Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001208 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001208
Unique NameTCONS_00001208
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2436

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001208 ID=TCONS_00001208|Name=TCONS_00001208|organism=Clytia hemisphaerica|type=transcript|length=2436bp
GTTATTTTCTATCTTgctatgaaaaataaatatctttcaataaaatataa
ttgataataaaaagcCTGGTTTCCACAAGGCCCAGCAACTTGTTATCAAC
AATTTGAAAAGATTAtaaccagacgatgtcaatcgaacggaatcgaacga
aaattccaatcgaatcaatcgaacgcaatcgaatgcaatcgaatgattgc
gaacgcaatcgaatataaACGGGGAGTATCTCcatcaattttatcaattt
tattggGCAACTTCTTCTCCTCTGTTTATCATGGCGTCTCTTTTGCTGAA
CTACAAATACCTCTCAAAAAACCAGCTCTCAGGCTTTGACAACTATAAGT
ATTCCTCAATCGATACCTCACCTTTATCCAAATATGTGATGCACCCATTC
TGGGACCAACTTGTAAAGGTTTGTCCACTATGGTTCCCAGCAAATTTATT
GACATTAATTGGATGGTTGCTTTCTTTATTCATGTTCATCTTACTAAGTT
ATTATGATCCAAACTTCAGTGCTATCAGTCAGAATGTCCCTCGTTGGGTA
TGGCTTGTTGGTGCTGTCTGTATTTTTTGCTCTCATCAATTTGATGGCAT
TGATGGAAAACAAGCTAGAAGGACAAAATCAGGATCACCACTGGGAGAAC
TGTTTGATCATGGTTGTGATAGTAGCATTGTATCTTTCATGGCAATTGGA
ATCTTTTCCTGCTTTGGTGTCAGTACAGCAACAGCATCTGAGCTGGAACT
TTTCTTTGTCGCTGTTGTTgtgttttatgcattttattTCTCGCACTGGG
AAAAATACACAACAAATGTTATGTATTTGCCTTGGGCGTATGATATTTCA
CAAATTtggTTATCAATATGTTTTTTCGCAACATATTTGTATGGTCCTGA
ACTGTGGAGAACAGTTGTCTACCAAGATTATTCTATCACTCAAGTTCTGA
AAGTTACATTATATACCGCTGCACCATGTCTGTGTGTTCCAATGAGCATT
TATAATCAATATGTGGCACGAAGAGACAGACCAGAAAAATGTGTCAGTTT
CTTAGAAGGATTGATGCCAATGTTGAGCTTAACTTCAGTCACTTTGGTCT
ATCTCTACTTTGGATACTTTTCACATGCTGACATTTTCTACACTAATCTG
AGATTGTATGCAATCACATATGGAATCATCTACGCAAATCTGAATTGTCG
CCTGATCATAGCACAGATGACCAATTCCCAGTGTGATCGCTTCAACATTT
TGGCATACCCACTCTTCCCTATGATTGTGTGCAGTCAATTAAAACTGGTC
AATGATAATAAAATGCTAGCTGTGTATTTTGCTTTTGTTGTTTTGGGCCA
TATACACTATGGTGTCAATGTGGTTCGTCAATTAGCAGATCATTTGAATG
TGTATGTTTTCAAAATCGGTAAAAAACCTGTCAAAGCAGTAAATGGTCAT
GCGTACACCAACGGACACTCAAATGGAATAAAAGCTAATGGAAAAGTTGC
CCAAGACTGAAATTGAAGATGAAGTCTTTGAATTTCCTCTTATTAAAGGA
AGAGCCAGCATGAATCCCAAGTGATGGTAGGGAAAATTCTTTCGACCCAT
GAATTGGTTACttgatgatatttttatttgctcacaaaattttattttga
attttaacatAATTAGATCCTAACAAACAGATTTGTCCAGCTTCGTCATG
AACGAGATCCGGGTAGAGtcctttttatcattttttaatttgtatACAGT
GTGTGTCTGAAATCTCAGCCCAACTTCGCTGGTTTTTGTTTACATAAGCA
AGGATCCTTGTACTTACACGGTATCAGGTGATGAGATCTGAGCATATACT
CACTATGTTTTGAAATAGTTTATAAAATAACAACATATTTGATTGTATAT
GATCTTTTGTAAATATCTTTTGGTCATCAGAGAGTTTTTTAACACCACAT
GGAGTTCAGAGCCTAGTTCATCGTTTGAGTGAGAGATTGTAGCTCTTTCC
AATAATTTCTTTCATCTTTTTATCATCTATTGCTTTTACCCTTCAagtca
aactattttttcagtTTCACGCCTTCTTCGTtcgattttattgaatttac
aGACTTTACCATGCAGTACCATAACAAATATTTGTCACCCTTATATTTTA
GCGGCTAGTATTCTGgaaatttgattgattttattttcttactttttctc
tttatttattcttttttgCTTTGTTCGTTTTTGCTTTGTTCGTTTTCCCA
CTCACCAGAATATTCAAGTTATTTAttaagaatttgaagaaaaataatct
tgGATGATATTTAAAGGTCATATAATAGTTATATAATAGTTTTCATGTTC
AGTTTATTatagtttttgaaatcttgTGTATTGTGCCATAAATGCGATCA
ATTAACAAACATTTACGAGGAAAATCATGTTTTCTT
Run BLAST on NCBI

protein sequence of TCONS_00001208-protein

>TCONS_00001208-protein ID=TCONS_00001208-protein|Name=TCONS_00001208-protein|organism=Clytia hemisphaerica|type=polypeptide|length=409bp
MASLLLNYKYLSKNQLSGFDNYKYSSIDTSPLSKYVMHPFWDQLVKVCPL
WFPANLLTLIGWLLSLFMFILLSYYDPNFSAISQNVPRWVWLVGAVCIFC
SHQFDGIDGKQARRTKSGSPLGELFDHGCDSSIVSFMAIGIFSCFGVSTA
TASELELFFVAVVVFYAFYFSHWEKYTTNVMYLPWAYDISQIWLSICFFA
TYLYGPELWRTVVYQDYSITQVLKVTLYTAAPCLCVPMSIYNQYVARRDR
PEKCVSFLEGLMPMLSLTSVTLVYLYFGYFSHADIFYTNLRLYAITYGII
YANLNCRLIIAQMTNSQCDRFNILAYPLFPMIVCSQLKLVNDNKMLAVYF
AFVVLGHIHYGVNVVRQLADHLNVYVFKIGKKPVKAVNGHAYTNGHSNGI
KANGKVAQD
Run BLAST on NCBI

