Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001197 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001197
Unique NameTCONS_00001197
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1666

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001197 ID=TCONS_00001197|Name=TCONS_00001197|organism=Clytia hemisphaerica|type=transcript|length=1666bp
GTTTTAATGATCATGCTCTTTCTATCTCATTGCGTTAGGGACCTTTGGAC
CTCATCTAGATTTTTTAATAGGTAAGATTTGACATCGTCAAAATCGCTCG
AAATATGGGAGCTTTGGTAGTACGGTTGATATGGTTTTACGGACAAACGC
AGATGAATGGACAATACAACCTGTTACCAGAATGTGCTTGGTTTCGCACT
TGATTTATGAAAGCCTAATATTAACTTAATTATTTCATTGGATCAATAAT
TGGATTATGTTAATACCTTCATTCTTTCTATCTTTAGAATCAATTAATAT
AAAGAAATTCTTATTATAAAGTGACGACAAAAATAGAAgaatatcaaaaa
agaaaatgggTTTTGTCAAGACGTTAGCTTGTTTGTGTTATTTCATGGTA
CCTGTTCTCGGTATTCTACTTCCAATACCGTTATGTGATATAAGACGAAA
CTTAACGCCGGAGCAAGTGGAATTATGCAAACAGTTCAAAGAGAAACATC
TGGATTTGTTGCTGGACGCCAAATTCAAATCAGAGTTCGAATGCAAGAAA
CAGTTTGCTGGTCGACGTTGGAATTGCACAATGCCGCCTTCTTCAAATGT
GACGCCATTNAATGCAAGAAACAGTTTGCTGGTCGACGTTGGAATTGCAC
AATGCCGCCTTCTTCAAACGTGACGCCATTATTGTTACCAAGGTTACCAT
TAGCAACCAAAGAGACATCATATTTGTACGCTTCGATGTCAGCAGCCATG
ATGCACACAATCAGTCGTGGTTGTATGGCAGGTACTCTGAAGAACTACTG
CGCATGCTCTGAAGAAGGAAGGCCACGTGATCTACCCAAGAATCAGATCT
GGGGTGGGTGTGGTGATAATTTACCATACGGATACAAGTTCAGTAAGATG
TTCACTGATGCTGGTGAACAACTGACCGAAACTTCGTTGACAGGATTTTC
AAGAGTTTTAATGAACCTTCATAATAATGAAGCTGGGAGATGGGCTGTTT
ACGAGAAGTCGTTCATCAAATGCAGATGTCATGGAGTTTCCACAAACTGT
CCAACAAAGACATGCTACAGGCAGCTTGGTCGCTTCCACACTGTAGCCAA
ACATCTGGAAACATTACATCAAGATGCGGTTCACGTCAAACTACAAAAGG
ACGTCCCTGATGCAGAGGAGGAGGGAAATGTAGAGATGAAGCTTGTCGAA
ACCAGTCCAGGATTTACCAAGAAGTCTACCAAAGACCTGGTTTATATTAG
TGATTCACCAAGTTACTGTGAGCGTAGCATAAGAACAGGTTCGTACGGTG
TAGCCGGTAGACCATGTACAAAAGAAGGAAATATTCATACGGATTGTGAA
GCTATGTGTTGTCAGAAAGGACATTATTCGAAACGAGAAATAGTACGGAC
TAAATGTGGGTGCAAACTGATTTGGTGTTGCGAAGTAAAGTGTAATATAt
gtgaaaatgaacaaaataaccACTACTGCAGATAACAGGTTCATCTTGCA
CTTATctagtcaattttttatatgAAGATGTTTTTAACGAAATATAGTTT
TATGTTGCCCTGGGTGTTGTTTTATCATTATTGTAGCGCGATTTGTATCA
TAAAAATATGTGTATATAATAATTATCTATTTATATTGTGAAAAGAATTT
ATATATGAAAACTCAA
Run BLAST on NCBI

transcript from alignment at sc0000007:945389..948683-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001197 ID=TCONS_00001197|Name=TCONS_00001197|organism=Clytia hemisphaerica|type=transcript|length=3295bp|location=Sequence derived from alignment at sc0000007:945389..948683- (Clytia hemisphaerica)
GTTTTAATGATCATGCTCTTTCTATCTCATTGCGTTAGGGACCTTTGGAC CTCATCTAGATTTTTTAATAGGTAAGATTTGACATCGTCAAAATCGCTCG AAATATGGGAGCTTTGGTAGTACGGTTGATATGGTTTTACGGACAAACGC AGATGAATGGACAATACAACCTGTTACCAGAATGTGCTTGGTTTCGCACT TGATTTATGAAAGCCTAATATTAACTTAATTATTTCATTGGATCAATAAT TGGATTATGTTAATACCTTCATTCTTTCTATCTTTAGAATCAATTAATAT AAAGAAATTCTTATTATAAAGTGACGACAAAAATAGAAGAATATCAAAAA AGAAAATGGGTTTTGTCAAGACGTTAGCTTGTTTGTGGTAAGTTGGATAT TATAAGATGTTTCAATGTTTCATTTACATTTTATGAGTTACTCAATGACT AGCGAAAAAGAAGGACTTCACTTAGAGAGCTGAAATAGAATCAGTTAGCG TGTCTAAACAATCTCGGTTTAGCAGTCACGTTTTTCGTATCCCACACGAA AGATTAAAATACCGAAAAAAGATATAATCAGACTTTTAATTAGTACCTTA