Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001195 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001195
Unique NameTCONS_00001195
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3575

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001195 ID=TCONS_00001195|Name=TCONS_00001195|organism=Clytia hemisphaerica|type=transcript|length=3575bp
tcgagtttcagtccgttattttgacccccactggctgaaaaagtcCTGCC
AGGTCTGCGAGGAGGGGGTGTTTtggagtgtttttttttatcataatttt
tagTACTCCTGAAAAAGTATGAGTCGGTATATAAACAGAAAAAGGGTCTG
GTTATTTAAAGTGTATTGgtcaaagaaaaatctttatgaagaagaaattg
aacaGCTTGTCAGTGAATAAACCAAAACTCGATTACTGTTTACTTTTCCA
AGTATCTCTTTCAAAAATCGAAACGTGAAAAAGAATTGGAgttaatttca
agaaaaactacAGCAATGGCACGGTATACAAGCACCTACCTACCATTGTT
AATTATAGTTCTCCATTTTTCATTTGTTAAAAACTTTTGCATAGAATTTC
ACTGTACTGCAAGATATAAGGGTTCGTATAAACCGACCACAGCGCCACCC
ACAGGACAATGCATCACACAAGTGGATGAAGTAATTTACAGCATGAAACA
TACTGTGAAGTCAGGAGGCTGCAAAAATACTCTTTGTAATGAAGTCAATC
GAGAACGACTAAAATGTTCATGCAGAGAGGTCACGAATTGTTGGTGGGCT
AGTTGGGGAGCTTGGACAGGTTCAATAACACAAGGGACCTGTGGAAAACA
ACATCGTAGACGAGCTGAGAAAGACAGAGCAAGATATGTGGAAAGATATG
GAAGTTGTAGTGGAGTAAAAGGCCAATGCAATGGAAGTTACAACTCAGAA
GATCGAACCATGTGTAATTGCAGGAAAGCAAGTAGTTGTCCAGTAGCACC
ATGGAGTTCGTGGACACCAGCAGTTGGTAATGGACAATGTAAAGACCAAA
CACGACACCAAGACAAAAAGCCTTCATACACTTACGTTATGAAAGAACAG
AAGAAAGGAGAAGTGGCTTGCTTTGGCATCGATCCTGATTGTCGACCACC
AAGAATTACTGATACAAGAACATTCTGTAAATGTCCGACGAAGGAATGCA
CAGAGAGAAGTTGGACATCTTGGAATATCGACACATGGACGGGAAGCTGC
CCAAATGAGAAGAGGACCAAAACATatgatttcaaaatcaaatataTTGA
GGCTTACAAGAGCTGCAATGGTGTAGGAAAAGATTGCCCACCTACCAAGA
ACGAGTATAGAAAAAAAGTGATCAAATGTCCAGCAATCAAGTTATCACTA
AACTCCATCCACCTTGACAAATCATGCAATGGAGTAGACAGCTCATGTAC
ATCTGTCTGTCGCATTGACTGTAAGAAAGGCTACAAGCTGATTGGTCAAA
ACCATGTCACGTGTCACGGATCAGGAAAATGGACAGGAAAACTAGGGTAT
TGTAAAGATTCTGAGCCACCGACGATAACATGTCCTAAATTGCCAATTCC
AACCGTCAACAACAAGCCAGGCACCAATTACTCCATCATCTCATTCCCCA
ATGCGACGGCAACCGATAATTCAGGTTTTCCAGTGACAATCACCACAAGT
CATCCATCACCACTGAAAGTGTTCGTTCACCATCCAGTTGAAGTTACTTA
CACTGCTACTGATGCTGTTGGAAACACCAATAAATGCAAACGGAAATTCA
TCGTCAAAGATCACGAGGCACCAGTTGTAACTTATTGCCCCAAAAAACAT
CGAATCATCAAAACAGGGTTATTCCCACACCGAGTATTTTGGCCCATGCC
ACGCTTCACAGACAACGTGGAGGCTGACAACGAGTTGGTCTTCATCCCTT
CCGTGGTGAATGGAACTAAGTTCTACCAAGGGAAACACAGTGTTGATATC
AAAGCCAGAGATAAATCATCCAATACTGGAAACTGCACCATGACATTCGA
GCTCCAAATGTTGAAATGCCCAGTGGATGCGCCACCCAAGCATGGTTCCG
CCACATGCAACATTAAGAACAACGGGAAAGTTGAAGCTTTCATTTGTACT
GCAGCTTGTCAAAAAGGTTCATGGTTTCTGGAAGGTGCAAACATTCCGAA
AGTGTACAATTTGTATGTGTGTTCGATGGATGGAGCATGGCAAGGTGCAA
GTGTTTTCAACTTTGACAACTTGGTACACTCTCCTATGGTTCCTATCAAT
AGAGGAGATCCTATGTGGCCAGACTGCTCAGTGGGCAAGTCACCAAACGG
CGTGGCGCTAGATATGCAAATCTTCAGTGGCAAATGTTCAGACCAAGCCT
CTATGGAAAAGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAAAGATTTC
ATTTGGGGAGCAGCATTCTgttcacaacaacaacaatgtGATGTGGAGAA
TGCTGTTGTGTNttcttttatttcattgttccAAGAAGACAAAGAGAAGC
ACCAACAATAAAGATCAGATGGTCATCAAGTTCTCCATTTCATTGTTCCA
AGAAGACAAAGAGAAGCACCAACAATAAAGATCAGATGGTCATCAAGTTC
TCCATATCTGTTCGCAAGACATTGAATCAAGGAGTTCTCGATAAAGACAA
TCTTAAGCAGTTGAACACGTTGACACAGGCGTTGGAACTTCAAAAGACAG
CAATTGTTCAAAAGGTGACAAGCACAGCGGTCAAAGTATTGAAAGACAAC
AGTGTGAAAGTGAACTCACAAAAACCTTCCATCTCATGCAAACAAGGTTC
TGAACTCCAATCTGTGAATGGAACCATCAAGTGCTTGCAATGTCCCAGTG
GAACGTTCTATCAGAGTGAAACAAAGAAATGTACAGTTTGTCAACCAGGA
TTTTTTCAGAACAGAGAAGGTGCATTGTCATGTGAAAATTGTCCGCAAGG
TGAAACAACCAAAGGGACTTTATCATCGGATTTCCATAGATGCAAAGCGA
TTTGTCATCCTGGAACATACTCAAAGAACGGTCTTGCACCTTGCACACAA
TGCCCATCAGGAACTTACCAACCTTCTTTGGAAAGTCAGGATTGTATTAA
ATGTCCGAATTCAAATGGGAAACGACAAGGCCTAACTGATGTCAAAGATT
GCAATTTTGATGGCATCAAATACGAGATCCGTTCAGAAGGTTGTGGCGAT
GCAGGGAAAACCAGTGGATGTGGTATCTCCACCATCAAAGTGGAAGGGAA
AGATTACAGTAAACAAAGAAGAGGAATCAATTTCGTCGCAATCGATGGTA
GCAAAGGCACCATTGTGGGAAGCGCGTCATTCGATTGGCACTATTACAGA
AATGAATGCACCAATGCTTTAAAGTGGACCAACAGTCTTACTGATGGCAC
CATCGTGCTTGGAGCCTACCAGGACGAGGCCACTTTGGCGTTTACGTCTG
ATTGTCAGAAAGCATTGGAAGCGATCGGTGGTAAGCGCCCTTTCCAACGT
CAATATCGTTCGTCGTACGTCATTGTCGGGTACAAAGGAAAGACGAAGAA
GTCTTGGGTCACCCAACAAATGAGCAGTTATGGACGAGGACCCACTCAAG
TTACTGGTCGCATTTCTTTTGTCTAATAAGGATGCATAGTACATGCACGa
aaatattggaatattcttttttcttcaaactaatcattttaaaaaagata
aaaagaaaggtaCTATTCTGAAATT
Run BLAST on NCBI

protein sequence of TCONS_00001195-protein

>TCONS_00001195-protein ID=TCONS_00001195-protein|Name=TCONS_00001195-protein|organism=Clytia hemisphaerica|type=polypeptide|length=681bp
MARYTSTYLPLLIIVLHFSFVKNFCIEFHCTARYKGSYKPTTAPPTGQCI
TQVDEVIYSMKHTVKSGGCKNTLCNEVNRERLKCSCREVTNCWWASWGAW
TGSITQGTCGKQHRRRAEKDRARYVERYGSCSGVKGQCNGSYNSEDRTMC
NCRKASSCPVAPWSSWTPAVGNGQCKDQTRHQDKKPSYTYVMKEQKKGEV
ACFGIDPDCRPPRITDTRTFCKCPTKECTERSWTSWNIDTWTGSCPNEKR
TKTYDFKIKYIEAYKSCNGVGKDCPPTKNEYRKKVIKCPAIKLSLNSIHL
DKSCNGVDSSCTSVCRIDCKKGYKLIGQNHVTCHGSGKWTGKLGYCKDSE
PPTITCPKLPIPTVNNKPGTNYSIISFPNATATDNSGFPVTITTSHPSPL
KVFVHHPVEVTYTATDAVGNTNKCKRKFIVKDHEAPVVTYCPKKHRIIKT
GLFPHRVFWPMPRFTDNVEADNELVFIPSVVNGTKFYQGKHSVDIKARDK
SSNTGNCTMTFELQMLKCPVDAPPKHGSATCNIKNNGKVEAFICTAACQK
GSWFLEGANIPKVYNLYVCSMDGAWQGASVFNFDNLVHSPMVPINRGDPM
WPDCSVGKSPNGVALDMQIFSGKCSDQASMEKLKRDFVATLKKDFIWGAA
FCSQQQQCDVENAVVXSFISLFQEDKEKHQQ
Run BLAST on NCBI

transcript from alignment at sc0000007:923551..938744-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001195 ID=TCONS_00001195|Name=TCONS_00001195|organism=Clytia hemisphaerica|type=transcript|length=15194bp|location=Sequence derived from alignment at sc0000007:923551..938744- (Clytia hemisphaerica)
