Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001217 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001217
Unique NameTCONS_00001217
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3642

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001217 ID=TCONS_00001217|Name=TCONS_00001217|organism=Clytia hemisphaerica|type=transcript|length=3642bp
tcaatggaagaaagtggaagtgctaaaatagcaattctcgcccgaacttt
aaattctgaaaaacgttaaaatacactaaaatctcaatatatttcgaagg
TGATTGTAGGTTTAAAATTATTAACTTCTTACCTTTGATTGTAGAGTCTT
GCCAATGACCAAGGTCTTCTGGAACGAATAGCTGCTGCTCTACTGAAAGG
ATCCTTTtatgaaaagGCTGGCGAACTGTTCCAAAGAGTCGGTTCCGACC
AGCGTGCACTAGATGCGTATCGTAAAGGGAAAGCATATCGACGAGCGGTG
GAGTTAGCACGCTCCTCCTTCCCACGAGAAGTTGTCAAACTTGAAGAAGA
ATGGGGAAACCATTTAGTGCTCCATAAACAATTGGACGCTGCTATCAACC
ATTTCATTGAAGCTGGTTCTTCACAAAAAGCCATCGACGCTGCCATCCAA
GCACGACAATGGAACAAAGCTGTTCAAATCGTCGAGTTGCAAGATGAAGA
TGTTGTTGAAAAATATTACAAAATCTTGGCAGAACATTATGCTCAAGTTG
GTGAATACCAGATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACGT
ACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTACAA
GCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATACATTG
CACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAG
TTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACG
AGCAAAGATGTACGACCAAATGATTAAACTGGTGAAAGAATACCACGGAG
ACTTGATCACAGATACTCATCTACACCTTGCTAAGGAATTGGAATCAGAA
GGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAA
AGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGCGTACA
GGATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTAT
TTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAA
ACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGACACAACATCGT
TCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATG
GAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAA
TGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTC
TTATGTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAG
AGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTT
GTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAG
CACAACGTCCAGAATTAGCCATCAAATTTTACAAGgaGTGTCAACGCTGG
CCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGTTGGCAGC
CTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAAG
GTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAG
TATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATGGCAGG
GAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCA
TCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAA
CGCTTATTGGAAATGCAAGCTTACGAAACTGCATCAGATTTGTATCAAGC
AGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTAT
GGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAGTACGAAGAA
CACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGA
CGAGGTCTCTTCACTTCATATCTTTTAACATGTTATGCAATTGTCACCAT
CTGTTACATCATAATATTCAATATCATGGTTGCCAGAAAAACGATTTCAT
CAAAGACCAAATATAATTTGAtatcgtgaaaaaaaaattccaaaagatAG
CACATTATTGATATGTTTTGCGTATGACTTCTCTTGCCtcccttttttaa
aatttcttttccccTCTTTTTTTCTGTAGCTGATCAACGTGGATGTGATC
GCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCA
AGAAGCTGAGCAACAGagTTTCGAAGTTTTATCAAAGTATGTGGCTTTGT
ATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTG
TTCGTCGAACATGGCGCACCTGCCAATCCACAGAATTTCAACATCTACAA
ACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATG
CATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGTGTGAT
GGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAG
GATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAA
ACAGCCAATTGgaggTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGA
TATTGTGATCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCA
CTGCAAGGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGAT
ATCTGGACTTGAGTGAGGGCATCGAAGATGGTAACCTTGATGCGATTGAC
AACACAGATATCATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTGA
AACACAATATCTCAATGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGT
TGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAA
CGAAATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTG
TTTGCCATGCGTTGTCACAGGTTATCCCGTTCTTCGAAATAAAATGGAAT
TCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCC
ATGGCAACCAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTT
TCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGT
AACGTCTAAATAACAACAACATGAGCTGGGCTCAATTCTCAAAACAATAT
GTTCACAACATGTAGATCAATCAACATGTAGATCAGATTCTAGTGACTTG
TAGAAAATTGTAGAGATTCTTTTCACGGTGCAAATATGATATTAATTTAT
TGGGTACATTTATAAATATTGTTTACTGTAATATAATTCTATGTTTGTCg
tcaaatttttaactttttcccTTCAGTTCATTTTGTATATACTTGAATAA
TGATAAAACTGGAAAATAAATGTCGTTAGTGGTAATACAGTATTCGAAAT
