Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001213 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001213
Unique NameTCONS_00001213
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2625

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001213 ID=TCONS_00001213|Name=TCONS_00001213|organism=Clytia hemisphaerica|type=transcript|length=2625bp
GAGCttgaaccattgagtttcaagcccgaagggctagaggtcaatctctt
tggtaggatttgaagccaacaaatcctaccaaagttgcgcggccttgagc
gacccgcctggtttttacacaaatgacaggttgaaactaaaatttaacgc
ttaatttcgaaaaatatatcactcgaagacaaaggaattgctagattcaa
tccgtcatcaaaaatacggcgcatattttaaggcttcaatttttcttccc
tgagaaaggttagagattgacctctagcccttcgggcttgaaactcaatg
gcttGAACTACTACACTGAAACGAAATTAATATTTCACTGTCATGACAAC
GGGGCATTTATTTACATTCCCGATATTCTAAATCTCTACTGCGCACGCGC
ATGTTTTgatttgtgcttgattcaaaaTGTCTGACAtcactttgcaaaat
attagaCAAGATGTCATAAAATCTCGCAATTTGTAATGATTTGATGGTAA
TGGAGAAATCACAGTCTAATTGCAAGTGAAGATAACACAGAGATGAACAC
AGATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTG
GAAAAGGGGCGTATGGTATTGTTTGGAAAGGTATTGACAGAAAAACTGGT
GAAATAGTTgcattaaaaaagatttttgatgcTTTTCGAAATCAAACGGA
TGCACAGAGAACATTTAGAGAGATATGCTTCTTGCAGGAATTTGGAAGTC
ATGACAATGTTATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAA
GACATTTACTTGGTGTTCGAATTTATGGACACTGACTTGCATAATGTTAT
CAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGGTACATTATGTATC
AGCTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCACAGG
GATCTGAAGCCAAGCAACGTTTTACTGGATAGAGAATGTTTTATTAAAGT
ATGCGACTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATG
GGGATCCAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCC
GAAATCCTCCTAGCTTCACCAAAATATACGAAAGGAGTGGACATGTGGTC
GATGGGGTGTATCCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTG
GATCCTCAACTCTCAATCAAATCGAACGAATTATGGCCGTTATACCAACC
CCAAGTAGACAAGACATCGATAGTATCAAATCATCATACAGCACCTCACT
ACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACCTTTTCC
CGGATGCACCCAATGATGCACTTGATATGGTTCAATCACTTTTACAATTT
AATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTACCT
AGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATGACGTAG
TCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATATCGAACC
AAACTATACGATAGCATCATGCAAAAGAAGTTGGACATTCGAAGGCAGCG
ACGAACGctggaaagtgaagaaaaacctGCCTCAGCTTCAGGCGGGGTGG
GTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCTCTTGCTAAAGCT
TCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCACCAAATCTGCACC
AACAAAGAATGCACGTACACCGGCCGATCAACAGgTGGCGCACCAGAGAC
CAGGACAATATTCTTCTCCGAAGGTTCAACGAGTGGCCGGCAAAAAGCCC
TCTTCAACGCAGGCAACGTCAGGTCTAACCATGTCAAGTTACACGCAAAG
TCACGCCTCTGTCAGTAAAAGTACACTGGATGCAATCCATGGACTGTCAA
TCAAATAGGGCTGTTGAAATAATGACAAACAATCTATTATAATGCACTTA
TTGAAATGAAACGGAAAAAAGTTTCCCCGAAAAGTCAATGAGTACGAGAA
TATTTAGTCCGCACTTTATTGTCAGAACCNCTTCTTCCGAAAAGTCAATG
AGTACGAGAATATTAAGTCCACCCTTTATTGTCAGAACCTTAAAATTGAC