transcript from alignment at sc0000007:1020382..1027106-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001208 ID=TCONS_00001208|Name=TCONS_00001208|organism=Clytia hemisphaerica|type=transcript|length=6725bp|location=Sequence derived from alignment at sc0000007:1020382..1027106- (Clytia hemisphaerica)
GTTATTTTCTATCTTGCTATGAAAAATAAATATCTTTCAATAAAATATAA TTGATAATAAAAAGCCTGGTTTCCACAAGGCCCAGCAACTTGTTATCAAC AATTTGAAAAGATTATAACCAGACGATGTCAATCGAACGGAATCGAACGA AAATTCCAATCGAATCAATCGAACGCAATCGAATGCAATCGAATGATTGC GAACGCAATCGAATATAAACGGGGAGTATCTCCATCAATTTTATCAATTT TATTGGGCAACTTCTTCTCCTCTGTTTATCATGGCGTCTCTTTTGCTGAA CTACAAATACCTCTCAAAAAACCAGCTCTCAGGCTTTGACAACTATAAGG TAGGCATGTTCTATTTTCAAAGTTAATATTTAAATAACATAGTCTAATTA TTGTTTTTTCATAATTGCTAAGTTTGAAAGAGGGTTCCAGCAGGGCGGCA GCGGCTAAACCCGCGATCGAGAGAAGGGGTAGAGAGAACGGAGTAGACTC AAGGTAAGCGATCAACCTAGCATAGGGGTGATGTATGTTAGCCCCTCTAA GGGTGTGTTATTCAGACTACTGGAAATGCACTGTAAGGGTCAAACAAATA CCGTGAGATTGGGTAAGGCGGTCATCGAAAAAATGCTCTGTTCGCGAGGA CCCTGCCGACGCACCGGACTGTCCGGTGTATTTGTCCGGTGGCAAAAAGT ATCCTTTCGCTACACCGGACGCAATAAGTCCGGTGTTGCATACAGGGAAT TTTGAACCGGGAATGTTTTTGACAGCCCGTCCGCCCTCCGCCCATATGCA TTTTTAACACCCGTTGCGACGCGAACAAGGACCCTGCCGACGCATCAGAC TTAATGAACACTGGACTTAATGAACACCGAACACGCGAAAGTCTGGTGTG AAAAGATAATTTTTTTAACCACCGGACAATTTCTACACCGGACTTTTAAG CAGACCCGATCAATCGAACTTGTCGAACCAATCGAACAATCGAACTAATC GAACTTCATCGAACGATTAAAGTTCGATTAAAAAAATTAATCGAACTCTA GGATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACCGTATATTAGCTT CTTTTCAAAGCCAAATTCGGAATGTAAATCGGGAAATTCTTCCGATAACG GATTACACACTTTTCCTGTATCCTTTTAGCGCCAGAGCAGAGGCGGTTTG TTGGGGCATAGCATTCCGCCACTCGGCCGCGCGCGAAATCGCAACAGAGG GGCTACGGACTTTATTCCGGATAGACAAATATCCGGGTACAATAAACGTC AATCTGTTAAGTCTGGGAACTGTCGAAATGGCAATCGCGTGCCAGGACAA GTTTTTGCAAGCGAGGGAAGATATGAGGATTTAATATCATCGAACTAATC GAACTTTTTACTGACCGAACTAATCGAACTGCTATTGCTTCNNNNNNNNN NNNGGTTCGACTAATTTTTTTAATCGAACTTTAATCGTTCGATGGAGTTC GATTAGTTCGATTGTTCGATTGGTTCGACAAGTTCGATTGATCGGGTCTG GACTTAAGAATGTTCGGTGTCGGAGAAGGATATTTTTTCCCGCTGGACAA TCAAAACACCGGACATGACCAGTCCGGTGCGTCCGGTGTTTCTTAATTTT TTGTTTCATAAATGTCCAGCGTCCAAAATTCCCTGTATGCAACACCGGAC TGACACCAGACTTATTGCGCCTGGTGTAGCGAAAGGATACTTTTTGCCAC CGGACAAATACACCGGACAGTCCGGTGCGTCGGCAGGGTTCTCCCCGTAC ATTGTACGGTGTCAACCTATTTTGACCACCGTACAAGGTATGGTGGTGGG AGCTATTCCTTAAAGATTTATTCCCACCGTAAAAAGTCAAAAGCTACATA CCTGCTGGTTCTCTTCGTCCATAGATCTGTTTATTTTTAATATTCTAGGT ACATTTTTGTTTTGGTAAATGAATCTAAGAAGTTGTTTAGTTTTAGAATT GAATACAATAGTATAAGAATGAACACACTACTTTCAATTTTGAAACTAGA AAGAAACTTTGGTCTGAGAAAACAAACCACCCGAAAAAAGATTGAATGTG ATCAGACTTACTTAATTGTTTTCTGAAACAGAGACGGATTTTTTAAAGAC TGCAGTTGACCAGGGAAACGCATTTTTACGAGCAATTCGAAAGCGGTCCC CTTGGCCGCCTTGAAGCGGTAGAAAAACGCCACTGTACATCGTCCGGTAG GAAAATTAATGTACGGTGTTTTGGCATTCTAACCTAAAATCCCAGGGGAC AACATCATACAATGTACGGCGTGTCCAGGGTCGTACAGGGTGTTTCTTGC AACAAGAAAAAAATGGAAATAGTACAATTTCTGCATTCAACAGAACAAAC AAAATTCCAAGATGGTGGGCAGCGAGTGAATAAAAAGAGAAGCGAGAAAA AAAACTGTTTTTGTTTAGGATAGCTTTCCTTTATCAAGACACAAGAGGTG ATTTCACATGGGATTTTCATGAGAGTGAGGCTGGGCTTAAAAAATTGTTG GTTTGCCGTCACCCAACCCCAGATTTTGGAGGTGGGTCGGTCGGTCGGAA TTTTTTTTTATTTTGGAGATTTATGAAATTTTCATCCATGGAAGGGTTAA CAGTTTGTTTACATTTAGGTAATTTTGAATAAAAAACAGAAGTGCTAGCA GGGAATTTACGATTCTTATGCTTGAGACAAACAAGATACAAGTTTTTCTT TTTTATTGTTTGAAGTTTTTGAAGGAAAAAAAATCTTCTTTAAAATGGCA ATAAAATTTTTTGGGTTTTGGGGAATCATCGTAAACAAAGCCATTCTAAA TGACTTATACCAAAAGCCCGTTCCTTTGTTTTGAAAATCCAAGAAACCTA ATCTTCTAATGTGTTTAGGGAGTCCATTTACAGTGGTTTAGAGAAAAGAT TTTTTTTCCTATTTCAGTCTCCTTGCTTTGTGTGCATGGTTTTGATGAAA TTTGGATTTAATTGATGAAATTTCTGTATTTATATTGTTTTGTAGTATTC CTCAATCGATACCTCACCTTTATCCAAATATGTGATGCACCCATTCTGGG ACCAACTTGTAAAGGTGAGTTATAATCAACTACTATTCAAGAGATGTCAC CTAGAATCATCTTTTTAAGAGACTGTTTGTATTTTTGTTCCTTGAATAAG