AGTGCCTAAAAATAATTCACTAGATCAACCCACATCTAAAACCGGCTCTG TGGAATCTCAATCCCTACTAAAACCTCCTCGAAACTCAAAGTAAGCCGAC AGATGAAAAAAGACGTTTATCAAATCAAAGGGAAGATACGATAAGATTAA AAAAACCACACATAGCTTAATTAATGATTAATCTTAATGACCAATTAGTA ACTGCTATATCTTGATCAGTGACTTCCGATAAAGTTAATCTAATGTGTAT TTAACGTTTCCGATGCTGGCGCTTATTGAGTCCTGCAAGAGACGAATAGT GCACGTCAACCGCCACCTAATTATCCCCTAATCATGTTTCCATTGTTTTC AAATGTTTTTGTAAACCCATACACAATACCTGTTATCAAGCAGTGCTAAA ATTAACCTGCTTTCCATCACAAATGAGACAGATTATTGATGGAAAGGACT TTGTAAACAAAACTCAAACACAAGAAAATGGGATTCTGTCCGTCCCCCTT TCTAAAGAAAATTAATCCGGTATATGGCTGTTGAAATGGAATTCCACTAA TAACTTTTTCTCCAAATGAAAAACATTGATGGTTGAAGGATTAAGTAGAT TTGTGGAAAAATTTAGTAAACAACAAACATTAGTTTCGTCTATCAGTCGT TGAGAACGATGTTCNGTTGAAGGATTAAGTAGATTTGTGGAAAAATTTAG TAAACAACAAACATTAGTTTCGTCTATCAGTCGTTGAGAAAGATGTTGGG AAATAATATTGTCACACAACCAGAGGTGGTTTATGCCAACATTCCTCCTT CGTTTTATAGTTATTTCATGGTACCTGTTCTCGGTATTCTACTTCCAATA CCGTTATGTGATATAAGACGAAACTTAACGCCGGAGCAAGTGGAATTATG CAAACAGTTCAAAGAGAAACATCTGGATTTGTTGCTGGACGCCAAATTCA AATCAGAGTTCGAATGCAAGAAACAGTTTGCTGGTCGACGTTGGAATTGC ACAATGCCGCCTTCTTCAAATGTGACGCCATTNAATGCAAGAAACAGTTT GCTGGTCGACGTTGGAATTGCACAATGCCGCCTTCTTCAAACGTGACGCC ATTATTGTTACCAAGGTTACCATTAGGTAAGCGCTTAACTTTTTAATACA ACTTTGTCGATGTTTATGAAAAAAGCATATTCAAGTATTTTGCGGCAACC TCTGTGAATCAAGCAAAAAAAGAAAGGGCCAAACTCTGATACTCCAAAGT AAACGCATCAAACTTAATAACATTGCAATACATTGGAAAACGTTGTGGGT TCTAACCAAATCATCTCACCTTTTACTCATAGCAACCAAAGAGACATCAT ATTTGTACGCTTCGATGTCAGCAGCCATGATGCACACAATCAGTCGTGGT TGTATGGCAGGTACTCTGAAGAACTACTGCGCATGCTCTGAAGAAGGAAG GCCACGTGATCTACCCAAGAATCAGATCTGGGGTGGGTGTGGTGATAATT TACCATACGGATACAAGTTCAGTAAGATGTTCACTGATGCTGGTGAACAA CTGACCGAAACTTCGTTGACAGGATTTTCAAGAGTTTTAATGAACCTTCA TAATAATGAAGCTGGGAGATGGGTAAGTTTATTTGTGTTTTATCAATTCC TTTTACATTGCACAAAAACAAAATGTATGCAAACTTTGAGATCAACAAAA TCCGGTAACAAAAAATCAGAGATGGGAGAAGAATCTCTCGAAATGTTAGC TAAGCGTAAATCTCGTGATCCAAGCCACGATAAACTTTCAATATATCATA GAGTCGATAAACTCAAATTTTTTCAGGAAATCAGAGAATTCAAGAGTCTT CCCACATAGAAACACGCCACAGTATCTAAAGGATGTTTATTCTGGAAATC TAGAAATTGAAATTATGTAAAGATGCCAACAAATTATTGAATACTAAGTC TCTTGTATTTCCTTTGAAATATATAAATTTCATAACGGCTTAACATTTTC AATGTTCCTGTTTTTCTTAAAGGCTGTTTACGAGAAGTCGTTCATCAAAT GCAGATGTCATGGAGTTTCCACAAACTGTCCAACAAAGACATGCTACAGG CAGCTTGGTCGCTTCCACACTGTAGCCAAACATCTGGAAACATTACATCA AGATGCGGTTCACGTCAAACTACAAAAGGACGTCCCTGATGCAGAGGAGG AGGGAAATGTAGAGATGAAGCTTGTCGAAACCAGTCCAGGATTTACCAAG AAGTCTACCAAAGACCTGGTTTATATTAGTGATTCACCAAGTTACTGTGA GCGTAGCATAAGAACAGGTTCGTACGGTGTAGCCGGTAGACCATGTACAA AAGAAGGAAATATTCATACGGATTGTGAAGCTATGTGTTGTCAGAAAGGA CATTATTCGAAACGAGAAATAGTACGGACTAAATGTGGGTGCAAACTGAT TTGGTGTTGCGAAGTAAAGTGTAATATATGTGAAAATGAACAAAATAACC ACTACTGCAGATAACAGGTTCATCTTGCACTTATCTAGTCAATTTTTTAT ATGAAGATGTTTTTAACGAAATATAGTTTTATGTTGCCCTGGGTGTTGTT TTATCATTATTGTAGCGCGATTTGTATCATAAAAATATGTGTATATAATA