TATCTTGttgcttctttttattcttataaatttgatttttttaatttttg
gacctaccacagtggggtagaggtcctataaattaacctttg
Run BLAST on NCBI

transcript from alignment at sc0000007:1119867..1136639-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001217 ID=TCONS_00001217|Name=TCONS_00001217|organism=Clytia hemisphaerica|type=transcript|length=16773bp|location=Sequence derived from alignment at sc0000007:1119867..1136639- (Clytia hemisphaerica)
TCAATGGAAGAAAGTGGAAGTGCTAAAATAGCAATTCTCGCCCGAACTTT AAATTCTGAAAAACGTTAAAATACACTAAAATCTCAATATATTTCGAAGG TGATTGTAGGTTTAAAATTATTAACTTCTTACCTTTGATTGTAGAGTCTT GCCAATGACCAAGGTCTTCTGGAACGAATAGCTGCTGCTCTACTGAAAGG ATCCTTTTATGAAAAGGTAAAATATAAAGTATTATTATTTTCTTGATGAT CATGTGTTTTCGCATGATTTTCTTAGAAATTGCTTGCTGTGTGCTGTGTG TCATGAAGGAATTCATTTTTAATGGTTTAATGTTATTAATTGACATGAAA TGATTTTGGTTATGTTCTATTAAAAAGCTGCTTTAATTTTATTCTTTGAA GTCAAAATAAAATGCTAAATCATCAAAACCATAGATCTCAAGAAAAGGAA CCCTCTTATTTCTACAAATAATTGAATGTCTTTTTCTCCGGAAGGATTTC CCCTTTGAGAAGTCTCAATCATAAGACTCCTTTGTTCACGCCTTCGTAAC CCATAAACAAGTTACGTTCAGTTCTATAATATTCAAGTATGTTTTTTACA GGCTGGCGAACTGTTCCAAAGAGTCGGTTCCGACCAGCGTGCACTAGATG CGTATCGTAAAGGGAAAGCATATCGACGAGCGGTGGAGTTAGCACGCTCC TCCTTCCCACGAGAAGTTGTCAAACTTGAAGAAGAATGGGGAAACCATTT AGTGCTCCATAAACAATTGGACGCTGCTATCAACCATTTCATTGAAGCTG GGTGAGAGAACCTCTTTACATGTCTCATGCAGGTAGCATCGAACGGCTCT ATTTGCATAAATAACGAAATATTTTTTCACGTGCGTAGGTGAGACCCTCA CCAAGGTTTAAACCCGAACATGCAATACGCTAATACGCAATATTCCATCT TCTCTCTTTTCAGTTCTTCACAAAAAGCCATCGACGCTGCCATCCAAGCA CGACAATGGAACAAAGCTGTTCAAATCGTCGAGTTGCAAGATGAAGATGT TGTTGAAAAGTAAGACATCTTATCTGCCACCCATTTTTTGTGTTAGAATG CCTTCGGACAATGTGTATCTTTAGTTCCGTAGGAGGATCGGTAGCTTTAT TCAAGCCACGCAAAAAGGTCTTTTCTAAAAGGTAGCCTACGAATAAGAAC CGATAAAATTTTTACATAACCGAAATCTCATTTGCTTCTATTTTTTGCAG ATATTACAAAATCTTGGCAGAACATTATGCTCAAGTTGGTGAATACCAGG TAAATGGTCAGGCTCTTTCCTGGAAAGTTTTCTGCCTTACTAACTTTTCT TTCTTACTAACTTTTCTTTTTTACTCACTTGTGCTGTATGAGAAATCATT TTCTACGAGTTTATGTAAGATTTTCCACGAAAAGTGATAGGCGGCCATTT CAAAGTAAGGGATAGTTAAGTCACGATAATTTTTGAATGGATACCGCCAT TACGACTCATGCAACATTTGATAACACCCATTGAGGGCGGTTCCTAATCG GTCTCCAATCATGGTTGACAATTTCTTGAAATGGCCCTATGGTTATTCAT AATTATTCAAAAACCAAAACATTTCCTCTCACAAGGGAGAATTTCCTGCA AAGTCCCATACTAGTTACTTTAAGGGCAGAAAGTTTCGCGGGCAGGAAGT TTCGCGAATTTTGGTTTTAGCCGAAATTTCACAGATATTACTTTCGCGAA TCCATATAAAATTTACCTTTTTTGGTAACAAAAACTCATAAAACACGCAA AAATTTAGCAAACAGTGCAAAACTGAGTAGGAAAGTTTATTTTTCTCGAA AAAAACTTTCGTGTTTTTCAGGTTCAAATTCTTACCTGGCAGAAACTTCC GCGAAAAATGATCAAAATCGCAAAAAACGCGAAAGTTTCTGCCCGCGAAA GTTTTTGCCCGCGAAAGTATAATATTTTTCCCTGTGAATATTTTTAGATG GCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAAT GTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTATAATGTTGCC ATCATTTTAATGTTAACAGTGTAAGCTCCAATTGGAGACCACTGTGTAGA GACTATTAAAAACGAGAAAGAACGACAAATAACGATAACAAACACGACAA ACGACAATAAACGACGACAAATTTATTCAAAGAGACTTGGTAAGGTAAAA AAATTGTCACCTACTTTTGCCAGAGTACACCCCAGTACAATACTCATCAA GCCACGCCTAACCTTCTTGTAAATCTCTTTTACTTTCACAGCTCGCAGTA CGTTGCATGGATTCCGATGACGTCTCCAAACTATACATTGCACAGGCTGA ACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAGTAAGTCAACT GTTTCCACATACTTTTGGTTGTATTAAAGACTTGATTGACAAAGATACAA GAATAACGATCTTGTTAATTTATGAGTTCAAAGTCATGCATTAAAACAGA AGATTTTAGGGCTATACAACAACGCAATTCTAAACGAAATCAATCTATTC GAATCTTCGAATCTACAGTTGAGTCTCCATAACTCTAACCTCTATAACTC GAAGTATTCATAACTCCAAGTAATTTGTGCTTCCTTTACACTGATAAAAT ATACAAGGAATCTATAATCTGATTGGCTTGAGGCTTCTTTTGTATTCTTC TAACTGATTCGAAATATTCAAAAGAAAGTATCATTATTTTTTACACAGGT TATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACGA GCAAAGATGGTAAGAGCAGACATTTTAAAGACTTTTTTGGATGATATAGG CATTGACTTAAACGTTGCTTATATATCGGACCGAAAATGTAGAAAAATGG CAAAGTTTAATCTTATTAATTATCTTAAAAGCCTCATTTGTGACTCCGTA ATAGTTGTCTGGCTGGTTATTGATTGAAGTATTTGTGCTTCCCAATAGAA ACTAATATAATTCGCTTTTTATTTTCAGTACGACCAAATGATTAAACTGG TGAAAGAATACCACGGAGACTTGATCACAGATACTCATCTACACCTTGCT AAGGTAAAATAAACACACTCAGATTCGTAGTAGAAACCGTACTAGAGTGG ATTCTTTAACTTAAACCTCTATAGCTCAAAATTTTCTTAACTCGAACAAA TTTGTGTTCTTCGCGCGTATTCAGTGGAATCTCAATAAACTCCACCGTAA TTGTCTTCATTATCCCTTCTATGTCACAAAAGTTCTTAAGTCAAATGGAT TGAATCTGTAATTGGAATTTCCGTAACATCTGCTTTTAAATGAAGATCAT AATCAGTCATAATCAAACAATTTTGCATTTCATACATCTCACGATTCCCT TGAAGTATTTAAAATAAGATCGTGAAAGGATAAAACTCGACTGGAGATTT CATTGCGTATATTTCATTATATCATCAATTTCGCGTTCCAGGAATTGGAA TCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGA TTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATG CGTACAGGGTAATATTTCATCTTTATTAGTATCAAGTTTGATTGCCCGCT ATCGTCATCCATTAGTCAAGATTGAAGGGTTATTTGGTTAACAAATGCCA ACAACAATAAGTCGTCCGTTTCGGTTGACTAACATTTCCAAAGTGCTAAT CAATCTTACTAGTTCATCTTTATCTTACTATCTCGTGGCGTCCTGGCCCC