Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001182 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001182
Unique NameTCONS_00001182
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1268

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001182 ID=TCONS_00001182|Name=TCONS_00001182|organism=Clytia hemisphaerica|type=transcript|length=1268bp
GCCAGATTCATATAGCAGACTGACAAATAATCTGCTGACATGGCAACAGT
TGGTTTGCTATCAAACTGATACATATCTCATTAAATAACTTCATGAGAGt
ccattttaatttttagtttcaGATAATTAAAAAGAATGCCTTTAGAACAA
GATGTATTGACAATTGGTCATCAATTGGAGAAGTTAGTCTCTGAAGGAAA
ATCTgACAATGAAACAATCAGCGACTTATTAAAGAGATTGAAAGAATTAC
CAATCACATTAGACATCTTACAGAAAACTCGTATTGGAATGACAGTAAAT
GTTGTACGTAAAGCCAGCAATAAAGATGACATTCAAACTGTTGCAAAAGG
TTTAatcaaatcttggaaaaaacTTTTAGATACACAAGAtaaagacaaag
aaaaagaaaaggagaAACCAAAAGTGAATAAACAAACGTCCCAGGAGAAA
GAAAGCAAGCCTGCACCACGAGATTCAAGAGCGGATTCAGGTGGATCGTA
TGAAGTACCTCCACCCAAAGGAAATGATCCAATACGAATACAATGTCGTG
AAATGTTGGTCAAATCACTCAAACTGGAAGGCAGACcagAATTCAACCCA
GCATACATAGCAGCTGATATAGAAGAAGCAACGTACCAAATGTTTAAAGA
CACTggttcaaaatacaaaaatcgaaTTAAAAGTCGTGTTATGAATCTAC
GAGATAAACGAAACCCTGCTCTAAAACAAATGGTGGCGGAGGGTGAGATT
TCACCCGAACGATTCGCCAATATGACGGCTGAGGAAATGGCGACTGACGA
ATTGAGAGCTGAACGTGAAAAGATGACCAAACAAGCGATCAACGAACATC
AACTAGCCACGTCAGCTGGTACAAGCACTGGTCAGTTCAAATGTCATCGC
TGTGGTAAAAGAAAAACCTCTTATAGTCAAGTACAAACACGTAGTGCGGA
TGAACCGATGACCACTTTTGTATATTGCAACGAATGTGGCAACCGGTGGA
AGTTTTGCTGACACCGGATGCACACATTGCCAACTATCAAAGAAACAACA
CAGCACACTTTGTACATATTCCTCGCCCCTAATTTTTTAAACCGTGTTCT
TctttgaaacataaaattttatacaaaataatccaaaatgtttgatacTT
TTCCGCCTACTAAGATTGTCTATAAGATAATAACgaattttgactttgtt
tgtCGGTAGAGTTTAGAGAAATTTTGTACAATGAATTTTCAGAACATTAA
AAAGTACCCTAAATTTCg
Run BLAST on NCBI

protein sequence of TCONS_00001182-protein

>TCONS_00001182-protein ID=TCONS_00001182-protein|Name=TCONS_00001182-protein|organism=Clytia hemisphaerica|type=polypeptide|length=291bp
MPLEQDVLTIGHQLEKLVSEGKSDNETISDLLKRLKELPITLDILQKTRI
GMTVNVVRKASNKDDIQTVAKGLIKSWKKLLDTQDKDKEKEKEKPKVNKQ
TSQEKESKPAPRDSRADSGGSYEVPPPKGNDPIRIQCREMLVKSLKLEGR
PEFNPAYIAADIEEATYQMFKDTGSKYKNRIKSRVMNLRDKRNPALKQMV
AEGEISPERFANMTAEEMATDELRAEREKMTKQAINEHQLATSAGTSTGQ