AGCTAAATAGAATAACTTGTTTAACTTTGTCATTTATGGACTTACCTAAT TGTGAAGTGGTCAAATTAAATTCACTTTGATTATGTATATTATTGTGGAC GTCAGCCAATTTAAGTGGTTAAATCAAAACAAATGTGTGGAGGAAATAAG AACAGGCTAAAGAGCAGTACCCCCGGTGAAACAAAAGAATTGCATCGCTA GTTTTCATAGTTTTCAGTTATGCCCATAGATTAGGAATTATTATCTTGAA AAAACTAAAAATATTTTAAAAAATGTTCCCTCATAGGTTTGTCCACTATG GTTCCCAGCAAATTTATTGACATTAATTGGATGGTTGCTTTCTTTATTCA TGTTCATCTTACTAAGTTATTATGATCCAAACTTCAGTGCTATCAGTCAG AATGTCCCTCGTTGGGTATGGCTTGTTGGTGCTGTCTGTATTTTTTGCTC TCATCAATTTGATGGCATTGATGGAAAACAAGCTAGAAGGACAAAATCAG GGTAAGAAATTTTAATGAGTACTCTTTTCATTACAAATTACAAATTAACC TTTAGTTAACGTTGAAAATTTGATGATGAATCTCTAATTCATCTTTCTGT TCAAAATATTTATGATATTTTTTATTTCCGTATTTCAACTTGATTAACTC TGACTGGGTTAGAGGATGAGAAAATTCTAAGTAAAAGACTTTTTAATTAT AGATCACCACTGGGAGAACTGTTTGATCATGGTTGTGATAGTAGCATTGT ATCTTTCATGGCAATTGGAATCTTTTCCTGCTTTGGTGTCAGTACAGCAA CAGCATCTGAGCTGGAACTTTTCTTTGTCGCTGTTGTTGTGTTTTATGCA TTTTATTTCTCGCACTGGGAAAAATACACAACAAATGTTATGTATTTGCC TTGGGCGTATGATATTTCACAAATTGTAAGTGTTAATTTCATATCATTTT TGAAAAAACGTTTTCCTGAAAACACATTACCTACTCTTATTAACCCATTT CTTACCAGTAACTTGATTTAGTTTGCTATAAATCTTCTGATAATATGTCT GTCAAACAATTTAAAGATTTTGAAAGTGTTAACGTTGAAAATGTAGAAAT CTACTCACCAGACTGAAAAGCCTTTTTTTTTTATTTCAGTGGTTATCAAT ATGTTTTTTCGCAACATATTTGTATGGTCCTGAACTGTGGAGAACAGTTG TCTACCAAGATTATTCTATCACTCAAGTTCTGAAAGTTACATTATATAGT AAGAATTATTTTGAATTCAGCTCAAAATAAGAAACCTTTTTGGGGATAGT AAGTAGTAAGGGTTAAGAGTAAGAATCACAAATATCATGATAGATTGATC ACTTCCTTTTCTAATTATTACAGCCGCTGCACCATGTCTGTGTGTTCCAA TGAGCATTTATAATCAATATGTGTAAGTAATGACTTGAGATTTTTCTAAC TTTGAATCAGCTCTCGTATTCTCTAATCAAAAAACAGCTGAGGCTGAACT AGATTTTCTTGTTTTACTGTTTCTTAAACTATGCATAATGATAACTTCTA GTATAACCTTGTACAACCAAATTTGGAAGTTAATGTTAACACTTTTCTAA CAATCGTTGTTTCAGGGCACGAAGAGACAGACCAGAAAAATGTGTCAGTT TCTTAGAAGGATTGATGCCAATGTTGAGCTTAACTTCAGTCACTTTGGTC TATCTCTACTTTGGATACTTTTCACATGCTGACATTTTCTACACTAATCT GAGATTGTATGCAATCACATATGGAATCATCTACGCAAATCTGAATGTAA GAATTTGTATCATTTATTCTTGTTCTCGGTTTCCATATCGCCTTATCGTG GGTTTATTCTGAGATACCAATGTTTCTCCAGTATAGCTGTTGTTTTCAAA AACAACATAACATTACATTTGAATAATTTTAATATTTTAATATTTATCAG AATTTTATTTTCATTTATCTTTGTAGTGTCGCCTGATCATAGCACAGATG ACCAATTCCCAGTGTGATCGCTTCAACATTTTGGCATACCCACTCTTCCC TATGATTGTGTGCAGTCAATTAAAACTGGTCAATGATAATAAAATGCTAG CTGTGTATTTTGCTTTTGTTGTTTTGGGCCATATACACTATGGTGTCAAT GTGGTAAGCAAAAGTTTAAAAAAATTTGGATCAAACTTGGATCCCTTGAT ATAGATTTGACGCTTTTCTTTTTAGGAACCATTTCTTTGATAAAATTTCT TTTCGTTTCAGGTTCGTCAATTAGCAGATCATTTGAATGTGTATGTTTTC AAAATCGGTAAAAAACCTGTCAAAGCAGTAAATGGTCATGCGTACACCAA CGGACACTCAAATGGAATAAAAGCTAATGGAAAAGTTGCCCAAGACTGAA ATTGAAGATGAAGTCTTTGAATTTCCTCTTATTAAAGGAAGAGCCAGCAT GAATCCCAAGTGATGGTAGGGAAAATTCTTTCGACCCATGAATTGGTTAC TTGATGATATTTTTATTTGCTCACAAAATTTTATTTTGAATTTTAACATA ATTAGATCCTAACAAACAGATTTGTCCAGCTTCGTCATGAACGAGATCCG GGTAGAGTCCTTTTTATCATTTTTTAATTTGTATACAGTGTGTGTCTGAA ATCTCAGCCCAACTTCGCTGGTTTTTGTTTACATAAGCAAGGATCCTTGT ACTTACACGGTATCAGGTGATGAGATCTGAGCATATACTCACTATGTTTT GAAATAGTTTATAAAATAACAACATATTTGATTGTATATGATCTTTTGTA AATATCTTTTGGTCATCAGAGAGTTTTTTAACACCACATGGAGTTCAGAG CCTAGTTCATCGTTTGAGTGAGAGATTGTAGCTCTTTCCAATAATTTCTT TCATCTTTTTATCATCTATTGCTTTTACCCTTCAAGTCAAACTATTTTTT CAGTTTCACGCCTTCTTCGTTCGATTTTATTGAATTTACAGACTTTACCA TGCAGTACCATAACAAATATTTGTCACCCTTATATTTTAGCGGCTAGTAT TCTGGAAATTTGATTGATTTTATTTTCTTACTTTTTCTCTTTATTTATTC TTTTTTGCTTTGTTCGTTTTTGCTTTGTTCGTTTTCCCACTCACCAGAAT ATTCAAGTTATTTATTAAGAATTTGAAGAAAAATAATCTTGGATGATATT TAAAGGTCATATAATAGTTATATAATAGTTTTCATGTTCAGTTTATTATA GTTTTTGAAATCTTGTGTATTGTGCCATAAATGCGATCAATTAACAAACA TTTACGAGGAAAATCATGTTTTCTT

Coding sequence (CDS) from alignment at sc0000007:1020382..1027106-