ATTATCTATTTATATTGTGAAAAGAATTTATATATGAAAACTCAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000650XLOC_000650Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001197-exon-sc0000007-1575043694:948297..948683TCONS_00001197-exon-sc0000007-1575043694:948297..948683Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1575043694:946958..947273TCONS_00001197-exon-sc0000007-1575043694:946958..947273Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1575043694:946462..946751TCONS_00001197-exon-sc0000007-1575043694:946462..946751Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1575043694:945389..946061TCONS_00001197-exon-sc0000007-1575043694:945389..946061Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1510915933:948297..948683TCONS_00001197-exon-sc0000007-1510915933:948297..948683Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1510915933:946958..947273TCONS_00001197-exon-sc0000007-1510915933:946958..947273Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1510915933:946462..946751TCONS_00001197-exon-sc0000007-1510915933:946462..946751Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1510915933:945389..946061TCONS_00001197-exon-sc0000007-1510915933:945389..946061Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1491911889:948297..948683TCONS_00001197-exon-sc0000007-1491911889:948297..948683Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1491911889:946958..947273TCONS_00001197-exon-sc0000007-1491911889:946958..947273Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1491911889:946462..946751TCONS_00001197-exon-sc0000007-1491911889:946462..946751Clytia hemisphaericaexon
TCONS_00001197-exon-sc0000007-1491911889:945389..946061TCONS_00001197-exon-sc0000007-1491911889:945389..946061Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:945389..948683 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0973994 0 0 0 0.451356 0 0.215152 0.201423 0.282042 0.174677 0 0.891622 0.219199 0.346752 0 0.509885 0 0.128764 0.711578 0.744615 1.61801 0.925219 0.575633 0.174445 0 0 0.229467 0 0 0.123921
Blast
BLAST of TCONS_00001197 vs. Swiss-Prot (Human)
Match: WNT5A (Protein Wnt-5a OS=Homo sapiens GN=WNT5A PE=1 SV=2)

HSP 1 Score: 219.935 bits (559), Expect = 3.813e-65
Identity = 115/292 (39.38%), Postives = 164/292 (56.16%), Query Frame = 1
Query:  613 CKKQFAGRRWNCTMPPSSNVTXXXXXXXXXATKETSYLYASMSAAMMHTISRGCMAGTLKNYCACSEEGRPRDLPKNQIWGGCGDNLPYGYKFSKMFTDAGEQLTETSLTGF--SRVLMNLHNNEAGRWAVYEKSFIKCRCHGVSTNCPTKTCYRQLGRFHTVAKHLETLHQDAVHVKLQKDVPDAEEEGNVEMKLVETSPGFTKKSTKDLVYISDSPSYCERSIRTGSYGVAGRPCTKEGNIHTDCEAMCCQKGHYSKREIVRTKCGCKLIWCCEVKCNICENEQNNHYCR 1482
            C+ QF  RRWNC+   +++V       + + ++ET++ YA  +A +++ +SR C  G L   C CS   RP+DLP++ +WGGCGDN+ YGY+F+K F DA E+    +   +  +R+LMNLHNNEAGR  VY  + + C+CHGVS +C  KTC+ QL  F  V   L+  +  A  ++L           N   KLV+ +  F   +T+DLVYI  SP YC R+  TGS G  GR C K       CE MCC +G+   + +   +C CK  WCC VKC  C    +   C+
Sbjct:  104 CQYQFRHRRWNCSTVDNTSV---FGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELST-CGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRL-----------NSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK 380          
The following BLAST results are available for this feature:
BLAST of TCONS_00001197 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
WNT5A3.813e-6539.38Protein Wnt-5a OS=Homo sapiens GN=WNT5A PE=1 SV=2[more]
back to top