FKCHRCGKRKTSYSQVQTRSADEPMTTFVYCNECGNRWKFC
Run BLAST on NCBI

transcript from alignment at sc0000007:721829..729862-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001182 ID=TCONS_00001182|Name=TCONS_00001182|organism=Clytia hemisphaerica|type=transcript|length=8034bp|location=Sequence derived from alignment at sc0000007:721829..729862- (Clytia hemisphaerica)
GCCAGATTCATATAGCAGACTGACAAATAATCTGCTGACATGGCAACAGT TGGTTTGCTATCAAACTGATACATATCTCATTAAATAACTTCATGAGAGT CCATTTTAATTTTTAGTTTCAGATAATTAAAAAGAATGCCTTTAGAACAA GATGTATTGACAATTGGTCATCAATTGGAGAAGTTAGTCTCTGAAGGAAA ATCTGTAAGTATTTTGTTCTTTCCTCCTCTACTCTAATTCTGTCTTCTGT CTAATGAACTGGAGGAAACAGGTGTTATAACATAAAGGGACTGAAGATAA GGTCATGTAAGGCTGTTCTTGTAAACTTATTTACCTATGAAAAACTGACT TCATTTTCAAGAGGATTCAAAGCTTGTATCTTTTTAAAAATACATGCTTT ACTCTGGGTTGTGGGTGTTTTGATAATGAAACTTCGTTACAAGTTACAAC CCTTTTTTTTGGGTCAGCAAAACTTCAAAACTTTTCTTGCCATTTTATCT ATCTCTTTTATCTTAATTTCTTCCAACGACATTTCATTTTTTAGTTGACT CTTTTGGACAAGACTTTTAGAAAGTGAAATTGATTTTTTAGGACAATGAA ACAATCAGCGACTTATTAAAGAGATTGAAAGAATTACCAATCACATTAGA CATCTTACAGGTCAGAGATATTCAGATATTTTTCTGTTTAGCCAAAATTC TCTTTCAGTCTTTCTCAACCCTCATAACTTCTTCGTTTGTAATCTCCATA AATTCATTATTCCACATTTACAAACAAAAAAACGTGAACATAGTTCTCTT GAACACTCTTGATTAGTTGCACAATTTTAGGGCTCACTTCTCTAGTAATT ATTTAAGAAAATTTATCTTGGAATTACAGTCAATGCAGGAGGGAGTCGAT ACTGAAATCTCAGATATCATGTTGTTTAGTGACGTGATGGTACACCCAAA AAAACTTAAAAAAACTTCTGAGAAAAATGGTCCTGAGAAGACCAAAATTG GATGGTCTACGTGTAAAAAAGTCCCCAAAAGTTTTAGTTCATTTGTACTA AAATACAGCATTTCTAGAATTCTTAAAACCCTTATACATGTCAGAGATTT TAGTACCAACCACCCCCTGGTCAATGTTGTATGTAAAGCCAGCAAAAAGA CTGGTGGAAGNGTTTGTAATCTCCATAAATTCATTATTCCACATTTACAA ACAATGACGTAAACATAGTTCTCTTGAACACTCTTGATTAGTTGTACAAT TTTAGGGCTCACTTCTCTAGTAATTATTTCAGAAAATTTAGCTTGGAATT ACAGTCAATGCAGGAGGGGGTCGATACTGAAATCTCAGATATCATGTTGT TTAGTGACGTGATGGTACACCCAAAAAAACTTAAAACAACTTCTGAGAAA AATGGTCCTGAGAAGACCAAAATTGGATGGTCTACGTGTAAAAAAGTCCG CAAAAATTTTAGTTCATTTGTACTAAAATACAGCATTTCTAGAATTCTTA AAACCCTTATACATGTCAGAGATTTTAGTACCTACCACCCCCTGGTCAAT GTTGTATGTAAAGCCAGCAAAAAGACTTTTAGGTGGAATTGAAATTCAAT TATCCTTATCACATATGTGTTTTTGTATTTCAGAAAACTCGTATTGGAAT GACAGTAAATGTTGTACGTAAAGCCAGCAATAAAGATGACATTCAAACTG TTGCAAAAGGTTTAATCAAATCTTGGAAAAAACTTTTAGGTGAGAAGGAA