>TCONS_00001208 ID=TCONS_00001208|Name=TCONS_00001208|organism=Clytia hemisphaerica|type=CDS|length=11070bp|location=Sequence derived from alignment at sc0000007:1020382..1027106- (Clytia hemisphaerica)
GTTCGTCAATTAGCAGATCATTTGAATGTGTATGTTTTCAAAATCGGTAA
AAAACCTGTCAAAGCAGTAAATGGTCATGCGTACACCAACGGACACTCAA
ATGGAATAAAAGCTAATGGAAAAGTTGCCCAAGACTGATGTCGCCTGATC
ATAGCACAGATGACCAATTCCCAGTGTGATCGCTTCAACATTTTGGCATA
CCCACTCTTCCCTATGATTGTGTGCAGTCAATTAAAACTGGTCAATGATA
ATAAAATGCTAGCTGTGTATTTTGCTTTTGTTGTTTTGGGCCATATACAC
TATGGTGTCAATGTGGGCACGAAGAGACAGACCAGAAAAATGTGTCAGTT
TCTTAGAAGGATTGATGCCAATGTTGAGCTTAACTTCAGTCACTTTGGTC
TATCTCTACTTTGGATACTTTTCACATGCTGACATTTTCTACACTAATCT
GAGATTGTATGCAATCACATATGGAATCATCTACGCAAATCTGAATCCGC
TGCACCATGTCTGTGTGTTCCAATGAGCATTTATAATCAATATGTTGGTT
ATCAATATGTTTTTTCGCAACATATTTGTATGGTCCTGAACTGTGGAGAA
CAGTTGTCTACCAAGATTATTCTATCACTCAAGTTCTGAAAGTTACATTA
TATAATCACCACTGGGAGAACTGTTTGATCATGGTTGTGATAGTAGCATT
GTATCTTTCATGGCAATTGGAATCTTTTCCTGCTTTGGTGTCAGTACAGC
AACAGCATCTGAGCTGGAACTTTTCTTTGTCGCTGTTGTTGTGTTTTATG
CATTTTATTTCTCGCACTGGGAAAAATACACAACAAATGTTATGTATTTG
CCTTGGGCGTATGATATTTCACAAATTGTTTGTCCACTATGGTTCCCAGC
AAATTTATTGACATTAATTGGATGGTTGCTTTCTTTATTCATGTTCATCT
TACTAAGTTATTATGATCCAAACTTCAGTGCTATCAGTCAGAATGTCCCT
CGTTGGGTATGGCTTGTTGGTGCTGTCTGTATTTTTTGCTCTCATCAATT
TGATGGCATTGATGGAAAACAAGCTAGAAGGACAAAATCAGGTATTCCTC
AATCGATACCTCACCTTTATCCAAATATGTGATGCACCCATTCTGGGACC
AACTTGTAAAGATGGCGTCTCTTTTGCTGAACTACAAATACCTCTCAAAA
AACCAGCTCTCAGGCTTTGACAACTATAAGGTTCGTCAATTAGCAGATCA
TTTGAATGTGTATGTTTTCAAAATCGGTAAAAAACCTGTCAAAGCAGTAA
ATGGTCATGCGTACACCAACGGACACTCAAATGGAATAAAAGCTAATGGA
AAAGTTGCCCAAGACTGATGTCGCCTGATCATAGCACAGATGACCAATTC
CCAGTGTGATCGCTTCAACATTTTGGCATACCCACTCTTCCCTATGATTG
TGTGCAGTCAATTAAAACTGGTCAATGATAATAAAATGCTAGCTGTGTAT
TTTGCTTTTGTTGTTTTGGGCCATATACACTATGGTGTCAATGTGGGCAC
GAAGAGACAGACCAGAAAAATGTGTCAGTTTCTTAGAAGGATTGATGCCA
ATGTTGAGCTTAACTTCAGTCACTTTGGTCTATCTCTACTTTGGATACTT
TTCACATGCTGACATTTTCTACACTAATCTGAGATTGTATGCAATCACAT
ATGGAATCATCTACGCAAATCTGAATCCGCTGCACCATGTCTGTGTGTTC
CAATGAGCATTTATAATCAATATGTTGGTTATCAATATGTTTTTTCGCAA
CATATTTGTATGGTCCTGAACTGTGGAGAACAGTTGTCTACCAAGATTAT
TCTATCACTCAAGTTCTGAAAGTTACATTATATAATCACCACTGGGAGAA
CTGTTTGATCATGGTTGTGATAGTAGCATTGTATCTTTCATGGCAATTGG
AATCTTTTCCTGCTTTGGTGTCAGTACAGCAACAGCATCTGAGCTGGAAC
TTTTCTTTGTCGCTGTTGTTGTGTTTTATGCATTTTATTTCTCGCACTGG
GAAAAATACACAACAAATGTTATGTATTTGCCTTGGGCGTATGATATTTC
ACAAATTGTTTGTCCACTATGGTTCCCAGCAAATTTATTGACATTAATTG
GATGGTTGCTTTCTTTATTCATGTTCATCTTACTAAGTTATTATGATCCA
AACTTCAGTGCTATCAGTCAGAATGTCCCTCGTTGGGTATGGCTTGTTGG
TGCTGTCTGTATTTTTTGCTCTCATCAATTTGATGGCATTGATGGAAAAC
AAGCTAGAAGGACAAAATCAGGTATTCCTCAATCGATACCTCACCTTTAT
CCAAATATGTGATGCACCCATTCTGGGACCAACTTGTAAAGATGGCGTCT
CTTTTGCTGAACTACAAATACCTCTCAAAAAACCAGCTCTCAGGCTTTGA
CAACTATAAGGTTCGTCAATTAGCAGATCATTTGAATGTGTATGTTTTCA
AAATCGGTAAAAAACCTGTCAAAGCAGTAAATGGTCATGCGTACACCAAC
GGACACTCAAATGGAATAAAAGCTAATGGAAAAGTTGCCCAAGACTGATG
TCGCCTGATCATAGCACAGATGACCAATTCCCAGTGTGATCGCTTCAACA
TTTTGGCATACCCACTCTTCCCTATGATTGTGTGCAGTCAATTAAAACTG
GTCAATGATAATAAAATGCTAGCTGTGTATTTTGCTTTTGTTGTTTTGGG
CCATATACACTATGGTGTCAATGTGGGCACGAAGAGACAGACCAGAAAAA
TGTGTCAGTTTCTTAGAAGGATTGATGCCAATGTTGAGCTTAACTTCAGT
CACTTTGGTCTATCTCTACTTTGGATACTTTTCACATGCTGACATTTTCT
ACACTAATCTGAGATTGTATGCAATCACATATGGAATCATCTACGCAAAT
CTGAATCCGCTGCACCATGTCTGTGTGTTCCAATGAGCATTTATAATCAA
TATGTTGGTTATCAATATGTTTTTTCGCAACATATTTGTATGGTCCTGAA
CTGTGGAGAACAGTTGTCTACCAAGATTATTCTATCACTCAAGTTCTGAA
AGTTACATTATATAATCACCACTGGGAGAACTGTTTGATCATGGTTGTGA
TAGTAGCATTGTATCTTTCATGGCAATTGGAATCTTTTCCTGCTTTGGTG
TCAGTACAGCAACAGCATCTGAGCTGGAACTTTTCTTTGTCGCTGTTGTT
GTGTTTTATGCATTTTATTTCTCGCACTGGGAAAAATACACAACAAATGT