GATTCTTCGTAAGATTCTTAGTTTTctttgaaacatttttgtaaaGTCTT
TATCTGCGACATTTTACTTCGAATTTAGTCTTTTTCAACCAGAGTTAGGG
TCTTGACTTAAAATGATTTTAACAGAAAATAAAGgggagaaaattgaaaa
tatttaagttaAATTATACTCagtagagaaatctattttgatgtttttgt
gtAAATGCGCGTATTGTATcataaattttttgtcaattttttagaTGTAA
TATTACATTAGtagagaaatttttatttcatggcttttaattcaattttt
taagaaagtcTTCGAAGACAAACATTTCAGTCGAATTTCCACACGTACAA
CGTTTCAAGGTCTCATTGATGGAGGTCCCTGAAACTCAATTTTTAGATGT
TGTTAGAAATCAAAATGTATAGAAAGTTTTTGTACATGCATTTTAATTTT
ATGCTCAAGAAATACAAActtcaaa
Run BLAST on NCBI

transcript from alignment at sc0000007:1086988..1097129-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001213 ID=TCONS_00001213|Name=TCONS_00001213|organism=Clytia hemisphaerica|type=transcript|length=10142bp|location=Sequence derived from alignment at sc0000007:1086988..1097129- (Clytia hemisphaerica)
GAGCTTGAACCATTGAGTTTCAAGCCCGAAGGGCTAGAGGTCAATCTCTT TGGTAGGATTTGAAGCCAACAAATCCTACCAAAGTTGCGCGGCCTTGAGC GACCCGCCTGGTTTTTACACAAATGACAGGTTGAAACTAAAATTTAACGC TTAATTTCGAAAAATATATCACTCGAAGACAAAGGAATTGCTAGATTCAA TCCGTCATCAAAAATACGGCGCATATTTTAAGGCTTCAATTTTTCTTCCC TGAGAAAGGTTAGAGATTGACCTCTAGCCCTTCGGGCTTGAAACTCAATG GCTTGAACTACTACACTGAAACGAAATTAATATTTCACTGTCATGACAAC GGGGCATTTATTTACATTCCCGATATTCTAAATCTCTACTGCGCACGCGC ATGTTTTGATTTGTGCTTGATTCAAAATGTCTGACATCACTTTGCAAAAT ATTAGACAAGATGTCATAAAATCTCGCAATTTGTAATGATTTGATGGTAA TGGAGAAATCACAGTCTAATTGCAAGTGAAGATAACACAGAGATGAACAC AGATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTG GAAAAGGGGTACGTTTTTCTCTGCTGAAGCCTTCATATTTACCTTTTTTT TCTAGCTTTGTTTATCTTTGATCTTGTATTGAATTTTAGGACACCAAACT TTTTTCTCGTTTGTTTTCACGAAGTTATTTCTTTTTCTTTCTGACTGATC ATTACCGTAAGTTGGTCTAATATCGACATCCCTCGTCTAATTCCGACACC CTTCTTTAGTTTAGAGACAGGAATTATATGAAAGCTTGAATCACTGCATT GCTGATTGAAAAAGGATTATTCCTCTCTGACCCACTAAGCAAGGAAAAAC AGTTTCAACCTTTCAATCAATTTCAGCTGATAAATAGGGTGTCAGAATTA GAGGAGGGGTGTCGACATTAGACCAAGTTACGGTATATTTTTGTTGTGTT ACTTTTGACAGTAAGGTGATTTCCAGACAATATCTGGTCCTTTAAATGTT TATCAGTAAGACCTTCTGAGTAAGCTGGTTAAAAAAATAACTCTAACTAC ATTGTAGACCAGTAATTTTGTGAGCGTAGTGCAAGAATGACTTTGAGCAG GAGGTTTGGGGGAATTTTAAGGCCTAACAAGTGGGAGTTCAGGGCCCAGC GCAGCGCTCTCTTACAAAATTTTGGAGTCTGAAATGACCCTAAACTTTGC TAAACACCTGTTTTGATTTAATGAAAAACAACTAAAGAAATGTAAAAATA CTTAAAAAGCCTATAAAGCCTACCGTGAAGTCGGGTAACATGTTAGCCTC CACTGATGCAAGTTGGTATAGCCTTCAAGTTTTACCCTGACCAAGTTAAA AGTACCGTAAGTTAGTCTAATTTCAACATCCTTTTTTAGAGATAGGAATG ATAGAAAAGTTGGGATCAATGATGACTCCTCAACTGATTGCTAAGCAAAG AAAATTAGTTTAATCAGCGATTTCGGACCATCCTATCATTCCTATCTCTA AAGAAGGGTGACAAAATTAGAAGAGGGATGTCAACATTAGACCAACTTAC GGTAAGCTTCAGAATGACCAGCGGCTATTTACTTCAGGCGGGGATGGTAC AAAGTTAAGCTATGGTAAACTTGAATCGCTCAATAATCGCACAGAAATCA CCCCCGTGTAAAGCTAACAGATCTGAAAATACGACGCTAGATTTTAGATG CAGATATCTGTGTTGTAGAGCGCGAGTGAGCGCGTGTACACTGGCGCGTG TTTAACTATAGAATTTATTTCATATTTCAATTTAAAAGCCTACTCGGTGC GGAAGAGAAATCGTGTATTTTTTAATACGCGGTTCATTAACTCAAATCAA ATGACTTTGGAGGTTCAGTGAAATGGTGGCTGAATTGCCATCCCATGTTT