TCGAGTTTCAGTCCGTTATTTTGACCCCCACTGGCTGAAAAAGTCCTGCC AGGTCTGCGAGGAGGGGGTGTTTTGGAGTGTTTTTTTTTATCATAATTTT TAGTACTCCTGAAAAAGTATGAGTCGGTATATAAACAGAAAAAGGGTCTG GTTATTTAAAGTGTATTGGTCAAAGAAAAATCTTTATGAAGAAGAAATTG AACAGCTTGTCAGTGAATAAACCAAAACTCGATTACTGTTTACTTTTCCA AGTATCTCTTTCAAAAATCGAAACGTGAAAAAGAATTGGAGTTAATTTCA AGAAAAACTACAGCAATGGCACGGTATACAAGCACCTACCTACCATTGTT AATTATAGTTCTCCATTTTTCATTTGTTAAAAACTTTTGCATAGAATTTC ACTGTACTGCAAGATATAAGGGTTCGTATAAACCGACCACAGCGCCACCC ACAGGACAATGCATCACACAAGTGGATGAAGTAATTTACAGCATGAAACA TACTGTGAAGTCAGGAGGCTGCAAAAATACTCTTTGTAATGAAGTCAATC GAGAACGACTAAAATGTAAGTAGTACCCCATTTTTTGTGCCTTCCCGCTA ACATTTTCCCGATTGTTTTCTAAAAAAACAAACCTCTAACCGGGCTCTAA CCGTAATCAGGTTACAAAATAGACCTAAAGCAACCACTCCACCACGATGT TAAGATAACTGGTTCCCATAAGGTGAGCCAGTTTCTGGGCCTGAACTTTT ACACAGATCATCAGTCGGCAAATCAAATCTTGCATAGCTCGCTGAAGGTG TTTTCAAAAATTAGTATCAAATCCAACTATCCGTTGATTGGTCGGCAATG GTAGCCATCTTTACTAATTTGTAAAAACACTAGCAAGTGGAATTTGGAAG CCATTAACAAGCCTCAGACCAAGCAAAAGGTCAAGTTAGCAGATAAGACG CGAAAATTTTAATGAGAGAAAAAGAAAACTAGGCAACAGAAGAATTATTA CTGTTTGTTTTTCAACCCGAAAAGTAAAGGTTTAAAAATTTCAATTTCAA TCGAAGAAAGGTAACATCGATGATAGCGAAATGAAATATTTTCACTTGTT ACTTACTTTATTGATTCCTGAATTTTCATTGGCTGTGTGGTTTCCGAAAC CATGTGTGGAGATACGTTGCCAGGCCCGTTACGCTGGTTACCAGCCTACC GTCATCCCTGAAGGGAAATGCATCAAACAAATAAATAAAGTGGTTCACAT CAATACACCTATAGTGAAAATGGGGAGTTGCAGAAGTAAAAGATGTACGG AAGTTGATAAAACGAGAACAGCGTGTAAGTGGGTTTTGTTGAGACTTAGA AATTACCCTGACTAAACACCATTCGAATTATCAGCTCATGCTCCGATTAC GATAAAATTGGAATTGCTGATGAAATATTACCACGCACTATAATTTTCAT GAAAGAAATTCTCCAAAATTTGAAAAACGAAAATAAAAGATGAAGAAGAA AGAATGATCTTTTTATCCGTTTTCACTATAAAATGAAATTGACTTTTGGT CAAAGATATTTTGAACCTTGCTGATTCGAGAAACACTTTTCATTTCTTCC TTACATCAAAAGTTATAATTCTTGGGGAGATGAAAACAGCAAAAAAATCA AAAACCATTTAGGGCCTGTAACTTTTCATGAAGCTATGGAAAACATATTC TACAGTGAAAGGAAACGAAATGGAGCTGAAGTTTTTTCTGTTACAAGGAC AACACTTTACCAAGCTATTTTCACTCGTCTTCATCTTTAATAAGGGCAAA AATCAAAGGTTGCTAATTTCGTGTTTCCAAAGCTTTTGAGGAAAAAGAGT CAACTGTAAAACTGTAAAAGTTCTGTTTGATGTAATGTAAGTTTCATATC CTAAATTTCAGAACACATCGTAGATAAAAAAAACAAGTGATACTTTTATG GACCTACCTGGTTGTGCATTTAACAAATTTATAATTAATATCTACGTGAC GTGACCATCAAACAATCATTCAGAACACAAATAGTGACGATCTATCAAAA GTCGTTTGTTTCTTATAAAAAAACATTTGGAAACCAAAATTTCATGCTCT TGAAATATTCTTCCATATTCAAGACTTCGTGAGCAAAAAAACATCCATCT CGTCAAAAAATCGAGTAGTTTGGCTAAGAAAATTAATGTATGCTTATTAA TAGTGATTCTTATAGATAAAAATAATTTTTTGAGCTGAAAAATTCTTCTT TTACAAAAATCTGCTTGAGCCATCTATTACCTACTTTCATGCAAAAAATC AGAAAAAAACAATGATCCAATATTTCACAAAGTCCAAAAAACTCTTTTTT TTGGCCGTTTTTTAGCTGAAATTTACCCCCGGGGGGGGGCACTGGGTTTG CGGACTGACGGTATGTGCGGGCCAAAAATTGGCTTTTAAAATTGCACCCT TACAGTGCAGCAAAAATCAGAGAAAATCATACCCTTAGAGTGCATTTTCC CCCAAATTTTTGATCCCTTTCGTGCAAAAATTGGTCAAAATTCTAGCATT TTTGGTCAAAATATCTAGATTTTTCAAGAATTTTCTAAAATTTCTACCCT TACAGTGCATCTCTAGTTTTTCCGACCCTTACAGTGCATTTTAAACATAT TGGAAAAGGTACCCTTAGGACCCGCACATACCCGTCGGTTCTTTTGCCCA GCTGCCCCCCCCCCCGGGAATTTACCCCAAATTTTTTTTTCAAAAAATCG AGCTCCGTCACATTCGAGGGTTTATAGTTACACATCTTTGTGCAAATAAT CAGAAAAAACTAATGAGCTAATCTCGAGAAAAATTGGTAACGAACGAACG GACGAACGAACAGAGGTTAATCCGAGGTTAATTTATAGGACCTCCACCGG GGTAGGTCCAAAAAATTTGAAAAATACCAAGGAGCTGAAGTGTTCAAAGT GAGAAAAAAAGGACAAACTCAGTGGAAATCTATAACATAAGGCCTCTTGA ATCTTTACGTTTGCAAACTCTTAATTCTTTTCAAATGCAGGTTCATGCAG AGAGGTCACGAATTGTTGGTGGGCTAGTTGGGGAGCTTGGACAGGTTCAA TAACACAAGGGACCTGTGGAAAACAACATCGTAGACGAGCTGAGAAAGAC AGAGCAAGATATGTGGAAAGATATGGAAGTTGTAGTGGAGTAAAAGGCCA ATGCAATGGAAGTTACAACTCAGAAGATCGAACCATGTGTAAGTTATATC CTGAAGTCTTTCAGCTTTTTGTTTACATAGTTTCGGTGGCAATTTGATCT ACTAATATTAATATTTCAATTAGCCGTCCTGGAATCGTCTCTTGAGATGA CTCTTTACAATGATAATCAAGCTCGCGAGACATTAAATGTATCTCATCCT TATGAGAGATATGTAACCGATTTCCTGTATTTTCCAAGGAAAAAAAGAAC TACAATATTTTCTTGTATATTGATTGGAACATTGATTATAAAACGCAGTT TCCTGCATTTTCCAAGGAAAATTATGTATGTCTTGTAGTTTCAAAGGAAA ATTAGACAAACACATTTCTTTTTTTGGTAATAGAAACAACCTAAAGCAAA TTCTTGTATTTTCCAAGGAAAATCGGCCAAGACAATTTCTTGTATTTTCC AAGGAAAAAATTACATAAGATAAAATGTTTCAAGAAAATTGTCTAAATTA ATTTTTTGCTACTTTCACCCTTTCACCAAGTTGATTTTGCAAGAAAGTTA AAAAAGGAGTTATTTTGAAAGCAAACCGAATCGAAACTGGCATATTTTAA TAGACTAAAACTATAATTTTACAAGAATAATCCTTATGCTAGGAGTTGTT CAGCCATCGTGGCTAGCGATGGTGGGTGGACATTCGTGGGTGGCTTTGAA AGTTATTTGAAAATGAAAAAGAAAAAGAAAATGAGTGTTAAATTTCAAAG CGCTCTTGAAAATGTTCAAAAAATAAGATTAGAAAAAAGGAACGAAAAAA TGCATGTTTTCACGGTTTTCATTTTAAGGCTGAAAATTAAAGACCAAATA CAGAAAAGGCGCGAAAAAGAGTTGCCATTTCCAAAAGAATCGCTAGCGAA AAAGTTTTATGCGAGAATGAGAGAGTTCGGATTTAAGCGTATTATGATAA TGATTATTTTAAATATCAACTTCTCATACATGGAATACTGTTTTAATCTT TAGGTAAATTCTCTCCACTTTAAAAGACATTTCAGGAAATCCAGTTAAAT CATGCCTCCTATCTTTTTCATGATTTGTAGGTAATTGCAGGAAAGCAAGT AGTTGTCCAGTAGCACCATGGAGTTCGTGGACACCAGCAGTTGGTAATGG ACAATGTAAAGACCAAACACGACACCAAGACAAAAAGCCTTCATACACTT ACGTTATGAAAGAACAGAAGAAAGGAGAAGTGGCTTGCTTTGGCATCGAT CCTGATTGTCGACCACCAAGAATTACTGATACAAGAACATTCTGTAAGAT AATTTTCATCGACTCGACTTTCGAAGACAATTATTTGTTAGTTTTAGTTG GTCTGTTGTTTCATAGTCTGTGCTTCTTGCAGAAGGAATTTTCAAAATAT TTTTGAAACGAATAAGCGTTTGATTCAATCAAAAAGTGTGAGAAAGCTAT GTTAAGATCTATCAGTTTTGACAATCTCAAAGAAGCCTTCTTTTAACCGA ATACATTTCTACATTCAGGTAAATGTCCGACGAAGGAATGCACAGAGAGA AGTTGGACATCTTGGAATATCGACACATGGACGGGAAGCTGCCCAAATGA GAAGAGGACCAAAACATATGATTTCAAAATCAAATATATTGAGGCTTACA AGAGCTGCAATGGTGTAGGAAAAGATTGCCCACCTACCAAGAACGAGTAT AGAAAAAAAGGTTGACAACTTTGACTCGATGTTGTATCTTCATCATAAGT ACCTTTTAATTGTCTCTCTGATTCTTATCATTTAGCAAACATCAAATTGT GAGTTTCCGAGAAGTCAGCAGTACATATGAGCCAAATCAAAACAAAAATT TCGGGTGTTAAAATACGGCAAACTATAAACTTTTGATCTATGGTAGTACA GCGGAGTCTCCATAACTCGGACACAATTTGTTCGAGTTAAGGAGACATTT AAGTTATAGAGGTTCGAGATAAAGAGACTCCACTATATCTTACGTCATCT TCTAATATTTCCAGTGATCAAATGTCCAGCAATCAAGTTATCACTAAACT CCATCCACCTTGACAAATCATGCAATGGAGTAGACAGCTCATGTACATCT GTCTGTCGCATTGACTGTAAGAAAGGCTACAAGCTGATTGGTCAAAACCA TGTCACGTGTCACGGATCAGGAAAATGGACAGGAAAACTAGGGTATTGTA AAGGTAAGATACAATAAAACTTGTCATTGCAAACCATTCTATCGAAATTT ATCGTAGAATTTAACAATTTCTCCTGGAAAGAATTCCAATTACATGTTAT GATCAGGAACCAAGATATTCAAAATACACTATTTCCACTGAACTTCGCTC GTCTGACTTTGTTTTTCACTCATTATGGCACCATATTTTTAGATTCTGAG CCACCGACGATAACATGTCCTAAATTGCCAATTCCAACCGTCAACAACAA GCCAGGCACCAATTACTCCATCATCTCATTCCCCAATGCGACGGCAACCG ATAATTCAGGTTTTCCAGTGACAATCACCACAAGTCATCCATCACCACTG AAAGTGTTCGTTCACCATCCAGTTGAAGTTACTTACACTGCTACTGATGC TGTTGGAAACACCAATAAATGCAAACGGAAATTCATCGTCAAAGGTAGAC ATTTTTGAATATCATTACTGCCGTTGGTTATAGGTTTTGTGAGTGAGGAC AAGTTATTTTACTGAGATGAAAAGAAGTCATTGGAATTTTAACTAGACAA AAAAGATGTAAGACTGCCACCAGCACAATATGTTCTCACTTCTTTTATAC TGTTCTCACTTCTTTTATACTGTTCATACTTCTTTTATACTGTTCATACT TTTTATTGCCGGTAGCAATAATTTTGAATCTTCAAGATGTTGACAAGGCT TTATAAATGAAATGATTTCCTATTTTAAACCCTCAAACCCATTTCTAGAT CACGAGGCACCAGTTGTAACTTATTGCCCCAAAAAACATCGAATCATCAA AACAGGGTTATTCCCACACCGAGTATTTTGGCCCATGCCACGCTTCACAG ACAACGTGGAGGCTGACAACGAGTTGGTCTTCATCCCTTCCGTGGTGAAT GGAACTAAGTTCTACCAAGGGAAACACAGTGTTGATATCAAAGCCAGAGA TAAATCATCCAATACTGGAAACTGCACCATGACATTCGAGCTCCAAAGTA AGTAAACAAAAAACATGGCATTCGTTATTGTCAAAGTTAGGTAGCAAATA AAAATGAAAGGAAAGGCAATAGAGTGTCTTTGCAAATAATTAAAAAAAAA AACTAAAAACAGGTTTTACTACATAAAGAGTTTCTGATGAACATGTGAGG GCTATCGAAACTTTTAACTAATTAACTTTCTAGTGTTGAAATGCCCAGTG GATGCGCCACCCAAGCATGGTTCCGCCACATGCAACATTAAGAACAACGG