TATGTATTTGCCTTGGGCGTATGATATTTCACAAATTGTTTGTCCACTAT
GGTTCCCAGCAAATTTATTGACATTAATTGGATGGTTGCTTTCTTTATTC
ATGTTCATCTTACTAAGTTATTATGATCCAAACTTCAGTGCTATCAGTCA
GAATGTCCCTCGTTGGGTATGGCTTGTTGGTGCTGTCTGTATTTTTTGCT
CTCATCAATTTGATGGCATTGATGGAAAACAAGCTAGAAGGACAAAATCA
GGTATTCCTCAATCGATACCTCACCTTTATCCAAATATGTGATGCACCCA
TTCTGGGACCAACTTGTAAAGATGGCGTCTCTTTTGCTGAACTACAAATA
CCTCTCAAAAAACCAGCTCTCAGGCTTTGACAACTATAAGGTTCGTCAAT
TAGCAGATCATTTGAATGTGTATGTTTTCAAAATCGGTAAAAAACCTGTC
AAAGCAGTAAATGGTCATGCGTACACCAACGGACACTCAAATGGAATAAA
AGCTAATGGAAAAGTTGCCCAAGACTGATGTCGCCTGATCATAGCACAGA
TGACCAATTCCCAGTGTGATCGCTTCAACATTTTGGCATACCCACTCTTC
CCTATGATTGTGTGCAGTCAATTAAAACTGGTCAATGATAATAAAATGCT
AGCTGTGTATTTTGCTTTTGTTGTTTTGGGCCATATACACTATGGTGTCA
ATGTGGGCACGAAGAGACAGACCAGAAAAATGTGTCAGTTTCTTAGAAGG
ATTGATGCCAATGTTGAGCTTAACTTCAGTCACTTTGGTCTATCTCTACT
TTGGATACTTTTCACATGCTGACATTTTCTACACTAATCTGAGATTGTAT
GCAATCACATATGGAATCATCTACGCAAATCTGAATCCGCTGCACCATGT
CTGTGTGTTCCAATGAGCATTTATAATCAATATGTTGGTTATCAATATGT
TTTTTCGCAACATATTTGTATGGTCCTGAACTGTGGAGAACAGTTGTCTA
CCAAGATTATTCTATCACTCAAGTTCTGAAAGTTACATTATATAATCACC
ACTGGGAGAACTGTTTGATCATGGTTGTGATAGTAGCATTGTATCTTTCA
TGGCAATTGGAATCTTTTCCTGCTTTGGTGTCAGTACAGCAACAGCATCT
GAGCTGGAACTTTTCTTTGTCGCTGTTGTTGTGTTTTATGCATTTTATTT
CTCGCACTGGGAAAAATACACAACAAATGTTATGTATTTGCCTTGGGCGT
ATGATATTTCACAAATTGTTTGTCCACTATGGTTCCCAGCAAATTTATTG
ACATTAATTGGATGGTTGCTTTCTTTATTCATGTTCATCTTACTAAGTTA
TTATGATCCAAACTTCAGTGCTATCAGTCAGAATGTCCCTCGTTGGGTAT
GGCTTGTTGGTGCTGTCTGTATTTTTTGCTCTCATCAATTTGATGGCATT
GATGGAAAACAAGCTAGAAGGACAAAATCAGGTATTCCTCAATCGATACC
TCACCTTTATCCAAATATGTGATGCACCCATTCTGGGACCAACTTGTAAA
GATGGCGTCTCTTTTGCTGAACTACAAATACCTCTCAAAAAACCAGCTCT
CAGGCTTTGACAACTATAAGGTTCGTCAATTAGCAGATCATTTGAATGTG
TATGTTTTCAAAATCGGTAAAAAACCTGTCAAAGCAGTAAATGGTCATGC
GTACACCAACGGACACTCAAATGGAATAAAAGCTAATGGAAAAGTTGCCC
AAGACTGATGTCGCCTGATCATAGCACAGATGACCAATTCCCAGTGTGAT
CGCTTCAACATTTTGGCATACCCACTCTTCCCTATGATTGTGTGCAGTCA
ATTAAAACTGGTCAATGATAATAAAATGCTAGCTGTGTATTTTGCTTTTG
TTGTTTTGGGCCATATACACTATGGTGTCAATGTGGGCACGAAGAGACAG
ACCAGAAAAATGTGTCAGTTTCTTAGAAGGATTGATGCCAATGTTGAGCT
TAACTTCAGTCACTTTGGTCTATCTCTACTTTGGATACTTTTCACATGCT
GACATTTTCTACACTAATCTGAGATTGTATGCAATCACATATGGAATCAT
CTACGCAAATCTGAATCCGCTGCACCATGTCTGTGTGTTCCAATGAGCAT
TTATAATCAATATGTTGGTTATCAATATGTTTTTTCGCAACATATTTGTA
TGGTCCTGAACTGTGGAGAACAGTTGTCTACCAAGATTATTCTATCACTC
AAGTTCTGAAAGTTACATTATATAATCACCACTGGGAGAACTGTTTGATC
ATGGTTGTGATAGTAGCATTGTATCTTTCATGGCAATTGGAATCTTTTCC
TGCTTTGGTGTCAGTACAGCAACAGCATCTGAGCTGGAACTTTTCTTTGT
CGCTGTTGTTGTGTTTTATGCATTTTATTTCTCGCACTGGGAAAAATACA
CAACAAATGTTATGTATTTGCCTTGGGCGTATGATATTTCACAAATTGTT
TGTCCACTATGGTTCCCAGCAAATTTATTGACATTAATTGGATGGTTGCT
TTCTTTATTCATGTTCATCTTACTAAGTTATTATGATCCAAACTTCAGTG
CTATCAGTCAGAATGTCCCTCGTTGGGTATGGCTTGTTGGTGCTGTCTGT
ATTTTTTGCTCTCATCAATTTGATGGCATTGATGGAAAACAAGCTAGAAG
GACAAAATCAGGTATTCCTCAATCGATACCTCACCTTTATCCAAATATGT
GATGCACCCATTCTGGGACCAACTTGTAAAGATGGCGTCTCTTTTGCTGA
ACTACAAATACCTCTCAAAAAACCAGCTCTCAGGCTTTGACAACTATAAG
GTTCGTCAATTAGCAGATCATTTGAATGTGTATGTTTTCAAAATCGGTAA
AAAACCTGTCAAAGCAGTAAATGGTCATGCGTACACCAACGGACACTCAA
ATGGAATAAAAGCTAATGGAAAAGTTGCCCAAGACTGATGTCGCCTGATC
ATAGCACAGATGACCAATTCCCAGTGTGATCGCTTCAACATTTTGGCATA
CCCACTCTTCCCTATGATTGTGTGCAGTCAATTAAAACTGGTCAATGATA
ATAAAATGCTAGCTGTGTATTTTGCTTTTGTTGTTTTGGGCCATATACAC
TATGGTGTCAATGTGGGCACGAAGAGACAGACCAGAAAAATGTGTCAGTT
TCTTAGAAGGATTGATGCCAATGTTGAGCTTAACTTCAGTCACTTTGGTC
TATCTCTACTTTGGATACTTTTCACATGCTGACATTTTCTACACTAATCT
GAGATTGTATGCAATCACATATGGAATCATCTACGCAAATCTGAATCCGC
TGCACCATGTCTGTGTGTTCCAATGAGCATTTATAATCAATATGTTGGTT
ATCAATATGTTTTTTCGCAACATATTTGTATGGTCCTGAACTGTGGAGAA
CAGTTGTCTACCAAGATTATTCTATCACTCAAGTTCTGAAAGTTACATTA