TGTCAGATAGTCCCAAGTTAGAGCAGTTGACGGTAATAGAAAACCAGAAT GCGGATCTTCTATAAATATTAACTATAGTAATGAAAACTGTAATGTGCAC TCTCAAACATCAATTGATGACAGATGGTACAAAATTTAATAAAGGAACTG TCATTATTTGATAATCGAACAGAAGATTTTCTGTCAAGAATCTTGTAAAC ATTCAAACAAATTCCATAAAGATTATCTGTTGTAGCTAAATCAAAATGCT ACCATTTAACAAACATACCAGGTGCGCCACAAAAAATTTTCTCTCTTTGA AACTAATTTTCAAGAAATCTAAAAATTTTAAAAGAGCCATTCCTATTTCA TTGGAAAGAAGAAAGATAAACATAAATTTTGATGGGTCATTTATTAAATT CGATTCACTAGATCAAAAGTTATGCTCAATTGAATGAAAAACTTACTTTC GGGATGTGCTCAAAAACGTTGAAAATCGACTTATCAAATTAAACAGAAGC ATAATTACATGATACATCAGTACTTTCGTTTCAGTCATTAAAAATGATAA TAAGCTGTCTAAATGACCTTTTGTTATNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNAAATTTGGCAAATTTTTAGCAGGGGACC ACCCTTTTTTGCAGTTAGTACATCTGAGTACTAAGTGATTTTATCCAATT CATATGGCACACCACCACGGTACTAATTGGCATGATGTCTTGTACTAACT GCTTCACCCCCCCTGGTTTTAAGGTAGATCCAGTCTTACTTAGACTTCAT CCAGTCGAGAACCAAAAATCTGAGGAAAATTTCGGTAAAAGTAAATTAAA TTGATTTTGATGAAGATTTTAAACAGTTTTAAACCCTTTCGACCCTTCAG TTTCAAAATTTATGTGTTTATTTACTGAGAAATGCTCTTAATCATGTAAA GGCTATTGCGATTGCCAGATTTAAAATAAAAAATTGATAGGTCGATTTTT AACATTTTCTTATCCAATTGAGCATAACTTTTGATCTAATGAATCAAATT TAATAAATGACCCATGAAAATTTAAGTCTATCTTTCTTCTTTCCAATGAA ATAGGAATGGCTCTTTTGAAAGTTTTAGATTTTGAGAAAATTAGTTTTAA AGAGAGAAACTTTTTTGTGGCGCACCCGGTATGCGCNATTTAATAAATGA CCCATGAAAGTTTAAGTCTATCTTTCTTCTTTCCAATGAAATAGGAATGG CTCTTTTGAAAGTTTTAGATTTTGAGAAAATTAGTTTTAAAGAGAGAAAC TTTTTTGTGGCGCACCCGGTATGCGCTGTTCCAGGATTGATCCCATTAAA TAAAGCCACACCCACAAAAACACCAGCAAACAGCCTTAAAGGTTGACAAA TTTTAATCTGTCAATCAATTTCTCAAGTAAAGAGTACACAGATTAAACAA ATAATATGATAACAATAAGGTTTTAATACAGAAATACCAAATTAAATTGG ACATCTAAAATGCTATTCACAATTTTAAAATGCCCATTCACAGAGTTTTT TAGCTGCTAACTAAGAAAACAAAAGAGCCATCTGGGTGGATTTCCCTTTA ACGTTAAAAGCTATGAACTTTGAACAAATCGTGAACATACTAAGGACACT TGTGTTGATTTCCAATTTTGTCAATGTTTTGCAAATAGAACAAAGGTAAC AATTGTAATTGATATTTATTCGCATCTATCTCATATATTTGGTTGATTTA CAGCAGGTTGTTCAGCCTATCCTCACAGCTGCTAGTACAATTAAGTCATG TAAGCAAATGCTTAATAAACATTGCAATTTTTAATTTCTTAGCAATAAAC CTTGGATATTTGGCAAAAGTAAAACTGAGCTTTATTTAGCTGCAACAATA AATTCTCTAATTCCTGTCATAGTGTCAAATATATTTAGCAGATTAGTGCG CCTCATTAAAAAATTTTCTGTCTTGTCTTCTGCATGGCATAATATCCGAG TCTCAAAATTAAAAAAAAAATTACCTCAGCCATATAATAATGTAAAATTA CACATCTTGATGTACCCAAACAATTTTGTATCCCTTTGATTTGAAAGGGG GAATTCACTGTATGTTTCCTCTCTTGAAACCACTAAGATTATTGGCAAAA TTTTAAACTTTAAGTTGTGAAAAAATGGCCATCATGTTTTCACATTTTTT AAATCCTCCAGCGGACCTGATAGTATTGGATTCATTTTTTGATAAATCTA ATAATTTCCTGAAATTACCTTTATCTTGTTTGTTGACTGATAGCATTTTT TATTTTGTTTGTAATAATGTATTTTTTACATTCAAAGCACATTAACTTGT ATACACAAATAACCCCATAAAGAACTTGTTTAGAATTTACCAGGAAGGTA TGACGTCAAATGTCTATATCTGTAAGAAAATCCATACAACTACTTCAGGC ATTCAATCTCAATCCTTCCTGGTAATCTCAGTCTGTCTGGTCGTTGATGT TCACCAATTTGTTACAATTCTTTTTCAGGCGTATGGTATTGTTTGGAAAG GTATTGACAGAAAAACTGGTGAAATAGTTGCATTAAAAAAGATTTTTGAT GCTTTTCGAAATCAAACGGATGCACAGGTTCGTTTTACTTTTCATCTTCT GCATATTCTGTATTTTATTAGGCTGTTAATTCTGAAGGTATCCAAGTAAT