..1140100Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1139822..1139875TCONS_00001223-exon-sc0000007-1575043694:1139822..1139875Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1139532..1139635TCONS_00001223-exon-sc0000007-1575043694:1139532..1139635Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1139169..1139254TCONS_00001223-exon-sc0000007-1575043694:1139169..1139254Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1138935..1138999TCONS_00001223-exon-sc0000007-1575043694:1138935..1138999Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1138765..1138812TCONS_00001223-exon-sc0000007-1575043694:1138765..1138812Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1138480..1138647TCONS_00001223-exon-sc0000007-1575043694:1138480..1138647Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1137666..1137802TCONS_00001223-exon-sc0000007-1575043694:1137666..1137802Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1137340..1137447TCONS_00001223-exon-sc0000007-1575043694:1137340..1137447Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1575043694:1136849..1137209TCONS_00001223-exon-sc0000007-1575043694:1136849..1137209Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1147551..1147615TCONS_00001223-exon-sc0000007-1510915933:1147551..1147615Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1147213..1147356TCONS_00001223-exon-sc0000007-1510915933:1147213..1147356Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1146533..1146645TCONS_00001223-exon-sc0000007-1510915933:1146533..1146645Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1146360..1146399TCONS_00001223-exon-sc0000007-1510915933:1146360..1146399Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1144718..1144786TCONS_00001223-exon-sc0000007-1510915933:1144718..1144786Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1144144..1144223TCONS_00001223-exon-sc0000007-1510915933:1144144..1144223Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1143780..1143867TCONS_00001223-exon-sc0000007-1510915933:1143780..1143867Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1143435..1143537TCONS_00001223-exon-sc0000007-1510915933:1143435..1143537Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1143110..1143342TCONS_00001223-exon-sc0000007-1510915933:1143110..1143342Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1141089..1141184TCONS_00001223-exon-sc0000007-1510915933:1141089..1141184Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1140241..1140303TCONS_00001223-exon-sc0000007-1510915933:1140241..1140303Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1140002..1140100TCONS_00001223-exon-sc0000007-1510915933:1140002..1140100Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1139822..1139875TCONS_00001223-exon-sc0000007-1510915933:1139822..1139875Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1139532..1139635TCONS_00001223-exon-sc0000007-1510915933:1139532..1139635Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1139169..1139254TCONS_00001223-exon-sc0000007-1510915933:1139169..1139254Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1138935..1138999TCONS_00001223-exon-sc0000007-1510915933:1138935..1138999Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1138765..1138812TCONS_00001223-exon-sc0000007-1510915933:1138765..1138812Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1138480..1138647TCONS_00001223-exon-sc0000007-1510915933:1138480..1138647Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1137666..1137802TCONS_00001223-exon-sc0000007-1510915933:1137666..1137802Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1137340..1137447TCONS_00001223-exon-sc0000007-1510915933:1137340..1137447Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1510915933:1136849..1137209TCONS_00001223-exon-sc0000007-1510915933:1136849..1137209Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1147551..1147615TCONS_00001223-exon-sc0000007-1491911889:1147551..1147615Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1147213..1147356TCONS_00001223-exon-sc0000007-1491911889:1147213..1147356Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1146533..1146645TCONS_00001223-exon-sc0000007-1491911889:1146533..1146645Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1146360..1146399TCONS_00001223-exon-sc0000007-1491911889:1146360..1146399Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1144718..1144786TCONS_00001223-exon-sc0000007-1491911889:1144718..1144786Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1144144..1144223TCONS_00001223-exon-sc0000007-1491911889:1144144..1144223Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1143780..1143867TCONS_00001223-exon-sc0000007-1491911889:1143780..1143867Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1143435..