TATAATCACCACTGGGAGAACTGTTTGATCATGGTTGTGATAGTAGCATT
GTATCTTTCATGGCAATTGGAATCTTTTCCTGCTTTGGTGTCAGTACAGC
AACAGCATCTGAGCTGGAACTTTTCTTTGTCGCTGTTGTTGTGTTTTATG
CATTTTATTTCTCGCACTGGGAAAAATACACAACAAATGTTATGTATTTG
CCTTGGGCGTATGATATTTCACAAATTGTTTGTCCACTATGGTTCCCAGC
AAATTTATTGACATTAATTGGATGGTTGCTTTCTTTATTCATGTTCATCT
TACTAAGTTATTATGATCCAAACTTCAGTGCTATCAGTCAGAATGTCCCT
CGTTGGGTATGGCTTGTTGGTGCTGTCTGTATTTTTTGCTCTCATCAATT
TGATGGCATTGATGGAAAACAAGCTAGAAGGACAAAATCAGGTATTCCTC
AATCGATACCTCACCTTTATCCAAATATGTGATGCACCCATTCTGGGACC
AACTTGTAAAGATGGCGTCTCTTTTGCTGAACTACAAATACCTCTCAAAA
AACCAGCTCTCAGGCTTTGACAACTATAAGGTTCGTCAATTAGCAGATCA
TTTGAATGTGTATGTTTTCAAAATCGGTAAAAAACCTGTCAAAGCAGTAA
ATGGTCATGCGTACACCAACGGACACTCAAATGGAATAAAAGCTAATGGA
AAAGTTGCCCAAGACTGATGTCGCCTGATCATAGCACAGATGACCAATTC
CCAGTGTGATCGCTTCAACATTTTGGCATACCCACTCTTCCCTATGATTG
TGTGCAGTCAATTAAAACTGGTCAATGATAATAAAATGCTAGCTGTGTAT
TTTGCTTTTGTTGTTTTGGGCCATATACACTATGGTGTCAATGTGGGCAC
GAAGAGACAGACCAGAAAAATGTGTCAGTTTCTTAGAAGGATTGATGCCA
ATGTTGAGCTTAACTTCAGTCACTTTGGTCTATCTCTACTTTGGATACTT
TTCACATGCTGACATTTTCTACACTAATCTGAGATTGTATGCAATCACAT
ATGGAATCATCTACGCAAATCTGAATCCGCTGCACCATGTCTGTGTGTTC
CAATGAGCATTTATAATCAATATGTTGGTTATCAATATGTTTTTTCGCAA
CATATTTGTATGGTCCTGAACTGTGGAGAACAGTTGTCTACCAAGATTAT
TCTATCACTCAAGTTCTGAAAGTTACATTATATAATCACCACTGGGAGAA
CTGTTTGATCATGGTTGTGATAGTAGCATTGTATCTTTCATGGCAATTGG
AATCTTTTCCTGCTTTGGTGTCAGTACAGCAACAGCATCTGAGCTGGAAC
TTTTCTTTGTCGCTGTTGTTGTGTTTTATGCATTTTATTTCTCGCACTGG
GAAAAATACACAACAAATGTTATGTATTTGCCTTGGGCGTATGATATTTC
ACAAATTGTTTGTCCACTATGGTTCCCAGCAAATTTATTGACATTAATTG
GATGGTTGCTTTCTTTATTCATGTTCATCTTACTAAGTTATTATGATCCA
AACTTCAGTGCTATCAGTCAGAATGTCCCTCGTTGGGTATGGCTTGTTGG
TGCTGTCTGTATTTTTTGCTCTCATCAATTTGATGGCATTGATGGAAAAC
AAGCTAGAAGGACAAAATCAGGTATTCCTCAATCGATACCTCACCTTTAT
CCAAATATGTGATGCACCCATTCTGGGACCAACTTGTAAAGATGGCGTCT
CTTTTGCTGAACTACAAATACCTCTCAAAAAACCAGCTCTCAGGCTTTGA
CAACTATAAGGTTCGTCAATTAGCAGATCATTTGAATGTGTATGTTTTCA
AAATCGGTAAAAAACCTGTCAAAGCAGTAAATGGTCATGCGTACACCAAC
GGACACTCAAATGGAATAAAAGCTAATGGAAAAGTTGCCCAAGACTGATG
TCGCCTGATCATAGCACAGATGACCAATTCCCAGTGTGATCGCTTCAACA
TTTTGGCATACCCACTCTTCCCTATGATTGTGTGCAGTCAATTAAAACTG
GTCAATGATAATAAAATGCTAGCTGTGTATTTTGCTTTTGTTGTTTTGGG
CCATATACACTATGGTGTCAATGTGGGCACGAAGAGACAGACCAGAAAAA
TGTGTCAGTTTCTTAGAAGGATTGATGCCAATGTTGAGCTTAACTTCAGT
CACTTTGGTCTATCTCTACTTTGGATACTTTTCACATGCTGACATTTTCT
ACACTAATCTGAGATTGTATGCAATCACATATGGAATCATCTACGCAAAT
CTGAATCCGCTGCACCATGTCTGTGTGTTCCAATGAGCATTTATAATCAA
TATGTTGGTTATCAATATGTTTTTTCGCAACATATTTGTATGGTCCTGAA
CTGTGGAGAACAGTTGTCTACCAAGATTATTCTATCACTCAAGTTCTGAA
AGTTACATTATATAATCACCACTGGGAGAACTGTTTGATCATGGTTGTGA
TAGTAGCATTGTATCTTTCATGGCAATTGGAATCTTTTCCTGCTTTGGTG
TCAGTACAGCAACAGCATCTGAGCTGGAACTTTTCTTTGTCGCTGTTGTT
GTGTTTTATGCATTTTATTTCTCGCACTGGGAAAAATACACAACAAATGT
TATGTATTTGCCTTGGGCGTATGATATTTCACAAATTGTTTGTCCACTAT
GGTTCCCAGCAAATTTATTGACATTAATTGGATGGTTGCTTTCTTTATTC
ATGTTCATCTTACTAAGTTATTATGATCCAAACTTCAGTGCTATCAGTCA
GAATGTCCCTCGTTGGGTATGGCTTGTTGGTGCTGTCTGTATTTTTTGCT
CTCATCAATTTGATGGCATTGATGGAAAACAAGCTAGAAGGACAAAATCA
GGTATTCCTCAATCGATACCTCACCTTTATCCAAATATGTGATGCACCCA
TTCTGGGACCAACTTGTAAAGATGGCGTCTCTTTTGCTGAACTACAAATA
CCTCTCAAAAAACCAGCTCTCAGGCTTTGACAACTATAAGGTTCGTCAAT
TAGCAGATCATTTGAATGTGTATGTTTTCAAAATCGGTAAAAAACCTGTC
AAAGCAGTAAATGGTCATGCGTACACCAACGGACACTCAAATGGAATAAA
AGCTAATGGAAAAGTTGCCCAAGACTGATGTCGCCTGATCATAGCACAGA
TGACCAATTCCCAGTGTGATCGCTTCAACATTTTGGCATACCCACTCTTC
CCTATGATTGTGTGCAGTCAATTAAAACTGGTCAATGATAATAAAATGCT
AGCTGTGTATTTTGCTTTTGTTGTTTTGGGCCATATACACTATGGTGTCA
ATGTGGGCACGAAGAGACAGACCAGAAAAATGTGTCAGTTTCTTAGAAGG
ATTGATGCCAATGTTGAGCTTAACTTCAGTCACTTTGGTCTATCTCTACT