ATTCAATATCCTTAGCTTGAAAACTGCCCTTAACATCAGGAAAGGCTCTG ATCAATACATGTGTTTTGAATTAGTTTCTCTGTGAATTTTTCAAGGAGTT TTAAACTTCACTTTTGAGAAGAATCTGGGCTGATCAAGCCATTATGTATA ACATTCCTCATTTTCACTAACACATAGATACACAAGATAAAGACAAAGAA AAAGAAAAGGAGAAACCAAAAGTGAATAAACAAACGTCCCAGGAGAAAGA AAGCAAGCCTGCACCACGAGATTCAAGAGCGGATTCAGGTGGATCGTATG AAGTACCTCCACCCAAAGGAAATGATCCAATACGAATACAATGTCGTGAA ATGTTGGTCAAATCACTCAAACTGGAAGGCAGACCAGGTTTCTTTGTTTT CTCTTAATACTGGATAGAAAAATTTCTCTTTTTTCTGTTACTTCTCTCCA ATGCCGTTTGAAGAAGTTTTTTCTTGCAATTTAATTCAAGAATTTTGATC ACACAAATAGTCAAAACTTCTAGGAAAGTTGGAAATTTGTTGTAATTTGT TCAATTTGCCTAATTTGCCTAATTTGATGACCAAAATCACACATCAACAT TAGCTGAAGTTATCTAATTTTATTGTTTTGATTGCAAATCTCGAAATCCT TCAAAATTCACACAAAGATTTTTCCTTAAAGAATGGCATGAAAGCTTTTA TAATCTATATATTAATAGTATAACGCGTATGTCATTTTGTTTTCTGTCTG TGTGTCACTTTCGATTTCGCAAGCAATGTTTTGTTCTTGGTAAGTTTGTT TTGATTGACAGATCGGATAGAGCCTGGTTTAGACTTTATTCAGCCTTTGT TTTGAAATTTAAGGCCCGTCTACATTTAGTAATTATAATTTCTGCCTAGG CATGCCCGTTTTTCGTTTTTCTCTTTTCTTTTGTTTTTCTCTTTTCTTTT GCTTAAATTCTTTTCGAATGTAATTAACGATCGTATTTATTAATGACATT CGAATTCTTTTCAAAACAAATTCCTTTTACAGAAAAGAATAATTCAAATG TAAATCAAAACATAACAGTCAAAAAGTTTGTCAAACCAAACAACGACAGC ATTCAAAAGGCGATAAAAAGCAAAAAGAGAAAATTNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNCAACCTCTTTCTTCATATAAAAACATTCAAGTC GTCGTTACTGTCAAAAAGTGTGTACGTCATTTTACATGTTTAAATTTGAA AAGTGGCTGCGTTTAGACCAACGCAACTGGCATTTTTAGTTTGGCATTTG CTCATGAGGGGTTCGATTTTAATAGCTTTTCCATTGTATTTTCTGTCATG GCATTTAAGGAATTTTTAGAGTCATTACTGAAAAGGTGATTCCCTCAAGT TNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNACTTTTGACTTAAACAAAAAATTCGTCTACATCCAAAGGACT TTTATTGCGTTCAGCTACAGCTTAACCGGCGTGCGACGCCGGGTACCGGC TAGTTACATTTATAATTACATTGTAATTACATTTTTATAAAATTTTATAA AAACTTTTGAAAAATATTCTCCTACAAAAATACAGCCAAGTACAAAATGC AATTGGTTTAATTTCCGACTGATGTAGCCCTGAAATGAAGCTTTCAAAAC TCTGAACATAGGAATTAAAAATACTCTTTTTCTTTTTCTCCTTGGGGCAT AGGCCCTGAAGACCCCTAAAATGCCAACTCAAATCAATCTGAGGCGGTTA TTGCCATTATGTATTTCCCGTTAATCATTACATGTTGTACGTTGTTCATT ATACATTATGTATTATGCATTACGCAAAAGATACAAAGAATAATATTTTC TTTTCAAAATACACAAGGTGATTTTTCTTCCTTCATAATAATTACTCAAA ATTTATTTTCGTGCAAAAAAAATATTTGCATGGAAAATATTCTTGCAAGA ATGCCGAAATATGTAAAATCATTTTCGTCATATTTTTTACGAAAAATACA