GAAAGTTGAAGCTTTCATTTGTACTGCAGCTTGTCAAAAAGGTTCATGGT TTCTGGAAGGTGCAAACATTCCGAAAGTGTACAATTTGTATGTGTGTTCG ATGGATGGAGCATGGCAAGGTGCAAGTGTTTTCAACTTTGACAACTTGGT ACACTCTCCTATGGTTCCTATCAATAGAGGAGATCCTATGTGGCCAGACT GCTCAGGTATCTCTGATGATTTTCTCGGGTTCAAAGCCAAGGGTAGACTC CTAAGTGTTCACATTAACTCCTTCGCATATAATTCATCTTTGGGTTATAA TCACAATAGTGTATAAAAGATTTTAGCAGCCTATAGACACATCAAAACGA GAGGTTTAATAGTTTATTTTCTTATCTTCGAACCGAAAATAACTTTATTT ATTTACTATTTCTCCAAAATGAGACACTCACCCCCACTCAAAAAGGATAG GAAGAGAAAGACACACAAATTTTACGAGACAGGTTTCACACTTATTCTAA TAGTAATAGTCGGGTCCAAGCCTCTCAAAATAAATACATTTATTTTCCTT ACCAAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCTGT TTGGAAGAAACCGTAAGGAATTGAAAATTCGAGTTATGCTTCATAGTCAG ATACCCTCATCCTCTTCTAACTGTCCACTTACCTTTATTTTATAAAATTA TACCCAATGATTTAATAGTTTTTGTCTTGTGCTCCCTCGCACCGTATATG TGCTCCCTCACACCGTATAATGTACTCCCTCGCACCGTATATGTACTCCT TCACAATTATTTATGTATGATAATATATCATCGTCTACTTAAAATCTACA TAAATTGCTAAGGGAAGTAACTAATAGCTAATGGAACTGTGGCGAAGTTG CTAGAGTTTGCAAGAAGTTACTAGTTGAGAGCTTGCCGACGTGTGAATAG CATCACTCAGAACACCCTTTTGAATTGCACGCTTCTGATCTTTAATTTTC GGAACGCAAATTAAAACCAAAATCGACATTTTATCCGAAACCGTAAATAA ATTCATTTAGTTTGAAGATATTTTATCTTATATTACACATTTTTTTATAT AAATAACCAGCTTGTATTGGTAAGGCTAAAGGGCTCAGATTAGCCATTTT TTTTTACTATCTCGTAAAGTATAAGTTAACCATGGCAGGCCTAGCCTGGA TATCTAAGCTGTAAACTTTTTTTTCTTCTAGACGTTCCTGGTTTCCTTCA GTCTTCCTAAATCCTAAATCGATTTATATTCTAAAATCGGAGACAGCGCA TGCGTACTTTGTCGATTTAATAATTCAATAAAAGCTAAAAATTTACCGGC CCCGGGTTTACAAGCATCTAGGTAGACCAAGCTATTGAAAACATCAAAAT ACAAAGCAATTTACAGCTTGGTCATTCAGGCTACTCTTGACCCATTAAGC ATAAACATGGTATAATATCAAGGATACTTTTTCACAAAATGAGTTAGAAT ACTGAGCCCAGGCCCTGACGCGAAATTTTGAGTTTCTTATAATGAAAAAA TGTGTAATAAACCTTGTTAGCTATCATATATGTTCACAAAATTTCTGTCT TTAGTGGGCAAGTCACCAAACGGCGTGGCGCTAGATATGCAAATCTTCAG TGGCAAATGTTCAGACCAAGCCTCTATGGAAAAGTTGAAGCGTGATTTTG TCGCAACGTTGAAGAAAGATTTCATTTGGGGAGCAGCATTCTGTTCACAA CAACAACAATGTGATGTGGAGAATGCTGTTGTGTNTTCTTTTATTTCATT GTTCCAAGAAGACAAAGAGAAGCACCAACAATAAAGATCAGATGGTCATC AAGTTCTCCATTTCATTGTTCCAAGAAGACAAAGAGAAGCACCAACAATA AAGATCAGATGGTCATCAAGTTCTCCATATCTGTTCGCAAGACATTGAAT CAAGGAGTTCTCGATAAAGACAATCTTAAGCAGTTGAACACGTTGACACA GGCGTTGGAACTTCAAAAGACAGCAATTGTTCAAAAGGTATCATTTCTAC TTCCCTTTTCTCCTATGTCTTCTAGTCTGGTATGTGAACTGTTGATCGAG AACAGCCTCGTTTACAGCGTTTAATCAGATTTTCAATGCTTGCTGATAGC GCAAGATAATCTTCTTTGGCGTCTATCAAATGACGAAAATAAAGCCTAGG ATACACTGGGACAACGTTGAATCCAGAATCGGTAATATCTTCAGATAAAA GAGTTAGTGCATAACAACAGACGTAATTCTCTTACTATTTGAATTCAGGT GACAAGCACAGCGGTCAAAGTATTGAAAGACAACAGTGTGAAAGTGAACT CACAAAAACCTTCCATCTCATGCAAACAAGGTTCTGAACTCCAATCTGTG AATGGAACCATCAAGTGCTGTAAGTTCAACGAAAAGTTTTAGTAGATTTA CACTTATTTACTTAGCAAAGCCTTTTCCTTCAAATCCTCAAAATTTGGGA CTTTTCTGAATTGAATAAATGTCTCAAAACACTCGAGATCTCGAAAGTGA ATACAGTATTTGGCTTCAATTTTTTTCATCTTCTTTTACAGTGCAATGTC CCAGTGGAACGTTCTATCAGAGTGAAACAAAGAAATGTACAGTTTGTCAA CCAGGATTTTTTCAGAACAGAGAAGGTGCATTGTCATGTGAAAATTGTCC GCAAGGTGAAACAACCAAAGGGACTTTATCATCGGATTTCCATAGATGCA AAGGTAACGGCACTTCTTGTCTACCATCAAATTGTTGCCCTAAGAAAAAG TCTAATTTCAATATTCAAACACTCTTGTAATCGCCCATTTAGTCATATTT ATTAGGTCACAAAGGTTCTTTCCTGAAGTTGGGAAGTCTGCAATCTATGG TGGACTGAAAAACACTTCGAAAAATACTTCACTAATACATGTATTCAAGT AATGTTACATTTGTCACGAATGATGACATGCGGCTTTCCCTATCTACTTC GTGCTATACAAAGCGTAACAAGCGACGACTTTACACATTTCATACTACAC TTCCATGACTATTTGAAACATAACCACACTTTATTATGAATGCGTGTCAT ACTATCATACTAAACTTACACATCACCCTCTACNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTAATCACGCC CTTACGCCACAACATATCGCCCTTTATAGCGCCACACCATAATAAGACAA TGTATACAATATACCCCTCAGGTAATGGTAATTGCAATAATTTCGGTAAT CACGGTAATCACGCCCTTGTGCCACAATATATAGCCCTTTATAGCGCCAC ACCATAATAAGACAATGTATATAATATACCCCTCAGGTAATGGTAATTGC AGTAATTTCGGTAATCACGGTAATCACGCCCTTACGCCACAATATATCGC CCTTTATAGCGCCAAACCATGATAAGACAATGTATACAATATACCCCTCA GGTAATGGTAATTGCAGTAATTTCGGTAATCACGGTAATCATGCCCTTAC GCCACAACATATCGCCCTTTAAAGCGCCACACCATAATNNNNNNNNNNNN NNNNNNNNNNNNNNAATATACCCCTCAGGTAATGGTAATTGCAGTAATTT CGGTAATCACGGTAATCACGCCCTTACGCCACAACATATCGCCCTTTAAA GCGCCACACCATAATAAGACAATGTATACAATGTACCCCTCAGGCAATGG TAATTGCAGTAATTTCAGTAATCACGGTAATCACGCCCTTACGCCACAAT ATAGCGCCACACCATAATAAGACAATGTATACAATGTACCCCTCAGGTAA TGGTAATTGCAGTAATTTCGGTAATCACGGTAATCACGCCCTTACGCCAC AACATATCGCCCTTTAAAGCGCCACACCATAATAAGACAATGTATACAAT ATACCCCTCAGGTAATGGTAATTGCAGTAATTTCGGTAATCACGGTAATC ACGCCCTTACGCAGCAACATATCACCCTTTATAGCGCCACACCATAATAA GACAATGTATACAATATACCCCTCAGGTAATGGTAATTGCAGTAATTTCG GTTATCACGGTAATCACGCCCTTACGCCACAATATATCGCCCTTTATAAC GCCACACCATAATAAGACAATGTATACAATATACCCCTCAGGTAATGGTA ATTGCAGTAATTTCGGTTATCACGGTAATCACGCCCTTACGCCACAATAC ATCGCCCTTAATAGCGCCACACCATAATAATACAATGTATACAATGTGTA CCCCTCAGGTAATGGTAATTGCAGTAATTTCGGTTATCACGGTAATCACG CCCTTACGCCACAATACATCGCCCTTAATAGCGCCACACCATAATAATAC AATGTATACAATGTGTACCCCTCAGGTAATGGTAATTGCAGTAATTTCGG TTATCACGGTAATCACGCCCTTACGCCACAATACATCGCCCTTAATAGCG CCACACCATAATAATACAATGTATACAATGTGTACCCCTCAGGTAATGGT AATTGCAGTAATTTCGGTTATCACGGTAATCACGCCCTTACGCCACAATA CATCGCCCTTAATAGCGCCACACCATAATAATACAATGTATACAATGTGT ACCCCTCAGGTAATGGTAATTGCAGTAATTTCGGTTATCACGGTAATCAC GCCCTTACGCCACAATACATCGCCCTTAATAGCGCCACACCATAATAATA CAATGTATACAATGTGTACCCCTCAGGTAATGGTAATTGCAGTAATTTCG GTTATCACGGTAATCACGCCCTTACGCCACAATACATCGCCCTTAATAGC GCCACACCATAATAATACAATGTATACAATGTGTACCCCTCAGGTAATGG TAATTGCAGTAATTTCGGTTATCACGGTAATCACGCCCTTACGCCACAAT ACATCGCCCTTAATAGCGCCACACCATAATAATACAATGTATACAATGTG TACCCCTCAGGTAATGGTAATTGCAGTAATTTCGGTTATCACGGTAATCA CGCCCTTACGCCACAATACATCGCCCTTAATAGCGCCACACCATAATAAT ACAATGTATACAATGTGTACCCCTCAGGTAATGGTAATTGCAGTAATTTC GGTTATCACGGTAATCACGCCCTTACGCCACAATACATCGCCCTTAATAG CGCCACACCATAATAATACAATGTATACAATGTGTACCCCTCAGGTAATG GTAATTGCAGTAATTTCGGTTATCACGGTAATCACGCCCTTACGCCACAA TACATCGCCCTTAATAGCGCCACACCATAATAATACAATGTATACAATGT GTACCCCTCAGGTAATGGTAATTGCAGTAATTTCGGTTATCACGGTAATC ACGCCCTTACGCCACAATACATCGCCCTTAATAGCGCCACACCATAATAA TACAATGTATACAATGTGTACCCCTCAGGTAATGGTAATTGCAGTAATTT CGGTTATCACGGTAATCACGCCCTTACGCCACAATACATCGCCCTTAATA GCGCCACACCATAATAATACAATGTATACAATGTGTACCCCTCAGGTAAT GGTAATTGCAGTAATTTCGGTTATCACGGTAATCACGCCCTTACGCCACA ATACATCGCCCTTAATAGCGCCACACCATAATAATACAATGTATACAATG TGTACCCCTCAGGTAATGGTAATTGCAGTAATTTCGGTTATCACGGTAAT CACGCCCTTACGCCACAATATATCGCCCTTTATAGCGCCACACCATAATA AGACAATGTATACAATATACCCCTCAGGTAATGGTAATAATTGCAGTAAT TTCGGTAATCACGGTAATCACGCCCTTACGCCACAATACATCGCCCTTAA