TGGCACCAGCTTTATTTTGTTTCAATCCTATTTCACAGTTCTGTCATTGT TTTCTTTTCACAGAGAACATTTAGAGAGATATGCTTCTTGCAGGTAAGTT AATTTCTATTTCTATTTCATAATTAGTAGCTTTTCTGCATTTTGAAACAT ATGTAGTTAGTAGTATTTTTAATTTGTTGTTGAATCTTTTTTCAAAACCA TCATCACGATCGAATTGTGGTATATATCAAACTTCATTACATGCATTACA TTACATTACATTTACTTGGATGTCTAGAAGATTTGCTCGATATTGCTACT CAATATTAAAACATTGTTGTTCTGTTTAGGAATTTGGAAGTCATGACAAT GTTATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAAGACATTTA CTTGGTGTTCGAATTTATGGGTAAGTGCTTTCATTGATTATCAATAATTT TATCAATCGACCATGTATATTTTTTGTTTTGATAAATTTGGCCCTGTATG AAATTTGGTTTTTGATATTTTTAATTTTTCATTTCTCAGACACTGACTTG CATAATGTTATCAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGGTA CATTATGTATCAGGTATGTAAATCTCATCTGAACGTTTCCAAAATATAAG GGAAGGACATGTTATTAATGGGATCTCAATCTTATACAAGTCATGTTTCA AAATGATGGGTTTATGTTCATGTTTATGTTCATGTTTTATGCTCATTTTT TCTAGCTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCAC AGGGATCTGAAGGTATACTTTTTTCTAAGGTCTTTTCGCATTTTTCCTGT CGGTTTCTTTTAAATGTGTATAATAAAAAAATGATTTTTCAATTATTTAT CTGATTCAACAAACTATCAATAAAATATGACGTCAATTGATCAATTTTGC AAGTATTTTTCTCACATACAAAAATGTACTGAATAGTCGATTGAGTGGAA ATAAACCGTACTGTTTATTTATTTATTTACTTTCAGCCAAGCAACGTTTT ACTGGATAGAGAATGTTTTATTAAAGTAAGAGCAAATTTTTTTATTCCAT TCAATTCAAACCCAACTCTTCCTTGTTGCAAACTTCTGCAAAAATTCCAT GATCTGTAAATATTTTTTAAAAACAAAGTCATAGAGTGTAAGAATTACAC TTTTTGTGACGGATTTCCCTAAAGTTCCTTGAAATTCTTATCGGAAGNCT TAAAAACAAGAGTGTAAGAATTACACTTTTTGTGACGGATTTCCCTAAAG TTCCTTGAAATTCTTTTCGGAAGAAATATCTGAAACGTTTCCATTTCTTT AAAAATGAAAATAACATTGGGGCGTGACCCCCTTCCGATTAGTGCTATAC TTAGCACAACAAAAATGCCCCTAGGTTTCTCACGCTTCACCCCAAGTTTT AGGCTGCCTAGGTTCTTCGCCTTGTCTATTTAAGTGATTGAAACTCGCAC ATCCTTTCCTACACACTTTATTAACATTTTATTCTGTTAAAGGTATGCGA CTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATGGGGATC CAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCCGAAATC CTCCTAGCTTCACCAAAGTAAGGGGATCTATTTCACCCAAAGTCATTAGT TTACTATCTTGACTGAAACCTATGAGGTTAACTAACTAACTAACAAGACC CTTTTTGGAAATATTTATGTATAAAATGTTGTAAAAATGCAATTGTTTTG AACTAATAAGACTGATGAGTTTGCTTCAAAATGTGTTTAGAAGGTTGCAG AAATCAGCAGAAATAGGTAAAAATTGCTGATATTGAAAGGGCCCACCATG ATAGTTGGGAAGAGCAATCAAATATCACCAAAATATTATAATTTCTCTTA TTATCGTCTAGATATACGAAAGGAGTGGACATGTGGTCGATGGGGTGTAT CCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTGGATCCTCAACTC TCAATCAAATCGAACGAATTATGGCCGTTATACCAACCCCAAGTAGACAA GGTTGGTATTTCCTTTGATATCATTTGTATCTGGTAGTTTATAAACTTAG AAAGTTTACATGTTGTATAGTGTATGTAGCACTGAGCTCAAAGACTGAAA TACTCTCAATTCCATTGATCAATAGTTTTTAATAGAGATTATAATGCAAC ATTTATCTCCCTTTAGACATCGATAGTATCAAATCATCATACAGCACCTC ACTACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACCTTT TCCCGGATGCACCCAATGATGCACTTGATATGGTTCAATCACTTTTACAA TTTAATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTA CCTAGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATGACG TAGTCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATATCGA ACCAAACTATACGATGTATGTATGATTATGTTGTTTCTAAAACTATGAGA