ATGAAAAATACACTTTCCTTGAAACATATATGAAGCATTTTCTCCAAAAA TACACAAATGGAATGATATTGAAAGAATGAAATTTTTCCTTTAAGATTAC ATTTTATTTATCAGAACTTTTCCCTCGAAAATACACAAAATGATCTTCCC TGAAAATTACTCAAAAATCCTTTTCCTACCAAAATACAAGGAATTATCTT TTCCTTCAAGAATACATTAATACAATCTTTTATTTTTTAAATTAGTGTAC AGTAAATCATATCTGCAAAAATAGAAATAATTTCAAAACTACCCAATATA TTTTCTTTCCATCAGAATTTTTACAGGGACGGCTTATTTTCTTATGCATC TTGGTTAAAATCATTTTGAAATATTACGAAAAAAGGAGGTGATCGGCTTA TGACCAATGGTTATTTATAGNTTATGCATCTTGGTTAAAATCATTTTGAA ATATTACGAAAAAAGGAGGTGATCGGCTTATGACCAATGGTTATTTATAG TTCTTTTTCTTTAGAATTCAACCCAGCATACATAGCAGCTGATATAGAAG AAGCAACGTACCAAATGTTTAAAGACACTGGTTCAAAATACAAAAATCGA ATTAAAAGTCGTGTTATGAATCTACGAGATAAACGAAACCCTGCTCTAAA ACAAATGGTGGCGGAGGGTGAGATTTCACCCGAACGATTCGCCAATATGA CGGCTGAGGTATAACTTTTGGAATACGGTGCGACCATACAACCTTCTAGG ACTTCAGGCCCTAACTTATGTTGAGTAGGTTTAAGCATTACAAACATTAC TTTTTAATAGACAATGAAATGCCTCGTTATTCTTTATTAACTGTTGTTCT TATGTGATCAGCCAAATTATTATACTGCGTTTGATTGTAATGTAAACGTG ATAGAGTTAATTTAGATTATCTTTGTATCAAAAGGAAATGGCGACTGACG AATTGAGAGCTGAACGTGAAAAGATGACCAAACAAGCGATCAACGAACAT CAACTAGCCACGTCAGCTGGTACAAGCACTGGTCAGTTCAAATGTCATCG CTGTGGTAAAAGAAAAACCTCTTATAGTCAAGTAAGTGTGACATTGATAT TTAAAAAGGATTAATCGGGTATATTCAGATGCCATCATTTTGCTGTCTAA AAATAATGTTTTCTTTATGTTGTGCCAGTCATTGATCATGGACAATTTAT CGATGTAGCTCAAATCTTTCCCTCTTCTCCGGACTTTTCCTCCGCAAGTA ATCTCATAAATCTTTTCATGCAAGGGATTTAAGTCTTCGAGGATGGGCTT TATAGGGGGCTGAGGTTCCACTTTATCGCCCTTGGCAGCCCTTCGAAGAG TTTTTGTATTATACAGTTTGTGAGCTACCTCCACTGTAAATTGTACGGAT AGATTTCAGGGATTTGGGGATGAATTATTAATCGGGCTTCTCTACTATGT TTTTGATGTTTGGATATTTTCTTCTTCTTTTTCACACCAGGTACAAACAC GTAGTGCGGATGAACCGATGACCACTTTTGTATATTGCAACGAATGTGGC AACCGGTGGAAGGTACTCCTCTTTCTCTTAGTTTCTCTTACTTTTCATCT TGACCCTTTGAAAGAGAATACTTGTGAGTAAAAGATTAAATGTATAGGAT AATTACATTTTGGCTTTCACTAGCTCCTGAAAGTCAACTCATGATCAGAT CACTGTAATTCTTTTCTGAATGAATGGAAATTAGCTAGAATGTTAAAAAT CATTTATTGATTGGTTATTGAGAATTGCAATGAATTAACGATTACACCAT TTTTGGAACACCCCGGTGGGGTGGAGGTCCTATAAATTAACCTTTGTCCG TTCGTCCGTTCGTTCGTCATTAGCTTCCTCGTGATTGGCTCGTTAGTTTT TCTGAATTTTTGCACAAAGATGTGTAACTATAAACCCTCGAATGTGACGG AGCCCGATTTTCGAAAAAAAAAATTTGGGGGCAAATTTGGGCCAAAAAAC GGCTAAAAAACGGGTTTTTTGGACTCTGTGAAAAATTGGATCGTTAACTT TTTCTAATTTTTTGCATGAAAGTAGGGTACTATCACAGGTAAAAGATGGC