TAGCGCCACACCATAATAATACAATGTATACAATGTGTACCCCTCAGGTA ATGGTAATTGCAGTAATTTCGGTAATCACGGTAATCACGCCCTTACGCCA CAACATATCGCCCTTTAAAGCGCCACACCATAATAAGACAATGTATACAA TATACCCCTCAGGTAATGGTAATAATTGCAGTAATCTCGGTAATCACGGT AATCACGCCCTTACGCTACAATATATCGCCCTTTATAGCGCCACACCATA ATAAGACAATGTATACAATATACCCCTCAGGTAATGGTAATTGCAGTAAT TTCGGTAATCACGGTAATCCCACCCTTACGCCACAACATATCACCCTTTA TAGCGCCACACCAATGTATACAATATACCCCTCAGGTAATGGTAATTACC ATTACCTGAGGGGTGTATTGTATACATTGTCTTATTATGGTGTGGCGCTT TAAAGGGTGATATGTTGCTGCGTAAGGGCGTGATTACCGTGATNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCA TGTCATCATTCGTGACAAATGTAACATTACTTGAATACATGTATTAGTGA AGTATTTTTCGAAGTGTTTTTCAGTCCACCATAGATTGCAGACTTCCCCT GAAGTTGACCTCTTCATCAGCTATAACATTAACCGTTTCAGCGATTTGTC ATCCTGGAACATACTCAAAGAACGGTCTTGCACCTTGCACACAATGCCCA TCAGGAACTTACCAACCTTCTTTGGAAAGTCAGGATTGTATTAAATGTCC GAATTCAAATGGGAAACGACAAGGCCTAACTGATGTCAAAGATTGCAATT TTGGTAAGATAAATGATTATAATAGAGGTGCTGTTTTACCTTTTTGTGAA AAAAACTGAACAAGCCGGGGGGGAATCATAAGGGAATAAATTTCGTAAGG GGAAATTTGACCATACCTTCACACTCTATAGAGGGCAGCAATACTTTCTT TTCCATTTCCTTGGAAATGCCATCTTATTTGTTCATTCTTTATAGCAGGT AACCTATATTTCTTATTGCTCCGACAACTATATGTTAAAGTTTACATTTC CTTCTAAAATGATCACTACAGATGGCATCAAATACGAGATCCGTTCAGAA GGTTGTGGCGATGCAGGGAAAACCAGTGGATGTGGTATCTCCACCATCAA AGTGGAAGGGAAAGATTACAGTAAACAAAGAAGAGGAATCAATTTCGTCG CAATCGATGGTAGCAAAGGTAAGATCACTCATGATTACTCATGCATTCTA AAATGATCGCCTAAATCATAGAGCTGGTCTTATATGTTCTCATCGAAAAT CTTTTTTTTGTTTTATTGAAGGCACCATTGTGGGAAGCGCGTCATTCGAT TGGCACTATTACAGAAATGAATGCACCAATGCTTTAAAGTGGACCAACAG TCTTACTGATGGGTTAGTACATCTACATCCTGCTGAAACCCAATTTGTAA TTCAGCTTAAAAGTAATCATAAAAGATCTAAGATATCATATTATTGCAAG CTGAAAACATTCCTTACCAGGTAAAATTCGGAAAATAATCACAGTTGCCA ATAGAAACTTTGTCCAATAAGCGAACGTTTTAATTTGCACCTGACTGGTT TACATACTCAGTTTTGAAAGGTATGTTTTTTAAATGACATTAGTTAGTTT GACTTTCAATTTATAGCACCATCGTGCTTGGAGCCTACCAGGACGAGGCC ACTTTGGCGTTTACGTCTGATTGTCAGAAAGCATTGGAAGCGATCGGTGG TAAGCGCCCTTTCCAACGTCAATATCGTTCGTCGTACGTCATTGTCGGGT ACAAAGGAAAGACGAAGAAGTCTTGGGTCACCCAACAAATGAGCAGTTAT GGACGAGGACCCACTCAAGTTACTGGTCGCATTTCTTTTGTCTAATAAGG ATGCATAGTACATGCACGAAAATATTGGAATATTCTTTTTTCTTCAAACT AATCATTTTAAAAAAGATAAAAAGAAAGGTACTATTCTGAAATT

Coding sequence (CDS) from alignment at sc0000007:923551..938744-

>TCONS_00001195 ID=TCONS_00001195|Name=TCONS_00001195|organism=Clytia hemisphaerica|type=CDS|length=18414bp|location=Sequence derived from alignment at sc0000007:923551..938744- (Clytia hemisphaerica)
TGGGCAAGTCACCAAACGGCGTGGCGCTAGATATGCAAATCTTCAGTGGC
AAATGTTCAGACCAAGCCTCTATGGAAAAGTTGAAGCGTGATTTTGTCGC
AACGTTGAAGAAAGATTTCATTTGGGGAGCAGCATTCTGTTCACAACAAC
AACAATGTGATGTGGAGAATGCTGTTGTGTNTTCTTTTATTTCATTGTTC
CAAGAAGACAAAGAGAAGCACCAACAATAATGTTGAAATGCCCAGTGGAT
GCGCCACCCAAGCATGGTTCCGCCACATGCAACATTAAGAACAACGGGAA
AGTTGAAGCTTTCATTTGTACTGCAGCTTGTCAAAAAGGTTCATGGTTTC
TGGAAGGTGCAAACATTCCGAAAGTGTACAATTTGTATGTGTGTTCGATG
GATGGAGCATGGCAAGGTGCAAGTGTTTTCAACTTTGACAACTTGGTACA
CTCTCCTATGGTTCCTATCAATAGAGGAGATCCTATGTGGCCAGACTGCT
CAGATCACGAGGCACCAGTTGTAACTTATTGCCCCAAAAAACATCGAATC
ATCAAAACAGGGTTATTCCCACACCGAGTATTTTGGCCCATGCCACGCTT
CACAGACAACGTGGAGGCTGACAACGAGTTGGTCTTCATCCCTTCCGTGG
TGAATGGAACTAAGTTCTACCAAGGGAAACACAGTGTTGATATCAAAGCC
AGAGATAAATCATCCAATACTGGAAACTGCACCATGACATTCGAGCTCCA
AAATTCTGAGCCACCGACGATAACATGTCCTAAATTGCCAATTCCAACCG
TCAACAACAAGCCAGGCACCAATTACTCCATCATCTCATTCCCCAATGCG
ACGGCAACCGATAATTCAGGTTTTCCAGTGACAATCACCACAAGTCATCC
ATCACCACTGAAAGTGTTCGTTCACCATCCAGTTGAAGTTACTTACACTG
CTACTGATGCTGTTGGAAACACCAATAAATGCAAACGGAAATTCATCGTC
AAAGTGATCAAATGTCCAGCAATCAAGTTATCACTAAACTCCATCCACCT
TGACAAATCATGCAATGGAGTAGACAGCTCATGTACATCTGTCTGTCGCA
TTGACTGTAAGAAAGGCTACAAGCTGATTGGTCAAAACCATGTCACGTGT
CACGGATCAGGAAAATGGACAGGAAAACTAGGGTATTGTAAAGGTAAATG
TCCGACGAAGGAATGCACAGAGAGAAGTTGGACATCTTGGAATATCGACA
CATGGACGGGAAGCTGCCCAAATGAGAAGAGGACCAAAACATATGATTTC
AAAATCAAATATATTGAGGCTTACAAGAGCTGCAATGGTGTAGGAAAAGA
TTGCCCACCTACCAAGAACGAGTATAGAAAAAAAGGTAATTGCAGGAAAG
CAAGTAGTTGTCCAGTAGCACCATGGAGTTCGTGGACACCAGCAGTTGGT
AATGGACAATGTAAAGACCAAACACGACACCAAGACAAAAAGCCTTCATA
CACTTACGTTATGAAAGAACAGAAGAAAGGAGAAGTGGCTTGCTTTGGCA
TCGATCCTGATTGTCGACCACCAAGAATTACTGATACAAGAACATTCTGT
TCATGCAGAGAGGTCACGAATTGTTGGTGGGCTAGTTGGGGAGCTTGGAC
AGGTTCAATAACACAAGGGACCTGTGGAAAACAACATCGTAGACGAGCTG
AGAAAGACAGAGCAAGATATGTGGAAAGATATGGAAGTTGTAGTGGAGTA
AAAGGCCAATGCAATGGAAGTTACAACTCAGAAGATCGAACCATGTATGG
CACGGTATACAAGCACCTACCTACCATTGTTAATTATAGTTCTCCATTTT
TCATTTGTTAAAAACTTTTGCATAGAATTTCACTGTACTGCAAGATATAA
GGGTTCGTATAAACCGACCACAGCGCCACCCACAGGACAATGCATCACAC
AAGTGGATGAAGTAATTTACAGCATGAAACATACTGTGAAGTCAGGAGGC
TGCAAAAATACTCTTTGTAATGAAGTCAATCGAGAACGACTAAAATTGGG
CAAGTCACCAAACGGCGTGGCGCTAGATATGCAAATCTTCAGTGGCAAAT
GTTCAGACCAAGCCTCTATGGAAAAGTTGAAGCGTGATTTTGTCGCAACG
TTGAAGAAAGATTTCATTTGGGGAGCAGCATTCTGTTCACAACAACAACA
ATGTGATGTGGAGAATGCTGTTGTGTNTTCTTTTATTTCATTGTTCCAAG
AAGACAAAGAGAAGCACCAACAATAATGTTGAAATGCCCAGTGGATGCGC
CACCCAAGCATGGTTCCGCCACATGCAACATTAAGAACAACGGGAAAGTT
GAAGCTTTCATTTGTACTGCAGCTTGTCAAAAAGGTTCATGGTTTCTGGA
AGGTGCAAACATTCCGAAAGTGTACAATTTGTATGTGTGTTCGATGGATG
GAGCATGGCAAGGTGCAAGTGTTTTCAACTTTGACAACTTGGTACACTCT
CCTATGGTTCCTATCAATAGAGGAGATCCTATGTGGCCAGACTGCTCAGA
TCACGAGGCACCAGTTGTAACTTATTGCCCCAAAAAACATCGAATCATCA
AAACAGGGTTATTCCCACACCGAGTATTTTGGCCCATGCCACGCTTCACA
GACAACGTGGAGGCTGACAACGAGTTGGTCTTCATCCCTTCCGTGGTGAA
TGGAACTAAGTTCTACCAAGGGAAACACAGTGTTGATATCAAAGCCAGAG
ATAAATCATCCAATACTGGAAACTGCACCATGACATTCGAGCTCCAAAAT
TCTGAGCCACCGACGATAACATGTCCTAAATTGCCAATTCCAACCGTCAA
CAACAAGCCAGGCACCAATTACTCCATCATCTCATTCCCCAATGCGACGG
CAACCGATAATTCAGGTTTTCCAGTGACAATCACCACAAGTCATCCATCA
CCACTGAAAGTGTTCGTTCACCATCCAGTTGAAGTTACTTACACTGCTAC
TGATGCTGTTGGAAACACCAATAAATGCAAACGGAAATTCATCGTCAAAG
TGATCAAATGTCCAGCAATCAAGTTATCACTAAACTCCATCCACCTTGAC
AAATCATGCAATGGAGTAGACAGCTCATGTACATCTGTCTGTCGCATTGA
CTGTAAGAAAGGCTACAAGCTGATTGGTCAAAACCATGTCACGTGTCACG
GATCAGGAAAATGGACAGGAAAACTAGGGTATTGTAAAGGTAAATGTCCG
ACGAAGGAATGCACAGAGAGAAGTTGGACATCTTGGAATATCGACACATG
GACGGGAAGCTGCCCAAATGAGAAGAGGACCAAAACATATGATTTCAAAA
TCAAATATATTGAGGCTTACAAGAGCTGCAATGGTGTAGGAAAAGATTGC
CCACCTACCAAGAACGAGTATAGAAAAAAAGGTAATTGCAGGAAAGCAAG
TAGTTGTCCAGTAGCACCATGGAGTTCGTGGACACCAGCAGTTGGTAATG
GACAATGTAAAGACCAAACACGACACCAAGACAAAAAGCCTTCATACACT