CAAAACAGAAGTCAATGGCATTTGAATTGCTCTTCTAGAAATTATTTGGA CTTGAATACTTCGCATATTTTCAGATCGCCAAACAAAGTGGTACACCAGG CTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATT CTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGAT TATGCTATTGACACAACGTGAGTATATGTTCCATAAGATCAATGCTCCTA TAAAACCCAGCTCCACAGAAACACAGTTTAGTTGAATAGAATGACGTCAA ATTCCTANGTCCTATAAAACCCAGCTCCAGAGAAACACAGTTTAGTTGAA TAGAATGACGTCAAATTCCTAATTATGGACCGATGCGACGACATTTTTTT GACGTCGTGCCACCTGGTAAAACTTGTACTAAATCAACTTCTTTAGAGCC TTTTAATTAAGGATAGTTGTGTCATTAGTGTAAGTTATTTATCTCGATAG CTGCTAAGAGGATCATTTGAACTAATTTTCAAATCTCTTCCACCTTAGAT CGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTG ATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTT CAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTG TTCTTATGTAGGTCTTGTATCTTTGAAGGGAACAAAATATATAGATTGGA ATCGACATGGACATTAAACCTCTAAACAGTCTAAAGCAAAACGCGAGCGA AAACCGGGATGAATTTGTAAAAAGCTCGTGTTTTTTTAATCGGGAAGTCA TTGCATTGAGTGAGTTTTCTAATTTTATGATTGCAAATCATTATCTTAGT AGAAAATAAACGATGATTTGAAATCTTTGTTGATTAGGTATATCCACCAA TCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAG TCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAG ATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTA GCCATCAAATTTTACAAGGTAAGCAATGAACTGATGATGTTTAAACTTAA TCATTTTAAGCCATCTGTTAAGCATTTCTTTCATTCGGCAAACGCATCTC ATAAATTTGACTATTTTATTTTCAGGAGTGTCAACGCTGGCCTGATGTAC TTCGTATAGCAAAAGAATATGTTCCACACCAGGTATACTCAAATGCATTC AAAGATTACAGTAACAGATTTCTTTGTAAAATACGTAGTCTATGCCTGTT GTATCAATCAATAATAAACGATCCTTTACTTTTCGTAGTTGGCAGCCTTA CAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGTAAGT ACACGTTAATTCATTTCCGAGCGATGGTTGTTGGAAAGAGAGTCAATAGA GTTAAAGAGATTCAAATGATTGAGAGCTCCACCGTGGTACAGATAGAAAC ACTTTGTATGAAATGGTCAAATAAAGAATTATTTATTACGCAACCTGCTC TGCTCGATTTTCAAACCTTTAAAATAAAATGATTCCCTTTCTCATTTCAG AGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCG AGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATGGCA GGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGC CATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTA AACGCTTATTGGAAATGCAAGCTTACGAAACTGTGAGTTTTGCGATGTTT TTTTTCATTTTCTCTTCTCGAATGGAAAAAAAAAAACATTCGTAATTCTT TCTTGAGAAATAGCTATCTTCTATAGCTTAGATAGGGTTATGAAAATTAT TCTCGATGAGTATATCGATGATAGGATTGAAATAACGTCTTTTCCACCTC TACAATTATGAATTTTTTTTCCAATTTTTTTCACCCAGGCATCAGATTTG TATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGG AGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAGT AAAAACTATTTTGTTCGTACAGGCGAAATCGCTCAAAATAGAACTTTTAA AACTGAAGAAATTCTTTTCCAAATCTGCCAACGTCCCCTTCGCTTAATCA CTGGTAAAATGTTCTCGATTTATCACTTTTGAGATATTTGAATGACACAC CTTGCTTTGAGATGAATATTTCGTAAAATGGGTAACATATCGAGAATAAA TTGTAGATTTTTTTAATCGTTTTGTCTNTTCGTAAAATGGGTAACATATC ATGAATAAATTGTAAATTTTTTTATTCGTTTTGTCTTTCATAAGATTTTC ATTTGAACAATTTCCTCTTCTTTTCAAAAGGTACGAAGAACACGTAGAAG AAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGTCTCT TCACTTCATATCTTTTAACATGTTATGCAATTGTCACCATCTGTTACATC ATAATATTCAATATCATGGTTGCCAGAAAAACGATTTCATCAAAGACCAA ATATAATTTGATATCGTGAAAAAAAAATTCCAAAAGATAGCACATTATTG ATATGTTTTGCGTATGACTTCTCTTGCCTCCCTTTTTTAAAATTTCTTTT CCCCTCTTTTTTTCTGTAGCTGATCAACGTGGATGTGATCGCAGCACTTG ACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAG CAACAGGTATTACCCCTACTCATCTTACCATTACAATGATGTTCGATTTT CCAAGTAGGGTAGATCGTCAAATGGCAAAGTCAAAAAATTCAAAGTGTAA TATTTTTTTGTGAAAATTTAATCTATTGTAAGACATTTTGCGCAATTTTT AANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NATGGTTTCAAATGGTGTCCTGAAATTTTTTGGTGTTGAAAGTATTCTGA AAATACTCTGGGAGAATCTAAATGGTTTGGGTCAGAAATTTGCCCTAGTC TGCCACTATGGCATTGCATTTCCAACTAAAACGGGATATTTAGAGTTAGT CTAATTTTCTCAGGCTAAAATCTCAAAAATGGTTTCCAATGGTGTCCTGA AATCTTTTGGTGTTGAAAGTATTCTGGAAATACTCTGGGAAAACCAAAAT GGTTTGGGTCAGAAATTTGCCAAAGTCTGCTATTATGGAATTGTATTTCA TTCTAAAACACAATGTTTTGAGTAAGCTTGAGTGTTCTTCCTAAAGAAAT AAAATTCATAATGGCAGACTGGCATATATATGTCCATTGTAAACCACTGT GATTTTCCTTGATTGTTCCAAGAATACTTTCGACACCTAAAGATTTCAGG ACCCTATTTGAAACCATTTTTTAGATTTAAGCCTGAGAAAATTAGACTTT AACAATAAATATCACGTTTTAGTAGGAAAAGCAATACCATATTGGCAGAC TTTGGCAAATTTCTGACCCAAACCATTTTGGTTTTCCCAGAGTATATCCA GAATACTTTCAACACCAAAAAATTTCAGGACCCTATTTGAAACCATTTTT GAGATTTTAGCCTGAGAAAATCAGACTTTAACTCTAAATATCGCGTTTTA GTGGGAAATGCAATACCATAATGGCAGACTTGGGCAAATTTCTGACCCAA AACATTTTGTTTCTCCCAGAGTATTTTCAGAATACTTTCAACACCAAAAA ATTTCAGGACACCATTTGAAACCATTTTTGAGATTTTAGCCTGAGAAAAT TAGACTTTCAACTCTAAATATCGCGTTTTAAGTGGAAAAGCAATTCCATA ATGGCGGACTTTGGTAGATTTCTAACCTAAACCATTTTGATTCTCCCAGA GTTTTTCCAGAATACTTTCAACACCCAAAGATTTCAGGACACCATTTGAA ACCATTTTTGAGATTTTAACCCAAGAAAACCAAGTTTTAGCTTGAAATAT TGGCATTTAGCATGAAAACTCAATTTCTAGGGCGCCATTATGGATTTATA