AATTTTGAGTTTGCCAGAATAATTTACTAATAAAAGTGAAGACAAGAAAC TTAATTCTATTCATCTTGGCTTTTTGATGATTTCGATTTTGCTTTTAGAA AAGATGAGTTGAGTTTGAGCAAGTTTCGAATCTCCATAAAGTAAATAATT CACACAACTCTTGTCTATTTTCAGAGCATCATGCAAAAGAAGTTGGACAT TCGAAGGCAGCGACGAACGCTGGAAAGTGAAGAAAAACCTGCCTCAGCTT CAGGCGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCT CTTGCTAAAGCTTCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCAC CAAATCTGCACCAACAAAGAATGCACGTACACCGGCCGATCAACAGGTAT TTATGGTCTTCCTCTAAAACCTTGAATTCAATGCACTTTCAACATTTAAN GCCGAGTCATAAAGCTGTTCGAACCACCAAATCTGCACCAACAAAGAATG CACGTACACCGGCCGATCAACAGGTATTTATGGTCTTCCTCTAAAACCTT GAATTCAATGCACTTTCAACATTTAATGATCCATCACCATCAGACATCCA TACATGATTACTGTTCACAACCTCATACATTCCACCTTTTCCGTCCACAC ACATTTCTAATAAAATTGACCCTTCTCTCTTTTCCTTTTGTAGACTTACA AATCCAGCCCTTCCAACATGCGTTCTCGTCCTATCTCATCACAGTATGAT AGAAAAGCTAATAATAATATCCTGACGCGCCCAGATAACAATTTACAGAT TACCAGTACCTCCAAAGTAAGACATTTTTTGTAATTCCTTCCCTTTCACA ACCCTTGTTCCAATTCACCCATCCTCCCCATGTCATCGACAATGTTTTAT GACGGCTGACACTTATGTGTAAAGGAAAGACCAGAACAATTTGCCATCCT TTTGTTTAATGGATTCATCAAACTCCTCAAAGCCTCTTTTCATAATTCTT GCAAGTCAGTTTTCCATGGTATAAGGCTCTAACAGTCAGTATGGATTTAC TCATTCGAGTGTGAAACTTTTCGATCTGAATAACTTTTTTGTTTTCATTA GGTGGCGCACCAGAGACCAGGACAATATTCTTCTCCGAAGGTTCAACGAG TGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAACGTCAGGTCTAACCATG TCAAGTTACACGCAAAGTCACGCCTCTGTCAGTAAAAGTACACTGGATGC AATCCATGGACTGTCAATCAAATAGGGCTGTTGAAATAATGACAAACAAT CTATTATAATGCACTTATTGAAATGAAACGGAAAAAAGTTTCCCCGAAAA GTCAATGAGTACGAGAATATTTAGTCCGCACTTTATTGTCAGAACCNCTT CTTCCGAAAAGTCAATGAGTACGAGAATATTAAGTCCACCCTTTATTGTC AGAACCTTAAAATTGACGATTCTTCGTAAGATTCTTAGTTTTCTTTGAAA CATTTTTGTAAAGTCTTTATCTGCGACATTTTACTTCGAATTTAGTCTTT TTCAACCAGAGTTAGGGTCTTGACTTAAAATGATTTTAACAGAAAATAAA GGGGAGAAAATTGAAAATATTTAAGTTAAATTATACTCAGTAGAGAAATC TATTTTGATGTTTTTGTGTAAATGCGCGTATTGTATCATAAATTTTTTGT CAATTTTTTAGATGTAATATTACATTAGTAGAGAAATTTTTATTTCATGG CTTTTAATTCAATTTTTTAAGAAAGTCTTCGAAGACAAACATTTCAGTCG AATTTCCACACGTACAACGTTTCAAGGTCTCATTGATGGAGGTCCCTGAA ACTCAATTTTTAGATGTTGTTAGAAATCAAAATGTATAGAAAGTTTTTGT ACATGCATTTTAATTTTATGCTCAAGAAATACAAACTTCAAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000658XLOC_000658Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001213-exon-sc0000007-1575043694:1096522..1097129TCONS_00001213-exon-sc0000007-1575043694:1096522..1097129Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1091603..1091701TCONS_00001213-exon-sc0000007-1575043694:1091603..1091701Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1091437..1091466TCONS_00001213-exon-sc0000007-1575043694:1091437..1091466Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1091110..1091200TCONS_00001213-exon-sc0000007-1575043694:1091110..1091200Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1090917..1090990TCONS_00001213-exon-sc0000007-1575043694:1090