TACGTTATGAAAGAACAGAAGAAAGGAGAAGTGGCTTGCTTTGGCATCGA
TCCTGATTGTCGACCACCAAGAATTACTGATACAAGAACATTCTGTTCAT
GCAGAGAGGTCACGAATTGTTGGTGGGCTAGTTGGGGAGCTTGGACAGGT
TCAATAACACAAGGGACCTGTGGAAAACAACATCGTAGACGAGCTGAGAA
AGACAGAGCAAGATATGTGGAAAGATATGGAAGTTGTAGTGGAGTAAAAG
GCCAATGCAATGGAAGTTACAACTCAGAAGATCGAACCATGTATGGCACG
GTATACAAGCACCTACCTACCATTGTTAATTATAGTTCTCCATTTTTCAT
TTGTTAAAAACTTTTGCATAGAATTTCACTGTACTGCAAGATATAAGGGT
TCGTATAAACCGACCACAGCGCCACCCACAGGACAATGCATCACACAAGT
GGATGAAGTAATTTACAGCATGAAACATACTGTGAAGTCAGGAGGCTGCA
AAAATACTCTTTGTAATGAAGTCAATCGAGAACGACTAAAATTGGGCAAG
TCACCAAACGGCGTGGCGCTAGATATGCAAATCTTCAGTGGCAAATGTTC
AGACCAAGCCTCTATGGAAAAGTTGAAGCGTGATTTTGTCGCAACGTTGA
AGAAAGATTTCATTTGGGGAGCAGCATTCTGTTCACAACAACAACAATGT
GATGTGGAGAATGCTGTTGTGTNTTCTTTTATTTCATTGTTCCAAGAAGA
CAAAGAGAAGCACCAACAATAATGTTGAAATGCCCAGTGGATGCGCCACC
CAAGCATGGTTCCGCCACATGCAACATTAAGAACAACGGGAAAGTTGAAG
CTTTCATTTGTACTGCAGCTTGTCAAAAAGGTTCATGGTTTCTGGAAGGT
GCAAACATTCCGAAAGTGTACAATTTGTATGTGTGTTCGATGGATGGAGC
ATGGCAAGGTGCAAGTGTTTTCAACTTTGACAACTTGGTACACTCTCCTA
TGGTTCCTATCAATAGAGGAGATCCTATGTGGCCAGACTGCTCAGATCAC
GAGGCACCAGTTGTAACTTATTGCCCCAAAAAACATCGAATCATCAAAAC
AGGGTTATTCCCACACCGAGTATTTTGGCCCATGCCACGCTTCACAGACA
ACGTGGAGGCTGACAACGAGTTGGTCTTCATCCCTTCCGTGGTGAATGGA
ACTAAGTTCTACCAAGGGAAACACAGTGTTGATATCAAAGCCAGAGATAA
ATCATCCAATACTGGAAACTGCACCATGACATTCGAGCTCCAAAATTCTG
AGCCACCGACGATAACATGTCCTAAATTGCCAATTCCAACCGTCAACAAC
AAGCCAGGCACCAATTACTCCATCATCTCATTCCCCAATGCGACGGCAAC
CGATAATTCAGGTTTTCCAGTGACAATCACCACAAGTCATCCATCACCAC
TGAAAGTGTTCGTTCACCATCCAGTTGAAGTTACTTACACTGCTACTGAT
GCTGTTGGAAACACCAATAAATGCAAACGGAAATTCATCGTCAAAGTGAT
CAAATGTCCAGCAATCAAGTTATCACTAAACTCCATCCACCTTGACAAAT
CATGCAATGGAGTAGACAGCTCATGTACATCTGTCTGTCGCATTGACTGT
AAGAAAGGCTACAAGCTGATTGGTCAAAACCATGTCACGTGTCACGGATC
AGGAAAATGGACAGGAAAACTAGGGTATTGTAAAGGTAAATGTCCGACGA
AGGAATGCACAGAGAGAAGTTGGACATCTTGGAATATCGACACATGGACG
GGAAGCTGCCCAAATGAGAAGAGGACCAAAACATATGATTTCAAAATCAA
ATATATTGAGGCTTACAAGAGCTGCAATGGTGTAGGAAAAGATTGCCCAC
CTACCAAGAACGAGTATAGAAAAAAAGGTAATTGCAGGAAAGCAAGTAGT
TGTCCAGTAGCACCATGGAGTTCGTGGACACCAGCAGTTGGTAATGGACA
ATGTAAAGACCAAACACGACACCAAGACAAAAAGCCTTCATACACTTACG
TTATGAAAGAACAGAAGAAAGGAGAAGTGGCTTGCTTTGGCATCGATCCT
GATTGTCGACCACCAAGAATTACTGATACAAGAACATTCTGTTCATGCAG
AGAGGTCACGAATTGTTGGTGGGCTAGTTGGGGAGCTTGGACAGGTTCAA
TAACACAAGGGACCTGTGGAAAACAACATCGTAGACGAGCTGAGAAAGAC
AGAGCAAGATATGTGGAAAGATATGGAAGTTGTAGTGGAGTAAAAGGCCA
ATGCAATGGAAGTTACAACTCAGAAGATCGAACCATGTATGGCACGGTAT
ACAAGCACCTACCTACCATTGTTAATTATAGTTCTCCATTTTTCATTTGT
TAAAAACTTTTGCATAGAATTTCACTGTACTGCAAGATATAAGGGTTCGT
ATAAACCGACCACAGCGCCACCCACAGGACAATGCATCACACAAGTGGAT
GAAGTAATTTACAGCATGAAACATACTGTGAAGTCAGGAGGCTGCAAAAA
TACTCTTTGTAATGAAGTCAATCGAGAACGACTAAAATTGGGCAAGTCAC
CAAACGGCGTGGCGCTAGATATGCAAATCTTCAGTGGCAAATGTTCAGAC
CAAGCCTCTATGGAAAAGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAA
AGATTTCATTTGGGGAGCAGCATTCTGTTCACAACAACAACAATGTGATG
TGGAGAATGCTGTTGTGTNTTCTTTTATTTCATTGTTCCAAGAAGACAAA
GAGAAGCACCAACAATAATGTTGAAATGCCCAGTGGATGCGCCACCCAAG
CATGGTTCCGCCACATGCAACATTAAGAACAACGGGAAAGTTGAAGCTTT
CATTTGTACTGCAGCTTGTCAAAAAGGTTCATGGTTTCTGGAAGGTGCAA
ACATTCCGAAAGTGTACAATTTGTATGTGTGTTCGATGGATGGAGCATGG
CAAGGTGCAAGTGTTTTCAACTTTGACAACTTGGTACACTCTCCTATGGT
TCCTATCAATAGAGGAGATCCTATGTGGCCAGACTGCTCAGATCACGAGG
CACCAGTTGTAACTTATTGCCCCAAAAAACATCGAATCATCAAAACAGGG
TTATTCCCACACCGAGTATTTTGGCCCATGCCACGCTTCACAGACAACGT
GGAGGCTGACAACGAGTTGGTCTTCATCCCTTCCGTGGTGAATGGAACTA
AGTTCTACCAAGGGAAACACAGTGTTGATATCAAAGCCAGAGATAAATCA
TCCAATACTGGAAACTGCACCATGACATTCGAGCTCCAAAATTCTGAGCC
ACCGACGATAACATGTCCTAAATTGCCAATTCCAACCGTCAACAACAAGC
CAGGCACCAATTACTCCATCATCTCATTCCCCAATGCGACGGCAACCGAT
AATTCAGGTTTTCCAGTGACAATCACCACAAGTCATCCATCACCACTGAA
AGTGTTCGTTCACCATCCAGTTGAAGTTACTTACACTGCTACTGATGCTG
TTGGAAACACCAATAAATGCAAACGGAAATTCATCGTCAAAGTGATCAAA
TGTCCAGCAATCAAGTTATCACTAAACTCCATCCACCTTGACAAATCATG
CAATGGAGTAGACAGCTCATGTACATCTGTCTGTCGCATTGACTGTAAGA
AAGGCTACAAGCTGATTGGTCAAAACCATGTCACGTGTCACGGATCAGGA
AAATGGACAGGAAAACTAGGGTATTGTAAAGGTAAATGTCCGACGAAGGA
ATGCACAGAGAGAAGTTGGACATCTTGGAATATCGACACATGGACGGGAA
GCTGCCCAAATGAGAAGAGGACCAAAACATATGATTTCAAAATCAAATAT
ATTGAGGCTTACAAGAGCTGCAATGGTGTAGGAAAAGATTGCCCACCTAC
CAAGAACGAGTATAGAAAAAAAGGTAATTGCAGGAAAGCAAGTAGTTGTC
CAGTAGCACCATGGAGTTCGTGGACACCAGCAGTTGGTAATGGACAATGT
AAAGACCAAACACGACACCAAGACAAAAAGCCTTCATACACTTACGTTAT
GAAAGAACAGAAGAAAGGAGAAGTGGCTTGCTTTGGCATCGATCCTGATT
GTCGACCACCAAGAATTACTGATACAAGAACATTCTGTTCATGCAGAGAG
GTCACGAATTGTTGGTGGGCTAGTTGGGGAGCTTGGACAGGTTCAATAAC
ACAAGGGACCTGTGGAAAACAACATCGTAGACGAGCTGAGAAAGACAGAG
CAAGATATGTGGAAAGATATGGAAGTTGTAGTGGAGTAAAAGGCCAATGC
AATGGAAGTTACAACTCAGAAGATCGAACCATGTATGGCACGGTATACAA
GCACCTACCTACCATTGTTAATTATAGTTCTCCATTTTTCATTTGTTAAA
AACTTTTGCATAGAATTTCACTGTACTGCAAGATATAAGGGTTCGTATAA
ACCGACCACAGCGCCACCCACAGGACAATGCATCACACAAGTGGATGAAG
TAATTTACAGCATGAAACATACTGTGAAGTCAGGAGGCTGCAAAAATACT
CTTTGTAATGAAGTCAATCGAGAACGACTAAAATTGGGCAAGTCACCAAA
CGGCGTGGCGCTAGATATGCAAATCTTCAGTGGCAAATGTTCAGACCAAG
CCTCTATGGAAAAGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAAAGAT
TTCATTTGGGGAGCAGCATTCTGTTCACAACAACAACAATGTGATGTGGA
GAATGCTGTTGTGTNTTCTTTTATTTCATTGTTCCAAGAAGACAAAGAGA
AGCACCAACAATAATGTTGAAATGCCCAGTGGATGCGCCACCCAAGCATG
GTTCCGCCACATGCAACATTAAGAACAACGGGAAAGTTGAAGCTTTCATT
TGTACTGCAGCTTGTCAAAAAGGTTCATGGTTTCTGGAAGGTGCAAACAT
TCCGAAAGTGTACAATTTGTATGTGTGTTCGATGGATGGAGCATGGCAAG
GTGCAAGTGTTTTCAACTTTGACAACTTGGTACACTCTCCTATGGTTCCT
ATCAATAGAGGAGATCCTATGTGGCCAGACTGCTCAGATCACGAGGCACC
AGTTGTAACTTATTGCCCCAAAAAACATCGAATCATCAAAACAGGGTTAT
TCCCACACCGAGTATTTTGGCCCATGCCACGCTTCACAGACAACGTGGAG
GCTGACAACGAGTTGGTCTTCATCCCTTCCGTGGTGAATGGAACTAAGTT
CTACCAAGGGAAACACAGTGTTGATATCAAAGCCAGAGATAAATCATCCA
ATACTGGAAACTGCACCATGACATTCGAGCTCCAAAATTCTGAGCCACCG
ACGATAACATGTCCTAAATTGCCAATTCCAACCGTCAACAACAAGCCAGG
CACCAATTACTCCATCATCTCATTCCCCAATGCGACGGCAACCGATAATT
CAGGTTTTCCAGTGACAATCACCACAAGTCATCCATCACCACTGAAAGTG
TTCGTTCACCATCCAGTTGAAGTTACTTACACTGCTACTGATGCTGTTGG
AAACACCAATAAATGCAAACGGAAATTCATCGTCAAAGTGATCAAATGTC
CAGCAATCAAGTTATCACTAAACTCCATCCACCTTGACAAATCATGCAAT
GGAGTAGACAGCTCATGTACATCTGTCTGTCGCATTGACTGTAAGAAAGG
CTACAAGCTGATTGGTCAAAACCATGTCACGTGTCACGGATCAGGAAAAT
GGACAGGAAAACTAGGGTATTGTAAAGGTAAATGTCCGACGAAGGAATGC
ACAGAGAGAAGTTGGACATCTTGGAATATCGACACATGGACGGGAAGCTG