1143537TCONS_00001223-exon-sc0000007-1491911889:1143435..1143537Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1143110..1143342TCONS_00001223-exon-sc0000007-1491911889:1143110..1143342Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1141089..1141184TCONS_00001223-exon-sc0000007-1491911889:1141089..1141184Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1140241..1140303TCONS_00001223-exon-sc0000007-1491911889:1140241..1140303Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1140002..1140100TCONS_00001223-exon-sc0000007-1491911889:1140002..1140100Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1139822..1139875TCONS_00001223-exon-sc0000007-1491911889:1139822..1139875Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1139532..1139635TCONS_00001223-exon-sc0000007-1491911889:1139532..1139635Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1139169..1139254TCONS_00001223-exon-sc0000007-1491911889:1139169..1139254Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1138935..1138999TCONS_00001223-exon-sc0000007-1491911889:1138935..1138999Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1138765..1138812TCONS_00001223-exon-sc0000007-1491911889:1138765..1138812Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1138480..1138647TCONS_00001223-exon-sc0000007-1491911889:1138480..1138647Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1137666..1137802TCONS_00001223-exon-sc0000007-1491911889:1137666..1137802Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1137340..1137447TCONS_00001223-exon-sc0000007-1491911889:1137340..1137447Clytia hemisphaericaexon
TCONS_00001223-exon-sc0000007-1491911889:1136849..1137209TCONS_00001223-exon-sc0000007-1491911889:1136849..1137209Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1136849..1147615 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.02179 1.93256 3.66763 3.63303 3.74309e-06 1.40769e-09 0.00945346 8.38615e-06 5.37662 3.58478 1.78191 2.39124 0.656395 0.482343 0.7714 0.930406 0.135783 0.921728 0.790942 1.15037 1.30055 0.753194 0.514583 0.628553 1.5716e-08 1.35946e-06 1.38988 1.61361 0.666413 0.0257603
Blast
BLAST of TCONS_00001223 vs. Swiss-Prot (Human)
Match: IF172 (Intraflagellar transport protein 172 homolog OS=Homo sapiens GN=IFT172 PE=1 SV=2)

HSP 1 Score: 1090.49 bits (2819), Expect = 0.000e+0
Identity = 510/761 (67.02%), Postives = 636/761 (83.57%), Query Frame = 3
Query:   27 MQLKHLKTTLAPQDGAAKITAMAWAPNNTKMAIVSTDRVVVLFDEHGEKRDKFGTKPGDAKTGKKGYQVKGLAFSPDSTKIAVGQTDNIVFVYKIGDEWGERKVICNKFLQQSAVTCLVWPPENQYIIFGLADGKVRMASLKTNKSQTVYGTGIHCISLCVSPDGKGVLSGHADGAIVRYMFEDTGTGLTQGQVVKHGCPPYALCWGS-SIIAAGCDKRIVAYGKEGRVLQNFDYSKDDEEKEFTVAIASPSGQSVVVGSYDRLRVFNWSPRRGAWEESKPKEINNLYTISSLSWKRDGSRLCAGTLCGGVELFDCCLRRSIFKNKFEMTYVGLSQVIVKNLASGARVVLKSHYGYEIDEVKIMGKDRFLVGHTSETLLVGDLNENKLSELPWHNSGGNEKFFFENETVCMVFNAGELSLIEYGQNEVLATVRTEFMNPHLISVRLNERKLKDQEDNKKLGYLIDLKTICVMDLMSGMVVANISHDVKIDWLEMNETGXXXXXXXXXXXXXXADIQSETKTTISTYCSYVQWVPLSDVVVAQSRSDLCVWYNIESPERVTIVPIKGDITDLEKIEGKTNVIVQEGVQSINYTLDEGLIEFGTAMEDGDYARAVSFLEGLEMSPETEAMWKTLSKVAMENKELFIAERCFAALGDVSKARYLRGINDLIDELNPSY-GDPMYHPTIRAKLAIFEKQFKLAESIYLEQGQVDEAMEMYQEVHKWDESLAIAEAKRHPELENLRSYYLQYLMKSGQEEKAGEVK 2303
            M LKHL+T L+PQDGAAK+T MAW+ NN K A+ + DRVV+L+DEHGE+RDKF TKP D K G+K Y VKG+AFSPDSTKIA+GQTDNI++VYKIG++WG++KVICNKF+Q SAVTCL WP E   I+FGLA+GKVR+A+ KTNKS T+YGT  + +SL  +  GKG+LSGHADG IVRY F+D G+G +QG++V H CPPYAL W + SI+AAGCD++IVAYGKEG +LQ FDYS+D +E+EFT A++SP GQSVV+GSYDRLRVFNW PRR  WEE+KPKEI NLYTI++L+WKRDGSRLC GTLCGGVE FDCCLRRSI+KNKFE+TYVG SQVIVKNL+SG RVVLKSHYGYE++EVKI+GK+R+LV HTSETLL+GDLN N+LSE+ W  SGGNEK+FFENE VCM+FNAGEL+L+EYG N+ L +VRTEFMNPHLISVR+NER  +  EDNKKL YLID+KTI ++DL+ G  +  +SH+ ++DWLE+NETG KLLFRD+KLRL L DI+S +KT I  +CSY+QWVP SDV+VAQ+R+ LCVWYNIE+PERVT+  I+GD+  LE+  GKT V+V EGV ++ YTLDEGLIEFGTA++DG+Y RA +FLE LEM+PETEAMWKTLSK+A+E ++L IAERCF+ALG V+KAR+L   N++ D+++  Y G+      +RA+LA+ EK +KLAE I+LEQ  V+EAM MYQE+H+WDE +A+AEAK HP LE LR  Y Q+LM + QEE+AGE++
Sbjct:    1 MHLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAE-YIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQEREFTTAVSSPGGQSVVLGSYDRLRVFNWIPRRSIWEEAKPKEITNLYTITALAWKRDGSRLCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIGTVSHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYMQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMFTIRGDVIGLERGGGKTEVMVMEGVTTVAYTLDEGLIEFGTAIDDGNYIRATAFLETLEMTPETEAMWKTLSKLALEARQLHIAERCFSALGQVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMGMYQELHRWDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQ 760          
The following BLAST results are available for this feature:
BLAST of TCONS_00001223 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
IF1720.000e+067.02Intraflagellar transport protein 172 homolog OS=Ho... [more]
back to top