GGAAGTTTTTGAAAACTTAAGTTTGATTTTTCCTGGAGCTTTCTCTGAAG TGTTTAATTACTGAAAATTTCAAGTGTGTACCTTAAAAAGTTTAAAAGTT GTGGGTCCTCAAAAATGCTGCTTTCATGTATTTTGCTACCCAGAATTGGA GAAAATCAGCCTTTTCAGCTTGAAATTGAAACATTGAGCAATCTCGCTGG GGTTTTTTTGTCTTTTTATGTTGAATATTAGTACAAGACACCATTTAGAA ACCATTTTGACCCTTTACTGGGCTTTCATAGTCTTATAAATGGGCAAAAA GTGCCATTTTACTCCTTTTTCGCTTTAGTGCGAATCAAAGACCCCCCTGG GGAATGCTGGATTTTTGACCTAGGAGGTTAAAAATTGCGCAAAATGTCTT ACAATAGATTAAATTTTCACAAAAAATATTACACTTTGAATTTTTTGACA TCATGCTAAAAATGGTAGTTGACGATCTACCCTATTCCAAGTATTATTGT TTCTTCTTCATCTGGCTAGCTGTAAAGTGTGGCGAGTTTTACCCTAGTAG AACCAGGAGCTTTTGTTTTGCTTCCTAACCCTGTCCGACCTTTAAACATA ATACTGTGATTTGATTATTTGGTTAAAAACGCAAGGAATAGGAATATCAT ATCAATGATGTTTTTTACTCAACTTTTCCCAATGTTTATTTTTCTTCAGA GTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATC AAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGC ACCTGCCAATCCACAGGTTTGTCTACGTCAAGAAAGTAATGAAAATATGA TGTATAGTAGGGGGCCATTCTTTAGGGCCCGTGACAACAATTTGAGGAAT GGAATTTTTTTTGAAATTTTTTGAACGAAGTTTCAAAGTCGCTAAAACAC AAAATTGACCATGTCCTCTATGTCGTTTTTCGAGAGCTTTCCAATGGTAT AATTGGTTTCGTCAAATTTCGGGTCCCAAGGGTTTTTGCTTGTGACGTCA GTCTTTTCCCCATAAAAAAATGCTGGACCTAATTAATTTACTCCCTCTCA AAAAAGTTTTATAAATACATTCTTCTTTCGAATGATCAAAAAAAATTACA CTCCGGAAATTGTTGTCACGGGCCCTAAAGAATGGCCCCCTACTGCTATT CTCCATTGGAGATTCATAAAGCTTTAATTGAAAACGATGAATTTTTTCTC ACGTCAATAATCATTGTTTCTCTTTTAGAATTTCAACATCTACAAACGTT TAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATAT AAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGGTAAGTGCTTC GTTACCAAAGATATGCCCCTATAAGGAGTTCTACAAGTTCATTCATGCAG CGCGATAGCCTTTGGTTCCTGTGAAACCTCTTAAAGCATTTTACGTAGAA AGTATTTTAGAAGCGAGAAGAGTTTTTTACCCTTAAACAGCAAAAAAATT ACTTTTCAACGCTATAGCTATGATGAAAAATTTTCCCTTCACGGGATGGA GTTTTCGCCTTAATCCAAAAGTAGCATCTTTGGTGACAAAAGGATTTACT TGTGGGACTTGCGACAAAGGAACGTTTTCACTTTCTTGGGAATATTTGCA AATGTTTCCTTTCTTGTTATCACTTCTTATGAATACATTTTCATTATCGT CCTGTTTACTTTCCTTCCCTTTTCTTGTAATATCCGGACGTTTCAACAAG AGAGTGGGTTGTTCTCTCAAATAGATCAATCGTAAAAATAGGTACTATTT ACATATCACCACGTATTTTCCTTTTTTCATTCAATAACAGTGTGATGGGT TCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGGATG CTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAACAG CCAATTGGTTTGTAATCCATCCTGCACGAATTTAGGCTTAAATCTTAAGG AGAATTCTTTTATTTGAATTAGCATTCCTATTAGAATCGTATGTTTTGAA TCAAATACATCAAACTACAGTCACGTAAATCAAATTTGATCGTAAATAGA AAAGAAATTGGAATTATCCTCCGTAATTGAAACTTTTTATCGTGATATTT TCTACTTATAGTAGAATGAGCTTAAAAAGGCCTAGACGATGCTATCGTCC GTACAATATAATATTATGATATAACATAGTTTGTATACTATAAAACGTAA TATGTTTCGCGGCGGATAGAGTCTGTGTTTAAGACAACAGCTACTCCCGT AAAAAATTCCCGTCTTCACGTTTGTTCCCCTTATAGATGATACTATAGCA TAGTCTACCTCCGATGCTAATGCTAATTCTTTAGACAGAAAAAAAAAAAA AAAAAAAAAAAAAANAATTCCCGTCTTCACGTTTGTTCCTCTTAGATGAA ACTCGTCTTAGACTATAGCATAGTCTAAAAAGGCCCTAACTTTGAAAAAA AATATATATATTGCTGAGATTCTGAAGAAATGTTCCTTATGGGTCTCAAA ACCAAAATTTAACCTGCAATCAATTCGAAAAATTTCGGACCCTTTTTGGG GCATTTTATGATGACGTCATTTTCAGTTCAAAACTCAAGTTTTAAAATTT TGCTGACTCAGAAAGAATGAAGTAAAATGTGGCGACTCATTGTGCATCAT TGATTATAAAACCTGAATATCTCATGATCTAGCCATCGAAAATCGGCAAA ATCTTACAAGGTAGCAGATGACGTCTTGATTTGACTGAATTTCAAAAACG ACTCCATTTCCATAAATTTTTAGATGAAAGGGACGACTTTTTTTCAAAAA CATTTTAAAGTTATGTTTGAAGGATTTTGTACCGAAAATTAACATCATCA TAAAACCTGATTCTACCGAAATTAAAATCATCATTCTAAGGATACTAGCA TTCCTATACTATTTCAATCAGTTATACTTGGTTAAATCTTCAGAAATAAT TTTTCCACTTTTTTTTCATTTTCAGGAGGTTCTACATGCCAAGATTTCAG TTTCCTTATTGAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTTAT GAAGCTGGCATTCACTGCAAGGTATGTCAAATGCGATTTCTCATTTTAAG TTTTTTTCTGGATTTTAATGGGTGAGATTGGCCTTGGGGGGGGGGGGGGG GGGGAGGACGAACAAACACTTGGGGGGGGGGGGGGGGGGGAGGACGAACA AACACTTGGGGGGGGGGGGGGGGGGGCTCTTCAATAAATCAGAAATTGTA TTAGTTTACAATGTATGTAACAAACTATTGACCAACATAAATAAGATATT TACAATGAAAAGAAATTGAATCTAAAACGATGTTGAAAGGAATTGTTCGT TCATTGTGAAGTGTTTGTTCGTCTTCGTTTGAAGATGAATTTTCTGATCT TGTTGAAGCTGAAAATGTATATAATGGGATTCGATACAGATAACGCTGTG AAAGCAAAAATGGAGAAAATCCATAATTCTTTATGTTCTCCGATGTCCAT CAACATCAATATGGAGCTGATGGAAGAAGGTATGATGAACATGCATGTCC AAAAGTTCAAATGGATGATATCCTTGATGCTACGTCTCAACTTTTTTGAT TTCTGCAACTCCTCTCTCTTCATTACTGAGCTATATCTTGCTGCTAGTCT AGCTTCATTTCTATTACGCACGTCTCGTGTGATCTTACCGAAAACGATGA TACAAACACCGGTCAAGAGACGAATACACGTGGTACAGATAACAACATTA TATTTGGAATGCCACACAGTGTTTATTTCTCGTTTCGAATCATCAAAAAT ATAAATGCTTGACACTGTAGCTGCTAAGAGAAAGGCGGAAAGCAGTAGCA ATTTGTTGATCCTTCTTTTAGTAACATAGGTTTGGTAATAGATAGCGTGT TTGACGGCTATCAGGCGATCAAGTGTGAGGAAGATAGTGATAGTTAGGGA GAACCAATGGACCCAGTAGCCTGTACCTCCCAACAATTTGGTGAGAATTT CGACCTCTATCTTCATTACGAAGACCAGTATCACAAATAAGATAACATTC AACGAGAACAATGTATCAGCGATGGTGAGGAAGCGGATCAAGTAGTACTG GTTGTCACGGAGACCGGCTTTGTGTATGATGACGCAAATGAGGATGAGCA