TCAAGCAGATTTTCTCAAAAAGATTTTTTTGGCTCAAAAAACGCATGTTT ATCTATAAGAATCACTATTAATAAGCATACATCAATGTTCTTAGTTAAAT TACTCAATTTTTTTATGAGATGGATGTTTTTTTGCTCACAAAGTCTTGAA TATGAAAGAATATCTCAAGAGCATGAAATTTTGGTTTTAAAACGTTTTTT TTATAAGAAACAGACGACTAATTTTAATAGATCGTCACTATTTGTGTTCT GAATGATTGTTTAATGGTCACGCTCACGTAGANGACTGATTTTAATAGAT CGTCACTATTTGTGTTCTGAATGATTGTTTAATGGTCACGCTCACGTAGA TATCAATTATATATGTGTTAAATACATAACTAGGTAGGTCCATAAAAGTA TCACTTGTTTGTTTACAGTTTTGCTGACACCGGATGCACACATTGCCAAC TATCAAAGAAACAACACAGCACACTTTGTACATATTCCTCGCCCCTAATT TTTTAAACCGTGTTCTTCTTTGAAACATAAAATTTTATACAAAATAATCC AAAATGTTTGATACTTTTCCGCCTACTAAGATTGTCTATAAGATAATAAC GAATTTTGACTTTGTTTGTCGGTAGAGTTTAGAGAAATTTTGTACAATGA ATTTTCAGAACATTAAAAAGTACCCTAAATTTCG

Coding sequence (CDS) from alignment at sc0000007:721829..729862-

>TCONS_00001182 ID=TCONS_00001182|Name=TCONS_00001182|organism=Clytia hemisphaerica|type=CDS|length=7008bp|location=Sequence derived from alignment at sc0000007:721829..729862- (Clytia hemisphaerica)
TTTTGCTGAGTACAAACACGTAGTGCGGATGAACCGATGACCACTTTTGT
ATATTGCAACGAATGTGGCAACCGGTGGAAGGAAATGGCGACTGACGAAT
TGAGAGCTGAACGTGAAAAGATGACCAAACAAGCGATCAACGAACATCAA
CTAGCCACGTCAGCTGGTACAAGCACTGGTCAGTTCAAATGTCATCGCTG
TGGTAAAAGAAAAACCTCTTATAGTCAAAATTCAACCCAGCATACATAGC
AGCTGATATAGAAGAAGCAACGTACCAAATGTTTAAAGACACTGGTTCAA
AATACAAAAATCGAATTAAAAGTCGTGTTATGAATCTACGAGATAAACGA
AACCCTGCTCTAAAACAAATGGTGGCGGAGGGTGAGATTTCACCCGAACG
ATTCGCCAATATGACGGCTGAGATACACAAGATAAAGACAAAGAAAAAGA
AAAGGAGAAACCAAAAGTGAATAAACAAACGTCCCAGGAGAAAGAAAGCA
AGCCTGCACCACGAGATTCAAGAGCGGATTCAGGTGGATCGTATGAAGTA
CCTCCACCCAAAGGAAATGATCCAATACGAATACAATGTCGTGAAATGTT
GGTCAAATCACTCAAACTGGAAGGCAGACCAGAAAACTCGTATTGGAATG
ACAGTAAATGTTGTACGTAAAGCCAGCAATAAAGATGACATTCAAACTGT
TGCAAAAGGTTTAATCAAATCTTGGAAAAAACTTTTAGGACAATGAAACA
ATCAGCGACTTATTAAAGAGATTGAAAGAATTACCAATCACATTAGACAT
CTTACAGATGCCTTTAGAACAAGATGTATTGACAATTGGTCATCAATTGG
AGAAGTTAGTCTCTGAAGGAAAATCTTTTTGCTGAGTACAAACACGTAGT
GCGGATGAACCGATGACCACTTTTGTATATTGCAACGAATGTGGCAACCG
GTGGAAGGAAATGGCGACTGACGAATTGAGAGCTGAACGTGAAAAGATGA
CCAAACAAGCGATCAACGAACATCAACTAGCCACGTCAGCTGGTACAAGC
ACTGGTCAGTTCAAATGTCATCGCTGTGGTAAAAGAAAAACCTCTTATAG
TCAAAATTCAACCCAGCATACATAGCAGCTGATATAGAAGAAGCAACGTA