TTGGATACTTTTCACATGCTGACATTTTCTACACTAATCTGAGATTGTAT
GCAATCACATATGGAATCATCTACGCAAATCTGAATCCGCTGCACCATGT
CTGTGTGTTCCAATGAGCATTTATAATCAATATGTTGGTTATCAATATGT
TTTTTCGCAACATATTTGTATGGTCCTGAACTGTGGAGAACAGTTGTCTA
CCAAGATTATTCTATCACTCAAGTTCTGAAAGTTACATTATATAATCACC
ACTGGGAGAACTGTTTGATCATGGTTGTGATAGTAGCATTGTATCTTTCA
TGGCAATTGGAATCTTTTCCTGCTTTGGTGTCAGTACAGCAACAGCATCT
GAGCTGGAACTTTTCTTTGTCGCTGTTGTTGTGTTTTATGCATTTTATTT
CTCGCACTGGGAAAAATACACAACAAATGTTATGTATTTGCCTTGGGCGT
ATGATATTTCACAAATTGTTTGTCCACTATGGTTCCCAGCAAATTTATTG
ACATTAATTGGATGGTTGCTTTCTTTATTCATGTTCATCTTACTAAGTTA
TTATGATCCAAACTTCAGTGCTATCAGTCAGAATGTCCCTCGTTGGGTAT
GGCTTGTTGGTGCTGTCTGTATTTTTTGCTCTCATCAATTTGATGGCATT
GATGGAAAACAAGCTAGAAGGACAAAATCAGGTATTCCTCAATCGATACC
TCACCTTTATCCAAATATGTGATGCACCCATTCTGGGACCAACTTGTAAA
GATGGCGTCTCTTTTGCTGAACTACAAATACCTCTCAAAAAACCAGCTCT
CAGGCTTTGACAACTATAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000656XLOC_000656Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001208-exon-sc0000007-1575043694:1026758..1027106TCONS_00001208-exon-sc0000007-1575043694:1026758..1027106Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1023793..1023861TCONS_00001208-exon-sc0000007-1575043694:1023793..1023861Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1023206..1023420TCONS_00001208-exon-sc0000007-1575043694:1023206..1023420Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1022782..1023004TCONS_00001208-exon-sc0000007-1575043694:1022782..1023004Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1022459..1022567TCONS_00001208-exon-sc0000007-1575043694:1022459..1022567Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1022285..1022333TCONS_00001208-exon-sc0000007-1575043694:1022285..1022333Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1021911..1022091TCONS_00001208-exon-sc0000007-1575043694:1021911..1022091Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1021554..1021730TCONS_00001208-exon-sc0000007-1575043694:1021554..1021730Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1575043694:1020382..1021445TCONS_00001208-exon-sc0000007-1575043694:1020382..1021445Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1026758..1027106TCONS_00001208-exon-sc0000007-1510915933:1026758..1027106Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1023793..1023861TCONS_00001208-exon-sc0000007-1510915933:1023793..1023861Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1023206..1023420TCONS_00001208-exon-sc0000007-1510915933:1023206..1023420Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1022782..1023004TCONS_00001208-exon-sc0000007-1510915933:1022782..1023004Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1022459..1022567TCONS_00001208-exon-sc0000007-1510915933:1022459..1022567Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1022285..1022333TCONS_00001208-exon-sc0000007-1510915933:1022285..1022333Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1021911..1022091TCONS_00001208-exon-sc0000007-1510915933:1021911..1022091Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1021554..1021730TCONS_00001208-exon-sc0000007-1510915933:1021554..1021730Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1510915933:1020382..1021445TCONS_00001208-exon-sc0000007-1510915933:1020382..1021445Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1026758..1027106TCONS_00001208-exon-sc0000007-1491911889:1026758..1027106Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1023793..1023861TCONS_00001208-exon-sc0000007-1491911889:1023793..1023861Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