CCCAAATGAGAAGAGGACCAAAACATATGATTTCAAAATCAAATATATTG
AGGCTTACAAGAGCTGCAATGGTGTAGGAAAAGATTGCCCACCTACCAAG
AACGAGTATAGAAAAAAAGGTAATTGCAGGAAAGCAAGTAGTTGTCCAGT
AGCACCATGGAGTTCGTGGACACCAGCAGTTGGTAATGGACAATGTAAAG
ACCAAACACGACACCAAGACAAAAAGCCTTCATACACTTACGTTATGAAA
GAACAGAAGAAAGGAGAAGTGGCTTGCTTTGGCATCGATCCTGATTGTCG
ACCACCAAGAATTACTGATACAAGAACATTCTGTTCATGCAGAGAGGTCA
CGAATTGTTGGTGGGCTAGTTGGGGAGCTTGGACAGGTTCAATAACACAA
GGGACCTGTGGAAAACAACATCGTAGACGAGCTGAGAAAGACAGAGCAAG
ATATGTGGAAAGATATGGAAGTTGTAGTGGAGTAAAAGGCCAATGCAATG
GAAGTTACAACTCAGAAGATCGAACCATGTATGGCACGGTATACAAGCAC
CTACCTACCATTGTTAATTATAGTTCTCCATTTTTCATTTGTTAAAAACT
TTTGCATAGAATTTCACTGTACTGCAAGATATAAGGGTTCGTATAAACCG
ACCACAGCGCCACCCACAGGACAATGCATCACACAAGTGGATGAAGTAAT
TTACAGCATGAAACATACTGTGAAGTCAGGAGGCTGCAAAAATACTCTTT
GTAATGAAGTCAATCGAGAACGACTAAAATTGGGCAAGTCACCAAACGGC
GTGGCGCTAGATATGCAAATCTTCAGTGGCAAATGTTCAGACCAAGCCTC
TATGGAAAAGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAAAGATTTCA
TTTGGGGAGCAGCATTCTGTTCACAACAACAACAATGTGATGTGGAGAAT
GCTGTTGTGTNTTCTTTTATTTCATTGTTCCAAGAAGACAAAGAGAAGCA
CCAACAATAATGTTGAAATGCCCAGTGGATGCGCCACCCAAGCATGGTTC
CGCCACATGCAACATTAAGAACAACGGGAAAGTTGAAGCTTTCATTTGTA
CTGCAGCTTGTCAAAAAGGTTCATGGTTTCTGGAAGGTGCAAACATTCCG
AAAGTGTACAATTTGTATGTGTGTTCGATGGATGGAGCATGGCAAGGTGC
AAGTGTTTTCAACTTTGACAACTTGGTACACTCTCCTATGGTTCCTATCA
ATAGAGGAGATCCTATGTGGCCAGACTGCTCAGATCACGAGGCACCAGTT
GTAACTTATTGCCCCAAAAAACATCGAATCATCAAAACAGGGTTATTCCC
ACACCGAGTATTTTGGCCCATGCCACGCTTCACAGACAACGTGGAGGCTG
ACAACGAGTTGGTCTTCATCCCTTCCGTGGTGAATGGAACTAAGTTCTAC
CAAGGGAAACACAGTGTTGATATCAAAGCCAGAGATAAATCATCCAATAC
TGGAAACTGCACCATGACATTCGAGCTCCAAAATTCTGAGCCACCGACGA
TAACATGTCCTAAATTGCCAATTCCAACCGTCAACAACAAGCCAGGCACC
AATTACTCCATCATCTCATTCCCCAATGCGACGGCAACCGATAATTCAGG
TTTTCCAGTGACAATCACCACAAGTCATCCATCACCACTGAAAGTGTTCG
TTCACCATCCAGTTGAAGTTACTTACACTGCTACTGATGCTGTTGGAAAC
ACCAATAAATGCAAACGGAAATTCATCGTCAAAGTGATCAAATGTCCAGC
AATCAAGTTATCACTAAACTCCATCCACCTTGACAAATCATGCAATGGAG
TAGACAGCTCATGTACATCTGTCTGTCGCATTGACTGTAAGAAAGGCTAC
AAGCTGATTGGTCAAAACCATGTCACGTGTCACGGATCAGGAAAATGGAC
AGGAAAACTAGGGTATTGTAAAGGTAAATGTCCGACGAAGGAATGCACAG
AGAGAAGTTGGACATCTTGGAATATCGACACATGGACGGGAAGCTGCCCA
AATGAGAAGAGGACCAAAACATATGATTTCAAAATCAAATATATTGAGGC
TTACAAGAGCTGCAATGGTGTAGGAAAAGATTGCCCACCTACCAAGAACG
AGTATAGAAAAAAAGGTAATTGCAGGAAAGCAAGTAGTTGTCCAGTAGCA
CCATGGAGTTCGTGGACACCAGCAGTTGGTAATGGACAATGTAAAGACCA
AACACGACACCAAGACAAAAAGCCTTCATACACTTACGTTATGAAAGAAC
AGAAGAAAGGAGAAGTGGCTTGCTTTGGCATCGATCCTGATTGTCGACCA
CCAAGAATTACTGATACAAGAACATTCTGTTCATGCAGAGAGGTCACGAA
TTGTTGGTGGGCTAGTTGGGGAGCTTGGACAGGTTCAATAACACAAGGGA
CCTGTGGAAAACAACATCGTAGACGAGCTGAGAAAGACAGAGCAAGATAT
GTGGAAAGATATGGAAGTTGTAGTGGAGTAAAAGGCCAATGCAATGGAAG
TTACAACTCAGAAGATCGAACCATGTATGGCACGGTATACAAGCACCTAC
CTACCATTGTTAATTATAGTTCTCCATTTTTCATTTGTTAAAAACTTTTG
CATAGAATTTCACTGTACTGCAAGATATAAGGGTTCGTATAAACCGACCA
CAGCGCCACCCACAGGACAATGCATCACACAAGTGGATGAAGTAATTTAC
AGCATGAAACATACTGTGAAGTCAGGAGGCTGCAAAAATACTCTTTGTAA
TGAAGTCAATCGAGAACGACTAAAATTGGGCAAGTCACCAAACGGCGTGG
CGCTAGATATGCAAATCTTCAGTGGCAAATGTTCAGACCAAGCCTCTATG
GAAAAGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAAAGATTTCATTTG
GGGAGCAGCATTCTGTTCACAACAACAACAATGTGATGTGGAGAATGCTG
TTGTGTNTTCTTTTATTTCATTGTTCCAAGAAGACAAAGAGAAGCACCAA
CAATAATGTTGAAATGCCCAGTGGATGCGCCACCCAAGCATGGTTCCGCC
ACATGCAACATTAAGAACAACGGGAAAGTTGAAGCTTTCATTTGTACTGC
AGCTTGTCAAAAAGGTTCATGGTTTCTGGAAGGTGCAAACATTCCGAAAG
TGTACAATTTGTATGTGTGTTCGATGGATGGAGCATGGCAAGGTGCAAGT
GTTTTCAACTTTGACAACTTGGTACACTCTCCTATGGTTCCTATCAATAG
AGGAGATCCTATGTGGCCAGACTGCTCAGATCACGAGGCACCAGTTGTAA
CTTATTGCCCCAAAAAACATCGAATCATCAAAACAGGGTTATTCCCACAC
CGAGTATTTTGGCCCATGCCACGCTTCACAGACAACGTGGAGGCTGACAA
CGAGTTGGTCTTCATCCCTTCCGTGGTGAATGGAACTAAGTTCTACCAAG
GGAAACACAGTGTTGATATCAAAGCCAGAGATAAATCATCCAATACTGGA
AACTGCACCATGACATTCGAGCTCCAAAATTCTGAGCCACCGACGATAAC
ATGTCCTAAATTGCCAATTCCAACCGTCAACAACAAGCCAGGCACCAATT
ACTCCATCATCTCATTCCCCAATGCGACGGCAACCGATAATTCAGGTTTT
CCAGTGACAATCACCACAAGTCATCCATCACCACTGAAAGTGTTCGTTCA
CCATCCAGTTGAAGTTACTTACACTGCTACTGATGCTGTTGGAAACACCA
ATAAATGCAAACGGAAATTCATCGTCAAAGTGATCAAATGTCCAGCAATC
AAGTTATCACTAAACTCCATCCACCTTGACAAATCATGCAATGGAGTAGA
CAGCTCATGTACATCTGTCTGTCGCATTGACTGTAAGAAAGGCTACAAGC
TGATTGGTCAAAACCATGTCACGTGTCACGGATCAGGAAAATGGACAGGA
AAACTAGGGTATTGTAAAGGTAAATGTCCGACGAAGGAATGCACAGAGAG
AAGTTGGACATCTTGGAATATCGACACATGGACGGGAAGCTGCCCAAATG
AGAAGAGGACCAAAACATATGATTTCAAAATCAAATATATTGAGGCTTAC
AAGAGCTGCAATGGTGTAGGAAAAGATTGCCCACCTACCAAGAACGAGTA
TAGAAAAAAAGGTAATTGCAGGAAAGCAAGTAGTTGTCCAGTAGCACCAT
GGAGTTCGTGGACACCAGCAGTTGGTAATGGACAATGTAAAGACCAAACA
CGACACCAAGACAAAAAGCCTTCATACACTTACGTTATGAAAGAACAGAA
GAAAGGAGAAGTGGCTTGCTTTGGCATCGATCCTGATTGTCGACCACCAA
GAATTACTGATACAAGAACATTCTGTTCATGCAGAGAGGTCACGAATTGT
TGGTGGGCTAGTTGGGGAGCTTGGACAGGTTCAATAACACAAGGGACCTG
TGGAAAACAACATCGTAGACGAGCTGAGAAAGACAGAGCAAGATATGTGG
AAAGATATGGAAGTTGTAGTGGAGTAAAAGGCCAATGCAATGGAAGTTAC
AACTCAGAAGATCGAACCATGTATGGCACGGTATACAAGCACCTACCTAC
CATTGTTAATTATAGTTCTCCATTTTTCATTTGTTAAAAACTTTTGCATA
GAATTTCACTGTACTGCAAGATATAAGGGTTCGTATAAACCGACCACAGC
GCCACCCACAGGACAATGCATCACACAAGTGGATGAAGTAATTTACAGCA
TGAAACATACTGTGAAGTCAGGAGGCTGCAAAAATACTCTTTGTAATGAA
GTCAATCGAGAACGACTAAAATTGGGCAAGTCACCAAACGGCGTGGCGCT
AGATATGCAAATCTTCAGTGGCAAATGTTCAGACCAAGCCTCTATGGAAA
AGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAAAGATTTCATTTGGGGA
GCAGCATTCTGTTCACAACAACAACAATGTGATGTGGAGAATGCTGTTGT
GTNTTCTTTTATTTCATTGTTCCAAGAAGACAAAGAGAAGCACCAACAAT
AATGTTGAAATGCCCAGTGGATGCGCCACCCAAGCATGGTTCCGCCACAT
GCAACATTAAGAACAACGGGAAAGTTGAAGCTTTCATTTGTACTGCAGCT
TGTCAAAAAGGTTCATGGTTTCTGGAAGGTGCAAACATTCCGAAAGTGTA
CAATTTGTATGTGTGTTCGATGGATGGAGCATGGCAAGGTGCAAGTGTTT
TCAACTTTGACAACTTGGTACACTCTCCTATGGTTCCTATCAATAGAGGA
GATCCTATGTGGCCAGACTGCTCAGATCACGAGGCACCAGTTGTAACTTA
TTGCCCCAAAAAACATCGAATCATCAAAACAGGGTTATTCCCACACCGAG
TATTTTGGCCCATGCCACGCTTCACAGACAACGTGGAGGCTGACAACGAG
TTGGTCTTCATCCCTTCCGTGGTGAATGGAACTAAGTTCTACCAAGGGAA
ACACAGTGTTGATATCAAAGCCAGAGATAAATCATCCAATACTGGAAACT
GCACCATGACATTCGAGCTCCAAAATTCTGAGCCACCGACGATAACATGT
CCTAAATTGCCAATTCCAACCGTCAACAACAAGCCAGGCACCAATTACTC
CATCATCTCATTCCCCAATGCGACGGCAACCGATAATTCAGGTTTTCCAG
TGACAATCACCACAAGTCATCCATCACCACTGAAAGTGTTCGTTCACCAT