CCAAATGTTTAAAGACACTGGTTCAAAATACAAAAATCGAATTAAAAGTC
GTGTTATGAATCTACGAGATAAACGAAACCCTGCTCTAAAACAAATGGTG
GCGGAGGGTGAGATTTCACCCGAACGATTCGCCAATATGACGGCTGAGAT
ACACAAGATAAAGACAAAGAAAAAGAAAAGGAGAAACCAAAAGTGAATAA
ACAAACGTCCCAGGAGAAAGAAAGCAAGCCTGCACCACGAGATTCAAGAG
CGGATTCAGGTGGATCGTATGAAGTACCTCCACCCAAAGGAAATGATCCA
ATACGAATACAATGTCGTGAAATGTTGGTCAAATCACTCAAACTGGAAGG
CAGACCAGAAAACTCGTATTGGAATGACAGTAAATGTTGTACGTAAAGCC
AGCAATAAAGATGACATTCAAACTGTTGCAAAAGGTTTAATCAAATCTTG
GAAAAAACTTTTAGGACAATGAAACAATCAGCGACTTATTAAAGAGATTG
AAAGAATTACCAATCACATTAGACATCTTACAGATGCCTTTAGAACAAGA
TGTATTGACAATTGGTCATCAATTGGAGAAGTTAGTCTCTGAAGGAAAAT
CTTTTTGCTGAGTACAAACACGTAGTGCGGATGAACCGATGACCACTTTT
GTATATTGCAACGAATGTGGCAACCGGTGGAAGGAAATGGCGACTGACGA
ATTGAGAGCTGAACGTGAAAAGATGACCAAACAAGCGATCAACGAACATC
AACTAGCCACGTCAGCTGGTACAAGCACTGGTCAGTTCAAATGTCATCGC
TGTGGTAAAAGAAAAACCTCTTATAGTCAAAATTCAACCCAGCATACATA
GCAGCTGATATAGAAGAAGCAACGTACCAAATGTTTAAAGACACTGGTTC
AAAATACAAAAATCGAATTAAAAGTCGTGTTATGAATCTACGAGATAAAC
GAAACCCTGCTCTAAAACAAATGGTGGCGGAGGGTGAGATTTCACCCGAA
CGATTCGCCAATATGACGGCTGAGATACACAAGATAAAGACAAAGAAAAA
GAAAAGGAGAAACCAAAAGTGAATAAACAAACGTCCCAGGAGAAAGAAAG
CAAGCCTGCACCACGAGATTCAAGAGCGGATTCAGGTGGATCGTATGAAG
TACCTCCACCCAAAGGAAATGATCCAATACGAATACAATGTCGTGAAATG
TTGGTCAAATCACTCAAACTGGAAGGCAGACCAGAAAACTCGTATTGGAA
TGACAGTAAATGTTGTACGTAAAGCCAGCAATAAAGATGACATTCAAACT
GTTGCAAAAGGTTTAATCAAATCTTGGAAAAAACTTTTAGGACAATGAAA
CAATCAGCGACTTATTAAAGAGATTGAAAGAATTACCAATCACATTAGAC
ATCTTACAGATGCCTTTAGAACAAGATGTATTGACAATTGGTCATCAATT
GGAGAAGTTAGTCTCTGAAGGAAAATCTTTTTGCTGAGTACAAACACGTA
GTGCGGATGAACCGATGACCACTTTTGTATATTGCAACGAATGTGGCAAC
CGGTGGAAGGAAATGGCGACTGACGAATTGAGAGCTGAACGTGAAAAGAT
GACCAAACAAGCGATCAACGAACATCAACTAGCCACGTCAGCTGGTACAA
GCACTGGTCAGTTCAAATGTCATCGCTGTGGTAAAAGAAAAACCTCTTAT
AGTCAAAATTCAACCCAGCATACATAGCAGCTGATATAGAAGAAGCAACG
TACCAAATGTTTAAAGACACTGGTTCAAAATACAAAAATCGAATTAAAAG
TCGTGTTATGAATCTACGAGATAAACGAAACCCTGCTCTAAAACAAATGG
TGGCGGAGGGTGAGATTTCACCCGAACGATTCGCCAATATGACGGCTGAG
ATACACAAGATAAAGACAAAGAAAAAGAAAAGGAGAAACCAAAAGTGAAT
AAACAAACGTCCCAGGAGAAAGAAAGCAAGCCTGCACCACGAGATTCAAG
AGCGGATTCAGGTGGATCGTATGAAGTACCTCCACCCAAAGGAAATGATC
CAATACGAATACAATGTCGTGAAATGTTGGTCAAATCACTCAAACTGGAA
