Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001202 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001202
Unique NameTCONS_00001202
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1096

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001202 ID=TCONS_00001202|Name=TCONS_00001202|organism=Clytia hemisphaerica|type=transcript|length=1096bp
AAAAGAAGCAGTGGCAGCAGTTCATTCTCAACAAATTCAACCTACGATAC
CGAAACGAAACAATTTTTATGACGAAATACATGACGTAATACATCGAATG
ACAAACAAAAAACCTTTAGAAGAGAGTACATCCGATGAGATCTTCCCCAT
TTTGAAACCCTCCAAAATGTTTGGCTTCTCTCCTTCACACGAGGAAAACA
ATGTCAAGAAAGACAACATTCCTAAATCCATTTTCCCTCCCACTCTCTCC
TCACAAATGCTCCATAAACTACCTCTACCGTTCACTGAGAAAAGCTTTTC
TCAGCCAGCAGAAAGTTCTCCAAAGTCACAACTCTCTTACCAACCTTTGC
AGCCCACTAACCAAACAAATCTCACAAAACCACCAAACTCATCCCCATCA
AGCAAAACAGATTCATCTGCTACTTTAAGCAACCAATCCAATTCCTCCTT
AATGTCAAATAACCAATCAGAATCACTCATGAAGACTGATCTTTTTGGTG
ACGCAAACTCTAACACCAATCAAAATGATTCGAATAGCTCCATATTGAGC
TCAGTCGGTCAATTTTTAGACAATGTTGGAAACACTTCATCAGTGAATAA
CCAAAATAACCCCTCTCCCTTTAACCCTACTCCTTCCTCTCTCCAAGCCG
CAAACTCTTCCTTAATTAACACTCTCTCCCctgaaaaacaaataaaccaa
tcaaacattgcATACATCTCCAACCATCCAATCACAACCCAATTCAGCAA
CGAATCAAATTTCGCCAGCAATTCATTAACACACTCAGACTTAACAGGTC
CCAaaatgaaccaatcaaataGCGATCCGTTAGTTGCTTCATGGAGGCAA
TTCTTCCCTTCCTTATTCCCATCCGGTAGAACGACATCCCAACAGTTTGA
CATCAAGAGTAACATAACGACAGCCAAAAATGAAACTCCTGAAGTGAGAT
CTGGTCAAAGTGCAGCAATGAACTACATGTTGCCAGAAACAGAAGCTAGT
ATCCATCCTTTATCATTGACCACTGCTGACGTGAAGAAACCAGCCCTTTA
TGACAGTGTTCTTGTCAAGAAGAATCTCATCAAAGAGAAACCAGGT
Run BLAST on NCBI

protein sequence of TCONS_00001202-protein

>TCONS_00001202-protein ID=TCONS_00001202-protein|Name=TCONS_00001202-protein|organism=Clytia hemisphaerica|type=polypeptide|length=365bp
KEAVAAVHSQQIQPTIPKRNNFYDEIHDVIHRMTNKKPLEESTSDEIFPI
LKPSKMFGFSPSHEENNVKKDNIPKSIFPPTLSSQMLHKLPLPFTEKSFS
QPAESSPKSQLSYQPLQPTNQTNLTKPPNSSPSSKTDSSATLSNQSNSSL
MSNNQSESLMKTDLFGDANSNTNQNDSNSSILSSVGQFLDNVGNTSSVNN
QNNPSPFNPTPSSLQAANSSLINTLSPEKQINQSNIAYISNHPITTQFSN
ESNFASNSLTHSDLTGPKMNQSNSDPLVASWRQFFPSLFPSGRTTSQQFD
IKSNITTAKNETPEVRSGQSAAMNYMLPETEASIHPLSLTTADVKKPALY
DSVLVKKNLIKEKPG
Run BLAST on NCBI