CCAGTTGAAGTTACTTACACTGCTACTGATGCTGTTGGAAACACCAATAA
ATGCAAACGGAAATTCATCGTCAAAGTGATCAAATGTCCAGCAATCAAGT
TATCACTAAACTCCATCCACCTTGACAAATCATGCAATGGAGTAGACAGC
TCATGTACATCTGTCTGTCGCATTGACTGTAAGAAAGGCTACAAGCTGAT
TGGTCAAAACCATGTCACGTGTCACGGATCAGGAAAATGGACAGGAAAAC
TAGGGTATTGTAAAGGTAAATGTCCGACGAAGGAATGCACAGAGAGAAGT
TGGACATCTTGGAATATCGACACATGGACGGGAAGCTGCCCAAATGAGAA
GAGGACCAAAACATATGATTTCAAAATCAAATATATTGAGGCTTACAAGA
GCTGCAATGGTGTAGGAAAAGATTGCCCACCTACCAAGAACGAGTATAGA
AAAAAAGGTAATTGCAGGAAAGCAAGTAGTTGTCCAGTAGCACCATGGAG
TTCGTGGACACCAGCAGTTGGTAATGGACAATGTAAAGACCAAACACGAC
ACCAAGACAAAAAGCCTTCATACACTTACGTTATGAAAGAACAGAAGAAA
GGAGAAGTGGCTTGCTTTGGCATCGATCCTGATTGTCGACCACCAAGAAT
TACTGATACAAGAACATTCTGTTCATGCAGAGAGGTCACGAATTGTTGGT
GGGCTAGTTGGGGAGCTTGGACAGGTTCAATAACACAAGGGACCTGTGGA
AAACAACATCGTAGACGAGCTGAGAAAGACAGAGCAAGATATGTGGAAAG
ATATGGAAGTTGTAGTGGAGTAAAAGGCCAATGCAATGGAAGTTACAACT
CAGAAGATCGAACCATGTATGGCACGGTATACAAGCACCTACCTACCATT
GTTAATTATAGTTCTCCATTTTTCATTTGTTAAAAACTTTTGCATAGAAT
TTCACTGTACTGCAAGATATAAGGGTTCGTATAAACCGACCACAGCGCCA
CCCACAGGACAATGCATCACACAAGTGGATGAAGTAATTTACAGCATGAA
ACATACTGTGAAGTCAGGAGGCTGCAAAAATACTCTTTGTAATGAAGTCA
ATCGAGAACGACTAAAATTGGGCAAGTCACCAAACGGCGTGGCGCTAGAT
ATGCAAATCTTCAGTGGCAAATGTTCAGACCAAGCCTCTATGGAAAAGTT
GAAGCGTGATTTTGTCGCAACGTTGAAGAAAGATTTCATTTGGGGAGCAG
CATTCTGTTCACAACAACAACAATGTGATGTGGAGAATGCTGTTGTGTNT
TCTTTTATTTCATTGTTCCAAGAAGACAAAGAGAAGCACCAACAATAATG
TTGAAATGCCCAGTGGATGCGCCACCCAAGCATGGTTCCGCCACATGCAA
CATTAAGAACAACGGGAAAGTTGAAGCTTTCATTTGTACTGCAGCTTGTC
AAAAAGGTTCATGGTTTCTGGAAGGTGCAAACATTCCGAAAGTGTACAAT
TTGTATGTGTGTTCGATGGATGGAGCATGGCAAGGTGCAAGTGTTTTCAA
CTTTGACAACTTGGTACACTCTCCTATGGTTCCTATCAATAGAGGAGATC
CTATGTGGCCAGACTGCTCAGATCACGAGGCACCAGTTGTAACTTATTGC
CCCAAAAAACATCGAATCATCAAAACAGGGTTATTCCCACACCGAGTATT
TTGGCCCATGCCACGCTTCACAGACAACGTGGAGGCTGACAACGAGTTGG
TCTTCATCCCTTCCGTGGTGAATGGAACTAAGTTCTACCAAGGGAAACAC
AGTGTTGATATCAAAGCCAGAGATAAATCATCCAATACTGGAAACTGCAC
CATGACATTCGAGCTCCAAAATTCTGAGCCACCGACGATAACATGTCCTA
AATTGCCAATTCCAACCGTCAACAACAAGCCAGGCACCAATTACTCCATC
ATCTCATTCCCCAATGCGACGGCAACCGATAATTCAGGTTTTCCAGTGAC
AATCACCACAAGTCATCCATCACCACTGAAAGTGTTCGTTCACCATCCAG
TTGAAGTTACTTACACTGCTACTGATGCTGTTGGAAACACCAATAAATGC
AAACGGAAATTCATCGTCAAAGTGATCAAATGTCCAGCAATCAAGTTATC
ACTAAACTCCATCCACCTTGACAAATCATGCAATGGAGTAGACAGCTCAT
GTACATCTGTCTGTCGCATTGACTGTAAGAAAGGCTACAAGCTGATTGGT
CAAAACCATGTCACGTGTCACGGATCAGGAAAATGGACAGGAAAACTAGG
GTATTGTAAAGGTAAATGTCCGACGAAGGAATGCACAGAGAGAAGTTGGA
CATCTTGGAATATCGACACATGGACGGGAAGCTGCCCAAATGAGAAGAGG
ACCAAAACATATGATTTCAAAATCAAATATATTGAGGCTTACAAGAGCTG
CAATGGTGTAGGAAAAGATTGCCCACCTACCAAGAACGAGTATAGAAAAA
AAGGTAATTGCAGGAAAGCAAGTAGTTGTCCAGTAGCACCATGGAGTTCG
TGGACACCAGCAGTTGGTAATGGACAATGTAAAGACCAAACACGACACCA
AGACAAAAAGCCTTCATACACTTACGTTATGAAAGAACAGAAGAAAGGAG
AAGTGGCTTGCTTTGGCATCGATCCTGATTGTCGACCACCAAGAATTACT
GATACAAGAACATTCTGTTCATGCAGAGAGGTCACGAATTGTTGGTGGGC
TAGTTGGGGAGCTTGGACAGGTTCAATAACACAAGGGACCTGTGGAAAAC
AACATCGTAGACGAGCTGAGAAAGACAGAGCAAGATATGTGGAAAGATAT
GGAAGTTGTAGTGGAGTAAAAGGCCAATGCAATGGAAGTTACAACTCAGA
AGATCGAACCATGTATGGCACGGTATACAAGCACCTACCTACCATTGTTA
ATTATAGTTCTCCATTTTTCATTTGTTAAAAACTTTTGCATAGAATTTCA
CTGTACTGCAAGATATAAGGGTTCGTATAAACCGACCACAGCGCCACCCA
CAGGACAATGCATCACACAAGTGGATGAAGTAATTTACAGCATGAAACAT
ACTGTGAAGTCAGGAGGCTGCAAAAATACTCTTTGTAATGAAGTCAATCG
AGAACGACTAAAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000649XLOC_000649Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001195-exon-sc0000007-1575043694:938180..938744TCONS_00001195-exon-sc0000007-1575043694:938180..938744Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:935507..935704TCONS_00001195-exon-sc0000007-1575043694:935507..935704Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:934252..934464TCONS_00001195-exon-sc0000007-1575043694:934252..934464Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:933835..934026TCONS_00001195-exon-sc0000007-1575043694:933835..934026Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:933342..933530TCONS_00001195-exon-sc0000007-1575043694:933342..933530Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:932901..933152TCONS_00001195-exon-sc0000007-1575043694:932901..933152Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:932348..932596TCONS_00001195-exon-sc0000007-1575043694:932348..932596Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:931889..932161TCONS_00001195-exon-sc0000007-1575043694:931889..932161Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:929758..930190TCONS_00001195-exon-sc0000007-1575043694:929758..930190Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:929376..929496TCONS_00001195-exon-sc0000007-1575043694:929376..929496Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:929042..929203TCONS_00001195-exon-sc0000007-1575043694:929042..929203Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:924742..924903TCONS_00001195-exon-sc0000007-1575043694:924742..924903Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:924327..924473TCONS_00001195-exon-sc0000007-1575043694:924327..924473Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:924133..924223TCONS_00001195-exon-sc0000007-1575043694:924133..924223Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1575043694:923551..923878TCONS_00001195-exon-sc0000007-1575043694:923551..923878Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:938180..938744TCONS_00001195-exon-sc0000007-1510915933:938180..938744Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:935507..935704TCONS_00001195-exon-sc0000007-1510915933:935507..935704Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:934252..934464TCONS_00001195-exon-sc0000007-1510915933:934252..934464Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:933835..934026TCONS_00001195-exon-sc0000007-1510915933:933835..934026Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:933342..933530TCONS_00001195-exon-sc0000007-1510915933:933342..933530Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:932901..933152TCONS_00001195-exon-sc0000007-1510915933:932901..933152Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:932348..932596TCONS_00001195-exon-sc0000007-1510