917..1090990Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1090718..1090774TCONS_00001213-exon-sc0000007-1575043694:1090718..1090774Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1090455..1090493TCONS_00001213-exon-sc0000007-1575043694:1090455..1090493Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1089863..1089987TCONS_00001213-exon-sc0000007-1575043694:1089863..1089987Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1089429..1089568TCONS_00001213-exon-sc0000007-1575043694:1089429..1089568Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1088965..1089263TCONS_00001213-exon-sc0000007-1575043694:1088965..1089263Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1088534..1088755TCONS_00001213-exon-sc0000007-1575043694:1088534..1088755Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1575043694:1086988..1087828TCONS_00001213-exon-sc0000007-1575043694:1086988..1087828Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1096522..1097129TCONS_00001213-exon-sc0000007-1510915933:1096522..1097129Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1091603..1091701TCONS_00001213-exon-sc0000007-1510915933:1091603..1091701Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1091437..1091466TCONS_00001213-exon-sc0000007-1510915933:1091437..1091466Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1091110..1091200TCONS_00001213-exon-sc0000007-1510915933:1091110..1091200Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1090917..1090990TCONS_00001213-exon-sc0000007-1510915933:1090917..1090990Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1090718..1090774TCONS_00001213-exon-sc0000007-1510915933:1090718..1090774Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1090455..1090493TCONS_00001213-exon-sc0000007-1510915933:1090455..1090493Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1089863..1089987TCONS_00001213-exon-sc0000007-1510915933:1089863..1089987Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1089429..1089568TCONS_00001213-exon-sc0000007-1510915933:1089429..1089568Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1088965..1089263TCONS_00001213-exon-sc0000007-1510915933:1088965..1089263Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1088534..1088755TCONS_00001213-exon-sc0000007-1510915933:1088534..1088755Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1510915933:1086988..1087828TCONS_00001213-exon-sc0000007-1510915933:1086988..1087828Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1096522..1097129TCONS_00001213-exon-sc0000007-1491911889:1096522..1097129Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1091603..1091701TCONS_00001213-exon-sc0000007-1491911889:1091603..1091701Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1091437..1091466TCONS_00001213-exon-sc0000007