GGCAGACCAGAAAACTCGTATTGGAATGACAGTAAATGTTGTACGTAAAG
CCAGCAATAAAGATGACATTCAAACTGTTGCAAAAGGTTTAATCAAATCT
TGGAAAAAACTTTTAGGACAATGAAACAATCAGCGACTTATTAAAGAGAT
TGAAAGAATTACCAATCACATTAGACATCTTACAGATGCCTTTAGAACAA
GATGTATTGACAATTGGTCATCAATTGGAGAAGTTAGTCTCTGAAGGAAA
ATCTTTTTGCTGAGTACAAACACGTAGTGCGGATGAACCGATGACCACTT
TTGTATATTGCAACGAATGTGGCAACCGGTGGAAGGAAATGGCGACTGAC
GAATTGAGAGCTGAACGTGAAAAGATGACCAAACAAGCGATCAACGAACA
TCAACTAGCCACGTCAGCTGGTACAAGCACTGGTCAGTTCAAATGTCATC
GCTGTGGTAAAAGAAAAACCTCTTATAGTCAAAATTCAACCCAGCATACA
TAGCAGCTGATATAGAAGAAGCAACGTACCAAATGTTTAAAGACACTGGT
TCAAAATACAAAAATCGAATTAAAAGTCGTGTTATGAATCTACGAGATAA
ACGAAACCCTGCTCTAAAACAAATGGTGGCGGAGGGTGAGATTTCACCCG
AACGATTCGCCAATATGACGGCTGAGATACACAAGATAAAGACAAAGAAA
AAGAAAAGGAGAAACCAAAAGTGAATAAACAAACGTCCCAGGAGAAAGAA
AGCAAGCCTGCACCACGAGATTCAAGAGCGGATTCAGGTGGATCGTATGA
AGTACCTCCACCCAAAGGAAATGATCCAATACGAATACAATGTCGTGAAA
TGTTGGTCAAATCACTCAAACTGGAAGGCAGACCAGAAAACTCGTATTGG
AATGACAGTAAATGTTGTACGTAAAGCCAGCAATAAAGATGACATTCAAA
CTGTTGCAAAAGGTTTAATCAAATCTTGGAAAAAACTTTTAGGACAATGA
AACAATCAGCGACTTATTAAAGAGATTGAAAGAATTACCAATCACATTAG
ACATCTTACAGATGCCTTTAGAACAAGATGTATTGACAATTGGTCATCAA
TTGGAGAAGTTAGTCTCTGAAGGAAAATCTTTTTGCTGAGTACAAACACG
TAGTGCGGATGAACCGATGACCACTTTTGTATATTGCAACGAATGTGGCA
ACCGGTGGAAGGAAATGGCGACTGACGAATTGAGAGCTGAACGTGAAAAG
ATGACCAAACAAGCGATCAACGAACATCAACTAGCCACGTCAGCTGGTAC
AAGCACTGGTCAGTTCAAATGTCATCGCTGTGGTAAAAGAAAAACCTCTT
ATAGTCAAAATTCAACCCAGCATACATAGCAGCTGATATAGAAGAAGCAA
CGTACCAAATGTTTAAAGACACTGGTTCAAAATACAAAAATCGAATTAAA
AGTCGTGTTATGAATCTACGAGATAAACGAAACCCTGCTCTAAAACAAAT
GGTGGCGGAGGGTGAGATTTCACCCGAACGATTCGCCAATATGACGGCTG
AGATACACAAGATAAAGACAAAGAAAAAGAAAAGGAGAAACCAAAAGTGA
ATAAACAAACGTCCCAGGAGAAAGAAAGCAAGCCTGCACCACGAGATTCA
AGAGCGGATTCAGGTGGATCGTATGAAGTACCTCCACCCAAAGGAAATGA
TCCAATACGAATACAATGTCGTGAAATGTTGGTCAAATCACTCAAACTGG
AAGGCAGACCAGAAAACTCGTATTGGAATGACAGTAAATGTTGTACGTAA
AGCCAGCAATAAAGATGACATTCAAACTGTTGCAAAAGGTTTAATCAAAT
CTTGGAAAAAACTTTTAGGACAATGAAACAATCAGCGACTTATTAAAGAG
ATTGAAAGAATTACCAATCACATTAGACATCTTACAGATGCCTTTAGAAC
AAGATGTATTGACAATTGGTCATCAATTGGAGAAGTTAGTCTCTGAAGGA
AAATCTTTTTGCTGAGTACAAACACGTAGTGCGGATGAACCGATGACCAC
TTTTGTATATTGCAACGAATGTGGCAACCGGTGGAAGGAAATGGCGACTG