AAATGAAGGCCATGATGTTGAGTAAGAAACACGTGCCTTGGATGACCAAT GACATCTCTCCTGCTATCCACTCGTTGTTCACTGTTGCTTTGAAGAATCT AAAATTTCAACGATCATTTTACAATAATGTTGCCATAAAATATGAAAGAA AAAGAAACACTTAATTTACTAAATTTAGAAATAATGTGAAAAAGTGGTGA AAGATGAAAAAAGCAGCCAGTTCATACCGACTGTACCAAATAATCATGCG TGTAGGCTACGATGAGTCAGTTATTAAATAATTAGTGAAAGTTCCCTTGG AATTACCTTTGGATAGAATGTTGAGCTATTTTTGGAAAACTTAACACCTT AATTACTTCTTATGGAATCATCAAAGCTTTCGAAGCCACTCAACGAATAA TGAATGACTTACATGATTATGAATGAAGAGGAGATACTTGATGACCTTAT GCTGAACTTAATTTCCAAATCCTCAACGTTGTGATTGGATAACAACGACT TCTGTTCTCACCCTGCTTCGTATACCTTATGGTGTCTTCAACCTTCTGTG CTTTTTTTACCAAAACTTGCAATTGCCCTCTTCTTTATACTACCCTACCT GTGGATATGAATAATTAATAACATTGGATTTGTTTCACTTTTGTTTCCAT GTGACTTGTACACACAGCAAGACAGTTTTTCTTGTTTTCGATTTTTGGGA TTTGCTTTCCTCTGAAAAGACAGTCTACCCACTTACCTTTTGTGTTTTGG GGATCTATAATCAAATTAGTATACCCAGTCGTCCTTCTGTTTGTTATCTT TAGGTGCAAGAACAATTTTATTTGTTGTTTTTTGGCCCTAAAATACCAAA AGGTGAAAAAAATTGACTTTGATGGTTTATATGGAAGCTTTAACAACAAA TTTACTTATGTCCACCCCATAGCATTTTTTTCTTTTAACATATTTTAGGG TGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACT TGAGTGAGGTACTTCAAATGTTATTTACCAAGAAACTTCAGTGAAATATC TTTAAATGTTTATAAACTTGCGGTATTTTTAAACAAAAACAGTCTCTAAA CATAGCATGCTAGACTGTGATAATAGGAGAAAATGAAAGAAGAAAGATTA GTTTGGCCTAGCCCTCCAAATTCCACTGGCGCCGTATTTGATCACTTGAT TTGTTATAGGTCATATACATAGGACAAAGCAGCGCTGCGAAAAAAGGTTT TGGTTTTTCATGAGTGTTCCCGTTTCATATCAGACACATGTTTCATATCA GGCCGGTGTCTGCTATTGTTATTTTGTGCTCGATTTCGTGCTGAATAAAC AAAAAAAATTCTTTCCTTCTGTCTAACCAATATTGACAAACTCTCCTTTC CGCGCTGAGTGAGCACAAATCTTTATAAATTCTTTTGATGCTGCTTTGGT AGCATAAGAGACTCCTTTCTACCAAATTATCTTCAAGAGTGAAGTAAAAA CCGAAGCAAAACTTAGGTCTAACAAATAAGCATGAACTTTTTTACTTAAT GTCTAACGTTATTTTCTCCACAGGGCATCGAAGATGGTAACCTTGATGCG ATTGACAACACAGATATCATGGACACAGATATTCCGTTAGAGGTTCCTCT CCCTGAAACACAATATCTCAATGTACGTTCTTTATTTTTGCAATATTTTC ATTTTACAAGCGACATAAACGTGAACCCTTTCCAATTAACGCTTCCAAAA ATCTAGATAGTAAAGCCCCTTTAAGATATCTCACTCTGACATTTTTAGCC TGTGCCAAACGGGGTATTTTTCAGCACCGTTTCGTCTGTAACCTTTTACC CACTCAGAAATGAGGGAGATTATTGTCACTTTTGATTTCAAGACTTTTCA CAGAAATATTTTCAGGAACTGTATTTCAATGTAAAATAAAGCCTGTAAAT CAATGTTACAGACCAATAAAGTGATAAAAAATGCTTAATGAGCTTGTGCG CCGAAAGAAGACTAATCTTCGAATTTGTTAAAGGATGACGGGTGAAAAGA TTGAAATTATTCATACAGAAAATTCTGATCTATAATATAACAGGAGGAGC AACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGT GTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTT AACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGTA AGGTTTCTCTTTCATTCAGTTTGTGTCAGTGTTAACGTTTCTCCGAACAT CTTAAAATGATGTAACTTAATCTCCGAGCAAATTATGATACTCCGTGAAT AGCACGTATTCACACTAAAGGCCAAGGTTCCGTAAAATAATCTGCCGAGA TTGGCGCACCGCTTTGATCTTTTTCATCCAGATTTCGGATGAATATTAAA TGAAACAATGGCACCAAAATCAAGCGCAAATTAAAAACATTAACACTAGA ACCCAGTCGTTTTCGGTTACGCGGTTTTTTTTTGGCTAAACAACCAGATC AGATCGTCACATTCGCCAAGGGTTTAGAGCAGAGCGTGGTATTTGCAGAG TGGGCGATCTGTTATCAGACTAGATGCAACTTTGATCGATGAGAATTTTA TTGTCACACATCGTTTTCAATCGTATTTTATAATGGGTTTTAGATGGATT TTTTTTGTACGTCTAAACTTGGAAAATAACAACCAAGATACTTTACAGCC CGAAAGAGAAGAAATCTTGGTTTATGTAATTCAGTAGGGAGTTTGAAAAG TCATATAACGCCTTAAACATTTCCATTTTCTAATCTGACTATTCAGGTTA TCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCA ACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGTAAATATAGTT TATTAATAAATAATATTATAGAGGGAATTGTATGGAAGATTCTCCTTCAT CTATCATTTTTTCTGGAAAAACCATTGAGAAGGTTGATCTTAGCGAGAGG AGTGGGTGAAAGGGGTCTTCATTCCCAACTTTTACGAAACTTAGACTTGA GGAATATTTTTGATTCGATGAAAGTATGTCTATCATCATTCATGACTTCC TCCTAATGTTCATTCGCTTTTACTCTTTCTGGAAACCACTCTGTAGGAGA TTTGTCTATCACGCAAACAAACATGGTTTTCCTACATTTCCTCATGGCAG CCAAAAAAGCACACTCAAAGCCATAGACTCTAAGAACTTCTCAAAAAGTA TGATCTCTAAGAACTTCTCAATTTGATCAATTTCACATTCCAGGTGTCAC ACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGA ACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAACGTCTAAATAACAACAA CATGAGCTGGGCTCAATTCTCAAAACAATATGTTCACAACATGTAGATCA ATCAACATGTAGATCAGATTCTAGTGACTTGTAGAAAATTGTAGAGATTC TTTTCACGGTGCAAATATGATATTAATTTATTGGGTACATTTATAAATAT TGTTTACTGTAATATAATTCTATGTTTGTCGTCAAATTTTTAACTTTTTC CCTTCAGTTCATTTTGTATATACTTGAATAATGATAAAACTGGAAAATAA ATGTCGTTAGTGGTAATACAGTATTCGAAATTATCTTGTTGCTTCTTTTT ATTCTTATAAATTTGATTTTTTTAATTTTTGGACCTACCACAGTGGGGTA GAGGTCCTATAAATTAACCTTTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000660XLOC_000660Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001217-exon-sc0000007-1575043694:1136424..1136639TCONS_00001217-exon-sc0000007-1575043694:1136424..1136639Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1135839..1136038TCONS_00001217-exon-sc0000007-1575043694:1135839..1136038Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1135581..1135676TCONS_00001217-exon-sc0000007-1575043694:1135581..1135676Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1135341..1135389TCONS_00001217-exon-sc0000007-1575043694:1135341..1135389Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1134553..1134642TCONS_00001217-exon-sc0000007-1575043694:1134553..1134642Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1134201..1134298TCONS_00001217-exon-sc0000007-1575043694:1134201..1134298Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1133781..1133841TCONS_00001217-exon-sc0000007-1575043694:1133781..1133841Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1133487..1133561TCONS_00001217-exon-sc0000007-1575043694:1133487..1133561Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1132982..1133098TCONS_00001217-exon-sc0000007-1575043694:1132982..1133098Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1132573..1132715TCONS_00001217-exon-sc0000007-1575043694:1132573..1132715Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1132083..1132241TCONS_00001217-exon-sc0000007-1575043694:1132083..1132241Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1131672..1131852TCONS_00001217-exon-sc0000007-1575043694:1131672..1131852Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1131508..1131564TCONS_00001217-exon-sc0000007-1575043694:1131508..1131564Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1131346..1131401TCONS_00001217-exon-sc0000007-1575043694:1131346..1131401Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1130908..1131139TCONS_00001217-exon-sc0000007-1575043694:1130908..1131139Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1130592..1130701TCONS_00001217-exon-sc0000007-1575043694:1130592..1130701Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1129884..1130259TCONS_00001217-exon-sc0000007-1575043694:1129884..1130259Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1127124..1127240TCONS_00001217-exon-sc0000007-1575043694:1127124..1127240Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1126551..1126661TCONS_00001217-exon-sc0000007-1575043694:1126551..1126661Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1125933..1126049TCONS_00001217-exon-sc0000007-1575043694:1125933..1126049Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1124769..1124864TCONS_00001217-exon-sc0000007-1575043694:1124769..1124864Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1122682..1122741TCONS_00001217-exon-sc0000007-1575043694:1122682..1122741Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1122018..1122116TCONS_00001217-exon-sc0000007-1575043694:1122018..1122116Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1121443..1121596TCONS_00001217-exon-sc0000007-1575043694:1121443..1121596Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1120752..1120843TCONS_00001217-exon-sc0000007-1575043694:1120752..1120843Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1575043694:1119867..1120346TCONS_00001217-exon-sc0000007-1575043694:1119867..1120346Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1136424..1136639TCONS_00001217-exon-sc0000007-1510915933:1136424..1136639Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1135839..1136038TCONS_00001217-exon-sc0000007-1510915933:1135839..1136038Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1135581..1135676TCONS_00001217-exon-sc0000007-1510915933:1135581..1135676Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1135341..1135389TCONS_00001217-exon-sc0000007-1510915933:1135341..1135389Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1134553..1134642TCONS_00001217-exon-sc0000007-1510915933:1134553..1134642Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1134201..1134298TCONS_00001217-exon-sc0000007-1510915933:1134201..1134298Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1133781..1133841TCONS_00001217-exon-sc0000007-1510915933:1133781..1133841Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1133487..1133561TCONS_00001217-exon-sc0000007-1510915933:1133487..1133561Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1132982..1133098TCONS_00001217-exon-sc0000007-1510915933:1132982..1133098Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1132573..1132715TCONS_00001217-exon-sc0000007-1510915933:1132573..1132715Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1132083..1132241TCONS_00001217-exon-sc0000007-1510915933:1132083..1132241Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1131672..1131852TCONS_00001217-exon-sc0000007-1510915933:1131672..1131852Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1131508..1131564TCONS_00001217-exon-sc0000007-1510915933:1131508..1131564Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1131346..1131401TCONS_00001217-exon-sc0000007-1510915933:1131346..1131401Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1130908..1131139TCONS_00001217-exon-sc0000007-1510915933:1130908..1131139Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1130592..1130701TCONS_00001217-exon-sc0000007-1510915933:1130592..1130701Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1129884..1130259TCONS_00001217-exon-sc0000007-1510915933:1129884..1130259Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1127124..1127240TCONS_00001217-exon-sc0000007-1510915933:1127124..1127240Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1126551..1126661TCONS_00001217-exon-sc0000007-1510915933:1126551..1126661Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1125933..1126049TCONS_00001217-exon-sc0000007-1510915933:1125933..1126049Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1124769..1124864TCONS_00001217-exon-sc0000007-1510915933:1124769..1124864Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1122682..1122741TCONS_00001217-exon-sc0000007-1510915933:1122682..1122741Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1122018..1122116TCONS_00001217-exon-sc0000007-1510915933:1122018..1122116Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1121443..1121596TCONS_00001217-exon-sc0000007-1510915933:1121443..1121596Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1120752..1120843TCONS_00001217-exon-sc0000007-1510915933:1120752..1120843Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1510915933:1119867..1120346TCONS_00001217-exon-sc0000007-1510915933:1119867..1120346Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1136424..1136639TCONS_00001217-exon-sc0000007-1491911889:1136424..1136639Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1135839..1136038TCONS_00001217-exon-sc0000007-1491911889:1135839..1136038Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1135581..1135676TCONS_00001217-exon-sc0000007-1491911889:1135581..1135676Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1135341..1135389TCONS_00001217-exon-sc0000007-1491911889:1135341..1135389Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1134553..1134642TCONS_00001217-exon-sc0000007-1491911889:1134553..1134642Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1134201..1134298TCONS_00001217-exon-sc0000007-1491911889:1134201..1134298Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1133781..1133841TCONS_00001217-exon-sc0000007-1491911889:1133781..1133841Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1133487..1133561TCONS_00001217-exon-sc0000007-1491911889:1133487..1133561Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1132982..1133098TCONS_00001217-exon-sc0000007-1491911889:1132982..1133098Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1132573..1132715TCONS_00001217-exon-sc0000007-1491911889:1132573..1132715Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1132083..1132241TCONS_00001217-exon-sc0000007-1491911889:1132083..1132241Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1131672..1131852TCONS_00001217-exon-sc0000007-1491911889:1131672..1131852Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1131508..1131564TCONS_00001217-exon-sc0000007-1491911889:1131508..1131564Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1131346..1131401TCONS_00001217-exon-sc0000007-1491911889:1131346..1131401Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1130908..1131139TCONS_00001217-exon-sc0000007-1491911889:1130908..1131139Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1130592..1130701TCONS_00001217-exon-sc0000007-1491911889:1130592..1130701Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1129884..1130259TCONS_00001217-exon-sc0000007-1491911889:1129884..1130259Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1127124..1127240TCONS_00001217-exon-sc0000007-1491911889:1127124..1127240Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1126551..1126661TCONS_00001217-exon-sc0000007-1491911889:1126551..1126661Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1125933..1126049TCONS_00001217-exon-sc0000007-1491911889:1125933..1126049Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1124769..1124864TCONS_00001217-exon-sc0000007-1491911889:1124769..1124864Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1122682..1122741TCONS_00001217-exon-sc0000007-1491911889:1122682..1122741Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1122018..1122116TCONS_00001217-exon-sc0000007-1491911889:1122018..1122116Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1121443..1121596TCONS_00001217-exon-sc0000007-1491911889:1121443..1121596Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1120752..1120843TCONS_00001217-exon-sc0000007-1491911889:1120752..1120843Clytia hemisphaericaexon