transcript from alignment at sc0000007:999784..1001944-

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001202 ID=TCONS_00001202|Name=TCONS_00001202|organism=Clytia hemisphaerica|type=transcript|length=2161bp|location=Sequence derived from alignment at sc0000007:999784..1001944- (Clytia hemisphaerica)
AAAAGAAGCAGTGGCAGCAGTTCATTCTCAACAAAGTAAGTTTTTGTTGA TTTTCGATTCACTGAATGTTTTAAATAAATCTTGTCTTCGACAAAACATA AATTCATATTAATGTTACCAAACCCCTTTTCGTTACAGACCCCCTTCTCA ATGAAAAAATTGACCTAAAAACATCAAGGCACCCTGAAAACTCATTCAAA CTGGGAGAGATACTCAAGTTTTAAATGTCCAAATATTGAACAGTATAAAA TTCAAAATCCCAACCTAAACGCAAGATCAATCAATCCGCATTGGTACTTA GCGTCGCCATTTTATTTCCACAGGCTAAACGCTTCTCACCGGATATCTGA GACAGGGGTGTCACCATTTGACGTTGTTTGTGTGTAATTTGTCAGTTCAC GCTCCCTTAGTTCATAATTATCTCAATTGTTGTCGTTGTTTGGTGTATAC ATTGTCATGTTCGTCCCCGATCATTTGAATCTGTGTTACTTGCGATGTTT GTTTCTGTTTTGTTTATGTCCGTTGTATGTTTGTAAACTGTCCATATGGT TGTATGCAACAAATTTCATGAGCGTTGCTTAAAAAGAGTGGCTTATCGCT TGGCTATATAATGTGAAGTCCTCGATGTCCAACACTAGATGTTTAGTTAT TGTTTCTTGTTTAATGTTGTTGTACATGTTGTTCGTACAGTAAGCGTTCG TTCATACCTCCACTCCCATGCATGCATGAACACGCTTCATTCACTACATC TTTTTTATTGACAGTTCAACCTACGATACCGAAACGAAACAATTTTTATG ACGAAATACATGACGTAATACATCGAATGACAAACAAAAAACCTTTAGAA GAGAGTACATCCGATGAGATCTTCCCCATTTTGAAACCCTCCAAAATGTT TGGCTTCTCTCCTTCACACGAGGAAAACAATGTCAAGAAAGACAACATTC CTAAATCCATTTTCCCTCCCACTCTCTCCTCACAAATGCTCCATAAACTA CCTCTACCGTTCACTGAGAAAAGCTTTTCTCAGCCAGCAGAAAGTTCTCC AAAGTCACAACTCTCTTACCAACCTTTGCAGCCCACTAACCAAACAAATC TCACAAAACCACCAAACTCATCCCCATCAAGCAAAACAGATTCATCTGCT ACTTTAAGCAACCAATCCAATTCCTCCTTAATGTCAAATAACCAATCAGA ATCACTCATGAAGACTGATCTTTTTGGTGACGCAAACTCTAACACCAATC AAAATGATTCGAATAGCTCCATATTGAGCTCAGTCGGTCAATTTTTAGAC AATGTTGGAAACACTTCATCAGTGAATAACCAAAATAACCCCTCTCCCTT TAACCCTACTCCTTCCTCTCTCCAAGCCGCAAACTCTTCCTTAATTAACA CTCTCTCCCCTGAAAAACAAATAAACCAATCAAACATTGCATACATCTCC AACCATCCAATCACAACCCAATTCAGCAACGAATCAAATTTCGCCAGCAA TTCATTAACACACTCAGACTTAACAGGTCCCAAAATGAACCAATCAAATA GCGATCCGTTAGTTGCTTCATGGAGGCAATTCTTCCCTTCCTTATTCCCA TCCGGTAGAACGACATCCCAACAGTTTGACATCAAGAGTAACATAACGAC AGCCAAAAATGAAACTCCTGAAGTGAGATCTGGTGAGTATGATGTAGTCG TTACACCCACTTACAGATTGGACGTCATGCATGTGACGAGTTTACTCAAG GAGTTTGGTTCACTTATAATCATGAATAGATGTTCGAGACTGGTCGGTTT CCAATATGCCGTGGAATGTCTTTTCTGTTATTGATCTCATGGCTCTCATA GTATAAGTTGCTATAAAGAAGGGAGAATTTACCAGAGGATGCTAACAGCT GGTATGTGCTCTGGGACCTTCTTCCTTTTTTCAATACTTGGCCCCAGTAC TTCCTTATGAGGGGATTTCCTTTTTTCGGACTTTTTATTTCTAACTTTCT AATTCTGTACAAAAACAGGTCAAAGTGCAGCAATGAACTACATGTTGCCA GAAACAGAAGCTAGTATCCATCCTTTATCATTGACCACTGCTGACGTGAA GAAACCAGCCCTTTATGACAGTGTTCTTGTCAAGAAGAATCTCATCAAAG AGAAACCAGGT