915933:932348..932596Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:931889..932161TCONS_00001195-exon-sc0000007-1510915933:931889..932161Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:929758..930190TCONS_00001195-exon-sc0000007-1510915933:929758..930190Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:929376..929496TCONS_00001195-exon-sc0000007-1510915933:929376..929496Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:929042..929203TCONS_00001195-exon-sc0000007-1510915933:929042..929203Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:924742..924903TCONS_00001195-exon-sc0000007-1510915933:924742..924903Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:924327..924473TCONS_00001195-exon-sc0000007-1510915933:924327..924473Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:924133..924223TCONS_00001195-exon-sc0000007-1510915933:924133..924223Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1510915933:923551..923878TCONS_00001195-exon-sc0000007-1510915933:923551..923878Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:938180..938744TCONS_00001195-exon-sc0000007-1491911889:938180..938744Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:935507..935704TCONS_00001195-exon-sc0000007-1491911889:935507..935704Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:934252..934464TCONS_00001195-exon-sc0000007-1491911889:934252..934464Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:933835..934026TCONS_00001195-exon-sc0000007-1491911889:933835..934026Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:933342..933530TCONS_00001195-exon-sc0000007-1491911889:933342..933530Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:932901..933152TCONS_00001195-exon-sc0000007-1491911889:932901..933152Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:932348..932596TCONS_00001195-exon-sc0000007-1491911889:932348..932596Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:931889..932161TCONS_00001195-exon-sc0000007-1491911889:931889..932161Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:929758..930190TCONS_00001195-exon-sc0000007-1491911889:929758..930190Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:929376..929496TCONS_00001195-exon-sc0000007-1491911889:929376..929496Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:929042..929203TCONS_00001195-exon-sc0000007-1491911889:929042..929203Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:924742..924903TCONS_00001195-exon-sc0000007-1491911889:924742..924903Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:924327..924473TCONS_00001195-exon-sc0000007-1491911889:924327..924473Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:924133..924223TCONS_00001195-exon-sc0000007-1491911889:924133..924223Clytia hemisphaericaexon
TCONS_00001195-exon-sc0000007-1491911889:923551..923878TCONS_00001195-exon-sc0000007-1491911889:923551..923878Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001195-proteinTCONS_00001195-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:923551..938744 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0804865 0.0539944 0.146363 0.26656 0 0 0.14906 0.114175 0.0177638 0.0817882 0 0.0495223 8.94642 9.23984 32.1528 48.4436 7.09427 6.64644 46.0033 46.2734 6.26885 8.61098 29.6425 32.5735 29.4317 34.4962 0.877979 0.891605 83.9644 109.599
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR000436Sushi_SCR_CCP_dom
IPR003410HYR_dom
Blast
BLAST of TCONS_00001195 vs. Swiss-Prot (Human)
Match: SVEP1 (Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens GN=SVEP1 PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 2.564e-50
Identity = 110/401 (27.43%), Postives = 166/401 (41.40%), Query Frame = 1
Query: 1177 CPAIKLSLNSIHLDKSCNGVDSSCTSVCRIDCKKGYKLIG-QNHVTCHGSGKWTG--KLGYCKDSEPPTITCPK-LPIPTVNNKPGTNYSIISFPNATATDNSGFPVTITTSHPS--PLKVFVHHPVEVTYTATDAVGNTNKCKRKFIVKDHEAPVVTYCPKKHRIIKTGLFPHRVFWPMPRFTDNVEADNELVFIPSVVNGTKFYQGKHSVDIKARDKSSNTGNCTMTFELQMLKCPVDAPPKHGSATCNIKNNGKVEAFICTAACQKGSWFLEGANIPKVYNLYVCSM-DGAWQGASVFNFDNLVHSPMVPINRGDPMWPDCSVGKSPNGVALDMQIF--SGKCSDQASMEKLKRDFVATLKKDFIWGAAFCSQQQ--QCDVENAVVXSFISLFQEDKE 2346
            C   ++  + I    +C    +   ++C + C++G+ L G +  + C  SGKW    +   CKD E P I CPK +   T+  +   N   +++   TA DNSG  V++   HP+  P  +F    V + YTATD  GN   C     V D E PV+ +C +    ++     H   W  P+F+DN  A  ELV   S   G  F QG+  V   A D S N   C +   ++   C +   P +G   C   N G      CT  C +G  F EG+      + Y C+  DG W+                        WPDC+  +  N      ++F  + +C D   M+K    F  TL K      +FCS  +   C +E  +   +   +  D E
Sbjct:  498 CSTFQMPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKEMLRCTTSGKWNVGVQAAVCKDVEAPQINCPKDIEAKTLEQQDSAN---VTWQIPTAKDNSGEKVSVHV-HPAFTPPYLFPIGDVAIVYTATDLSGNQASCIFHIKVIDAEPPVIDWC-RSPPPVQVSEKVHAASWDEPQFSDNSGA--ELVITRSHTQGDLFPQGETIVQYTATDPSGNNRTCDIHIVIKGSPCEIPFTPVNGDFICTPDNTG----VNCTLTCLEGYDFTEGST-----DKYYCAYEDGVWKPTYTTE------------------WPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMV---PSFCSDAEDIDCRLEENLTKKYCLEYNYDYE 861          

HSP 2 Score: 100.908 bits (250), Expect = 2.564e-50
Identity = 69/211 (32.70%), Postives = 104/211 (49.29%), Query Frame = 3
Query: 2397 SKKTKRSTNNKDQMV-IKFSISVRKTL---NQGVLDKDN----LKQLNTLTQALELQKTAIVQKVTSTAVKVLKDNSVKVNSQKPSISCKQGSELQSVNGTIKCLQCPSGTFYQSETKKCTVCQPGFFQNREGALSCENCPQGETTKGTLSSDFHRCKAICHPGTYSKNGLAPCTQCPSGTYQPSLESQDCIKCP-NSNGKRQGLTDVKDC 3002
            S + KRS    D  + + F+I+    L       L+ +N    L+ L T+T  L+             A ++L  +S  + ++K S  C+ GS L+       C+ CP GT+Y  E   C  C+ G +Q+ EG L C+ CP G  T+   S +   CKA C  GTYS +GL  C  CP GTYQP   S+ C+ CP N++  ++G  ++  C
Sbjct:  900 SSRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKLKRTLNKDPMYSFQLASEILIADSNSLETKKASPFCRPGSVLRGR----MCVNCPLGTYYNLEHFTCESCRIGSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPKFGSRSCLSCPENTSTVKRGAVNISAC 1106          
The following BLAST results are available for this feature:
BLAST of TCONS_00001195 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SVEP12.564e-5027.43Sushi, von Willebrand factor type A, EGF and pentr... [more]
back to top