TCONS_00001217-exon-sc0000007-1491911889:1119867..1120346TCONS_00001217-exon-sc0000007-1491911889:1119867..1120346Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1119867..1136639 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.748994 0.274899 0.165466 0 1.20192 0.94041 1.17485 1.39118 1.85799 1.18037 0.420022 0.805631 0.635526 0.445178 0.732329 0.959887 0.960061 0.537898 0.419266 0.479662 1.2356 1.38274 0.345071 0.600795 0 0 0.632678 1.97107 0.624683 0.477387
Blast
BLAST of TCONS_00001217 vs. Swiss-Prot (Human)
Match: IF172 (Intraflagellar transport protein 172 homolog OS=Homo sapiens GN=IFT172 PE=1 SV=2)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 318/592 (53.72%), Postives = 447/592 (75.51%), Query Frame = 1
Query:  166 LLERIAAALLKGSFYEKAGELFQRVGSDQRALDAYRKGKAYRRAVELARSSFPREVVKLEEEWGNHLVLHKQLDAAINHFIEAGSSQKAIDAAIQARQWNKAVQIVELQDEDVVEKYYKILAEHYAQVGEYQMAERFYVRGNMPRTAVEMYTKVNKYEAAYKLAVRCMDSDDVSKLYIAQAEQLEAQGRFKEAEKLYIMIEEGDLAINMYKRAKMYDQMIKLVKEYHGDLITDTHLHLAKELESEGQLSTAEHHYLEVGDWKACVNMYRSNELWEDAYRIAKQSGTPGSGKQVAYLWAKSLGGDSAIKLLQKLGLLEACIDYAIDTTSFDFAFDLARTLKREKVMEIHLKKAMFLEDEGRFNDAEDEFIKAEKPKEAVLMYIHQSDWDEARRVAESYDPESLVDVLIGQARLSFEKKDYTEGESFLLRAQRPELAIKFYKECQRWPDVLRIAKEYVPHQLAALQDEYDRIATQSGGDKGAEGIIAQARDWETRAEYNRAIDLYMRITQDMAGNSAVIEEVYTKALELAIKF-SKDRALSVAHEVCKRLLEMQAYETASDLYQAVKLYREAISACVKGDLWTQARSIARDYAP 1938
            L+E I AAL+KG  YE+AG+LF+++ + Q+AL+ YRKG A+ +AVELAR +FP EVVKLEE WG+HLV  KQLDAAINH+IEA  S KAI+AA+ ARQW KA+ I++LQD +   KYY ++A+HYA + EY++AE  Y +G+  + A++MYT+  ++E A+KLA++CM  +DVS LYI QA+++E QG+++EAE+LY+ ++E DLAI MYK+ K+YD MI+LV ++H DL++DTHLHL KELE+EG+L  AE+HYLE  +WKA VNMYR++ LWE+AYR+A+  G   + K VAYLWAKSLGG++A++LL KLGLLEA +D+A D  SF+FAF+L+R   + K  E+HLK AMFLEDEG+F +AE EFI+A KPKEAVLM++H  DW+ A+RVAE++DP+S+ +VL+GQAR + E+KD+ + E  LLRAQRP LA+ +YKE   W D LRI K+YVP QL ALQ+EY+R AT+ G  +G EG + QAR WE   EY+RA+D Y+++    +GNS + E+ + KA EL+IKF    R + V   V  +L+ +  +  A++LY  + L +EAI A ++G+ W +A+ +A++  P
Sbjct:  798 LVEHITAALIKGELYERAGDLFEKIHNPQKALECYRKGNAFMKAVELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTASKYYPLVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVQEPDLAITMYKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRASGLWEEAYRVARTQGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHAADNCSFEFAFELSRLALKHKTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREATKKGA-RGVEGFVEQARHWEQAGEYSRAVDCYLKVRD--SGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDP 1386          

HSP 2 Score: 440.654 bits (1132), Expect = 3.617e-130
Identity = 198/339 (58.41%), Postives = 255/339 (75.22%), Query Frame = 1
Query: 2233 INVDVIAALDMYVEQGLWDKCIQEAEQQSFEVLSKYVALYAANLIKDGDQVKALRLFVEHGAPANPQNFNIYKRLVEDLFAKQGLSGENAYKVWADLRTMLYDLCDGFNKKP-TNPAVMDIFNRMLLVAHYYAIRSAITKNSQLEVLHAKISVSLLRYCDLIPCDKAFYEAGIHCKGVGWENMAFVFLNRYLDLSEGIEDGNLDAIDNTDIMDTDIPLEVPLPETQYLNEEQREEVKEWVLAVSMDQRVEQTLSFDERNVYEASLTSPESDVVCLPCVVTGYPVLRNKMEFNKTGKAANKEDWNKFAMATKVSHSADCQDVLRFLSLWCGTSGNQAFSF 3246
            + VDVIAALD+YVEQG WDKCI+ A +Q++++L KYVALYA +LI++G   +AL L+V+HGAPANPQNFNIYKR+  D+ +  G +   AY  WADLR +L++LC+   K    N    + F  MLL+AHYYA RSA     QLE + A++SVSLLR+  L+P DKAFYEAGI  K VGW+NMAF+FLNR+LDL++ IE+G LD +D++D  DTDIP EVPLP  Q++ E +REEV++WVL VSMDQR+EQ L  DER  YEASL +  + V  LPC++TGYP+LRNK+EF + GKAANK++WNKF MA K SHS  CQDVL+F+S WCG   + +FSF
Sbjct: 1410 VGVDVIAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGSSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNRFLDLTDAIEEGTLDGLDHSDFQDTDIPFEVPLPAKQHVPEAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVAASTGVRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPSTSFSF 1748          
The following BLAST results are available for this feature:
BLAST of TCONS_00001217 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
IF1723.617e-13053.72Intraflagellar transport protein 172 homolog OS=Ho... [more]
back to top