Coding sequence (CDS) from alignment at sc0000007:999784..1001944-

>TCONS_00001202 ID=TCONS_00001202|Name=TCONS_00001202|organism=Clytia hemisphaerica|type=CDS|length=3285bp|location=Sequence derived from alignment at sc0000007:999784..1001944- (Clytia hemisphaerica)
GTCAAAGTGCAGCAATGAACTACATGTTGCCAGAAACAGAAGCTAGTATC
CATCCTTTATCATTGACCACTGCTGACGTGAAGAAACCAGCCCTTTATGA
CAGTGTTCTTGTCAAGAAGAATCTCATCAAAGAGAAACCAGGTTTCAACC
TACGATACCGAAACGAAACAATTTTTATGACGAAATACATGACGTAATAC
ATCGAATGACAAACAAAAAACCTTTAGAAGAGAGTACATCCGATGAGATC
TTCCCCATTTTGAAACCCTCCAAAATGTTTGGCTTCTCTCCTTCACACGA
GGAAAACAATGTCAAGAAAGACAACATTCCTAAATCCATTTTCCCTCCCA
CTCTCTCCTCACAAATGCTCCATAAACTACCTCTACCGTTCACTGAGAAA
AGCTTTTCTCAGCCAGCAGAAAGTTCTCCAAAGTCACAACTCTCTTACCA
ACCTTTGCAGCCCACTAACCAAACAAATCTCACAAAACCACCAAACTCAT
CCCCATCAAGCAAAACAGATTCATCTGCTACTTTAAGCAACCAATCCAAT
TCCTCCTTAATGTCAAATAACCAATCAGAATCACTCATGAAGACTGATCT
TTTTGGTGACGCAAACTCTAACACCAATCAAAATGATTCGAATAGCTCCA
TATTGAGCTCAGTCGGTCAATTTTTAGACAATGTTGGAAACACTTCATCA
GTGAATAACCAAAATAACCCCTCTCCCTTTAACCCTACTCCTTCCTCTCT
CCAAGCCGCAAACTCTTCCTTAATTAACACTCTCTCCCCTGAAAAACAAA
TAAACCAATCAAACATTGCATACATCTCCAACCATCCAATCACAACCCAA
TTCAGCAACGAATCAAATTTCGCCAGCAATTCATTAACACACTCAGACTT
AACAGGTCCCAAAATGAACCAATCAAATAGCGATCCGTTAGTTGCTTCAT
GGAGGCAATTCTTCCCTTCCTTATTCCCATCCGGTAGAACGACATCCCAA
CAGTTTGACATCAAGAGTAACATAACGACAGCCAAAAATGAAACTCCTGA
AGTGAGATCTGAAAGAAGCAGTGGCAGCAGTTCATTCTCAACAAAGTCAA
AGTGCAGCAATGAACTACATGTTGCCAGAAACAGAAGCTAGTATCCATCC
TTTATCATTGACCACTGCTGACGTGAAGAAACCAGCCCTTTATGACAGTG
TTCTTGTCAAGAAGAATCTCATCAAAGAGAAACCAGGTTTCAACCTACGA
TACCGAAACGAAACAATTTTTATGACGAAATACATGACGTAATACATCGA
ATGACAAACAAAAAACCTTTAGAAGAGAGTACATCCGATGAGATCTTCCC
CATTTTGAAACCCTCCAAAATGTTTGGCTTCTCTCCTTCACACGAGGAAA
ACAATGTCAAGAAAGACAACATTCCTAAATCCATTTTCCCTCCCACTCTC
TCCTCACAAATGCTCCATAAACTACCTCTACCGTTCACTGAGAAAAGCTT
TTCTCAGCCAGCAGAAAGTTCTCCAAAGTCACAACTCTCTTACCAACCTT
TGCAGCCCACTAACCAAACAAATCTCACAAAACCACCAAACTCATCCCCA
TCAAGCAAAACAGATTCATCTGCTACTTTAAGCAACCAATCCAATTCCTC
CTTAATGTCAAATAACCAATCAGAATCACTCATGAAGACTGATCTTTTTG
GTGACGCAAACTCTAACACCAATCAAAATGATTCGAATAGCTCCATATTG
AGCTCAGTCGGTCAATTTTTAGACAATGTTGGAAACACTTCATCAGTGAA
TAACCAAAATAACCCCTCTCCCTTTAACCCTACTCCTTCCTCTCTCCAAG
CCGCAAACTCTTCCTTAATTAACACTCTCTCCCCTGAAAAACAAATAAAC
CAATCAAACATTGCATACATCTCCAACCATCCAATCACAACCCAATTCAG
CAACGAATCAAATTTCGCCAGCAATTCATTAACACACTCAGACTTAACAG
GTCCCAAAATGAACCAATCAAATAGCGATCCGTTAGTTGCTTCATGGAGG
CAATTCTTCCCTTCCTTATTCCCATCCGGTAGAACGACATCCCAACAGTT
TGACATCAAGAGTAACATAACGACAGCCAAAAATGAAACTCCTGAAGTGA
GATCTGAAAGAAGCAGTGGCAGCAGTTCATTCTCAACAAAGTCAAAGTGC
AGCAATGAACTACATGTTGCCAGAAACAGAAGCTAGTATCCATCCTTTAT
CATTGACCACTGCTGACGTGAAGAAACCAGCCCTTTATGACAGTGTTCTT
GTCAAGAAGAATCTCATCAAAGAGAAACCAGGTTTCAACCTACGATACCG
AAACGAAACAATTTTTATGACGAAATACATGACGTAATACATCGAATGAC
AAACAAAAAACCTTTAGAAGAGAGTACATCCGATGAGATCTTCCCCATTT