1023206..1023420TCONS_00001208-exon-sc0000007-1491911889:1023206..1023420Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1022782..1023004TCONS_00001208-exon-sc0000007-1491911889:1022782..1023004Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1022459..1022567TCONS_00001208-exon-sc0000007-1491911889:1022459..1022567Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1022285..1022333TCONS_00001208-exon-sc0000007-1491911889:1022285..1022333Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1021911..1022091TCONS_00001208-exon-sc0000007-1491911889:1021911..1022091Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1021554..1021730TCONS_00001208-exon-sc0000007-1491911889:1021554..1021730Clytia hemisphaericaexon
TCONS_00001208-exon-sc0000007-1491911889:1020382..1021445TCONS_00001208-exon-sc0000007-1491911889:1020382..1021445Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001208-proteinTCONS_00001208-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1020382..1027106 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
41.3556 42.4556 12.2618 9.93088 11.7504 9.32831 13.8775 14.8856 19.1005 18.283 26.3478 21.0631 56.8821 62.098 32.2571 34.9726 30.3592 35.2986 49.0077 40.9147 52.1966 50.6396 44.7138 48.8045 44.6543 46.4845 17.1883 18.8833 22.9833 25.2736
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR014472CHOPT
IPR000462CDP-OH_P_trans
Vocabulary: Biological Process
TermDefinition
GO:0008654phospholipid biosynthetic process
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0016780phosphotransferase activity, for other substituted phosphate groups
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008654 phospholipid biosynthetic process
cellular_component GO:0016020 membrane
molecular_function GO:0016780 phosphotransferase activity, for other substituted phosphate groups
Blast
BLAST of TCONS_00001208 vs. Swiss-Prot (Human)
Match: EPT1 (Ethanolaminephosphotransferase 1 OS=Homo sapiens GN=SELENOI PE=1 SV=3)

HSP 1 Score: 265.774 bits (678), Expect = 6.054e-80
Identity = 147/384 (38.28%), Postives = 232/384 (60.42%), Query Frame = 2
Query:  293 LLNYKYLSKNQLSGFDNYKYSSIDTSPLSKYVMHPFWDQLVKVCPLWFPANLLTLIGWLLSLFMFILLSYYDPNFSAIS---QNVPRWVWLVGAVCIFCSHQFDGIDGKQARRTKSGSPLGELFDHGCDSSIVSFMAIGIFSCFGVSTATASELELXXXXXXXXXXXXXSHWEKYTTNVMYLPWAYDISQIWLSICFFATYLYGPELWRTVVYQDYSITQVLKVTLYTAAPCLCVPMSIYNQYVARRDRPEKCVSFLEGLMPMLSLTSVTLVYLYFGYFSHADIFYTNLRLYAITYGIIYANLNCRLIIAQMTNSQCDRFNILAYPLFPMIVCSQLKLVN--DNKMLAVYFAFVVLGHIHYGVNVVRQLADHLNVYVFKIGKKP 1429
            +  Y+Y+S  QL+GFD YKYS++DT+PLS YVMHPFW+ +VKV P W   NL+T  G+LL +F F+L++Y+DP+F A +   ++VP WVW+V  +  F ++  DG+DGKQARRT S +PLGELFDHG DS    +  + ++S FG  +   S   L+ +  VV ++F  SHWEKY T +++LPW YDISQ+ +S  +  T + G E W      ++    +    +   A C+ +PMS+ N + + ++   K  S  E ++P+ S   + ++   +  +S +DI   + R++    G  +AN  C+LI+ QM++++C   N L  PLF +++   L + +  ++ +L        L HIHYGV VV+QL+ H  +Y F + +KP
Sbjct:    1 MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAPNLITFSGFLLVVFNFLLMAYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTVYSIFGRGSTGVSVFVLYLLLWVVLFSFILSHWEKYNTGILFLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIGCALCVTLPMSLLNFFRSYKNNTLKLNSVYEAMVPLFSPCLLFILSTAWILWSPSDILELHPRVFYFMVGTAFANSTCQLIVCQMSSTRCPTLNWLLVPLFLVVLVVNLGVASYVESILLYTLTTAFTLAHIHYGVRVVKQLSSHFQIYPFSL-RKP 383          
The following BLAST results are available for this feature:
BLAST of TCONS_00001208 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
EPT16.054e-8038.28Ethanolaminephosphotransferase 1 OS=Homo sapiens G... [more]
back to top