-1491911889:1091437..1091466Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1091110..1091200TCONS_00001213-exon-sc0000007-1491911889:1091110..1091200Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1090917..1090990TCONS_00001213-exon-sc0000007-1491911889:1090917..1090990Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1090718..1090774TCONS_00001213-exon-sc0000007-1491911889:1090718..1090774Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1090455..1090493TCONS_00001213-exon-sc0000007-1491911889:1090455..1090493Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1089863..1089987TCONS_00001213-exon-sc0000007-1491911889:1089863..1089987Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1089429..1089568TCONS_00001213-exon-sc0000007-1491911889:1089429..1089568Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1088965..1089263TCONS_00001213-exon-sc0000007-1491911889:1088965..1089263Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1088534..1088755TCONS_00001213-exon-sc0000007-1491911889:1088534..1088755Clytia hemisphaericaexon
TCONS_00001213-exon-sc0000007-1491911889:1086988..1087828TCONS_00001213-exon-sc0000007-1491911889:1086988..1087828Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1086988..1097129 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
8.95843e-08 9.09993e-07 1.31119 5.7115e-08 5.97706 6.80658 1.0149 1.68407 0.999665 1.97944 1.04155 1.77933 15.749 14.0632 6.20045 7.53514 5.66691 4.51691 13.7972 12.331 8.34931 9.63253 6.47533 7.19969 6.59209 5.401 2.68684 1.11065 1.7516e-06 0.00039717
Blast
BLAST of TCONS_00001213 vs. Swiss-Prot (Human)
Match: MK15 (Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 2.708e-138
Identity = 201/345 (58.26%), Postives = 268/345 (77.68%), Query Frame = 3
Query:  543 MNTDIDQHILVRYEIKKRLGKGAYGIVWKGIDRKTGEIVALKKIFDAFRNQTDAQRTFREICFLQEFGSHDNVIKLLNVIKADNDKDIYLVFEFMDTDLHNVIKKGNILKDVHKRYIMYQLMKAINFIHSGNVIHRDLKPSNVLLDRECFIKVCDFGLARSVQCLTLEHGDPSLTDYVATRWYRAPEILLASPKYTKGVDMWSMGCILGEMLLGKPLFPGSSTLNQIERIMAVIPTPSRQDIDSIKSSYSTSLLDKATMRSRKNLPDLF-PDAPNDALDMVQSLLQFNPDKRMTAEEALAHPYLAKFHNPAEEHSLTYXXXXXXXXXXQLSVAEYRTKLYDSIMQ 1574
            M T +D  I+ RY ++++LG+GAYGIVWK +DR+TGE+VA+KKIFDAFR++TDAQRTFREI  LQEFG H N+I LL+VI+A+ND+DIYLVFEFMDTDL+ VI+KG +L+DVH R I YQL++A  F+HSG+V+HRD KPSNVLLD  C +K+CDFGLARS+  L     D ++T+YVATRWYRAPE+LL+S +YT GVDMWS+GCILGEML G+PLFPG+STL+Q+E I+  IP PS +D+ ++ S    S+L +   R R+ L  L  PD   +ALD+++ LL F PDKR++A +AL HPY+ +FH P++E +   DV P   + VQLSV EYR+++Y  I++
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILE 345          
The following BLAST results are available for this feature:
BLAST of TCONS_00001213 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MK152.708e-13858.26Mitogen-activated protein kinase 15 OS=Homo sapien... [more]
back to top