TGAAACCCTCCAAAATGTTTGGCTTCTCTCCTTCACACGAGGAAAACAAT
GTCAAGAAAGACAACATTCCTAAATCCATTTTCCCTCCCACTCTCTCCTC
ACAAATGCTCCATAAACTACCTCTACCGTTCACTGAGAAAAGCTTTTCTC
AGCCAGCAGAAAGTTCTCCAAAGTCACAACTCTCTTACCAACCTTTGCAG
CCCACTAACCAAACAAATCTCACAAAACCACCAAACTCATCCCCATCAAG
CAAAACAGATTCATCTGCTACTTTAAGCAACCAATCCAATTCCTCCTTAA
TGTCAAATAACCAATCAGAATCACTCATGAAGACTGATCTTTTTGGTGAC
GCAAACTCTAACACCAATCAAAATGATTCGAATAGCTCCATATTGAGCTC
AGTCGGTCAATTTTTAGACAATGTTGGAAACACTTCATCAGTGAATAACC
AAAATAACCCCTCTCCCTTTAACCCTACTCCTTCCTCTCTCCAAGCCGCA
AACTCTTCCTTAATTAACACTCTCTCCCCTGAAAAACAAATAAACCAATC
AAACATTGCATACATCTCCAACCATCCAATCACAACCCAATTCAGCAACG
AATCAAATTTCGCCAGCAATTCATTAACACACTCAGACTTAACAGGTCCC
AAAATGAACCAATCAAATAGCGATCCGTTAGTTGCTTCATGGAGGCAATT
CTTCCCTTCCTTATTCCCATCCGGTAGAACGACATCCCAACAGTTTGACA
TCAAGAGTAACATAACGACAGCCAAAAATGAAACTCCTGAAGTGAGATCT
GAAAGAAGCAGTGGCAGCAGTTCATTCTCAACAAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000653XLOC_000653Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001202-proteinTCONS_00001202-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001202-exon-sc0000007-1575043694:1001910..1001944TCONS_00001202-exon-sc0000007-1575043694:1001910..1001944Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1575043694:1000263..1001180TCONS_00001202-exon-sc0000007-1575043694:1000263..1001180Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1575043694:999784..999926TCONS_00001202-exon-sc0000007-1575043694:999784..999926Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1510915933:1001910..1001944TCONS_00001202-exon-sc0000007-1510915933:1001910..1001944Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1510915933:1000263..1001180TCONS_00001202-exon-sc0000007-1510915933:1000263..1001180Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1510915933:999784..999926TCONS_00001202-exon-sc0000007-1510915933:999784..999926Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1491911889:1001910..1001944TCONS_00001202-exon-sc0000007-1491911889:1001910..1001944Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1491911889:1000263..1001180TCONS_00001202-exon-sc0000007-1491911889:1000263..1001180Clytia hemisphaericaexon
TCONS_00001202-exon-sc0000007-1491911889:999784..999926TCONS_00001202-exon-sc0000007-1491911889:999784..999926Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:999784..1001944 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.199987 0.195019 0.407585 0.132919 0.755143 0.255739 1.31066 2.45406 0.370756 0.208746 0.364705 1.032 3.82394 4.61899 2.08396 5.78981 1.34692 2.60422 0.0850364 0.222461 1.5082 1.52788 0.687904 1.12573 3.41496 3.51666 0.164533 0.0585315 0 0.0452305
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001202 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top