ACGAATTGAGAGCTGAACGTGAAAAGATGACCAAACAAGCGATCAACGAA
CATCAACTAGCCACGTCAGCTGGTACAAGCACTGGTCAGTTCAAATGTCA
TCGCTGTGGTAAAAGAAAAACCTCTTATAGTCAAAATTCAACCCAGCATA
CATAGCAGCTGATATAGAAGAAGCAACGTACCAAATGTTTAAAGACACTG
GTTCAAAATACAAAAATCGAATTAAAAGTCGTGTTATGAATCTACGAGAT
AAACGAAACCCTGCTCTAAAACAAATGGTGGCGGAGGGTGAGATTTCACC
CGAACGATTCGCCAATATGACGGCTGAGATACACAAGATAAAGACAAAGA
AAAAGAAAAGGAGAAACCAAAAGTGAATAAACAAACGTCCCAGGAGAAAG
AAAGCAAGCCTGCACCACGAGATTCAAGAGCGGATTCAGGTGGATCGTAT
GAAGTACCTCCACCCAAAGGAAATGATCCAATACGAATACAATGTCGTGA
AATGTTGGTCAAATCACTCAAACTGGAAGGCAGACCAGAAAACTCGTATT
GGAATGACAGTAAATGTTGTACGTAAAGCCAGCAATAAAGATGACATTCA
AACTGTTGCAAAAGGTTTAATCAAATCTTGGAAAAAACTTTTAGGACAAT
GAAACAATCAGCGACTTATTAAAGAGATTGAAAGAATTACCAATCACATT
AGACATCTTACAGATGCCTTTAGAACAAGATGTATTGACAATTGGTCATC
AATTGGAGAAGTTAGTCTCTGAAGGAAAATCTTTTTGCTGAGTACAAACA
CGTAGTGCGGATGAACCGATGACCACTTTTGTATATTGCAACGAATGTGG
CAACCGGTGGAAGGAAATGGCGACTGACGAATTGAGAGCTGAACGTGAAA
AGATGACCAAACAAGCGATCAACGAACATCAACTAGCCACGTCAGCTGGT
ACAAGCACTGGTCAGTTCAAATGTCATCGCTGTGGTAAAAGAAAAACCTC
TTATAGTCAAAATTCAACCCAGCATACATAGCAGCTGATATAGAAGAAGC
AACGTACCAAATGTTTAAAGACACTGGTTCAAAATACAAAAATCGAATTA
AAAGTCGTGTTATGAATCTACGAGATAAACGAAACCCTGCTCTAAAACAA
ATGGTGGCGGAGGGTGAGATTTCACCCGAACGATTCGCCAATATGACGGC
TGAGATACACAAGATAAAGACAAAGAAAAAGAAAAGGAGAAACCAAAAGT
GAATAAACAAACGTCCCAGGAGAAAGAAAGCAAGCCTGCACCACGAGATT
CAAGAGCGGATTCAGGTGGATCGTATGAAGTACCTCCACCCAAAGGAAAT
GATCCAATACGAATACAATGTCGTGAAATGTTGGTCAAATCACTCAAACT
GGAAGGCAGACCAGAAAACTCGTATTGGAATGACAGTAAATGTTGTACGT
AAAGCCAGCAATAAAGATGACATTCAAACTGTTGCAAAAGGTTTAATCAA
ATCTTGGAAAAAACTTTTAGGACAATGAAACAATCAGCGACTTATTAAAG
AGATTGAAAGAATTACCAATCACATTAGACATCTTACAGATGCCTTTAGA
ACAAGATGTATTGACAATTGGTCATCAATTGGAGAAGTTAGTCTCTGAAG
GAAAATCT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000642XLOC_000642Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001182-exon-sc0000007-1575043694:729659..729862TCONS_00001182-exon-sc0000007-1575043694:729659..729862Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1575043694:729203..729271TCONS_00001182-exon-sc0000007-1575043694:729203..729271Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1575043694:728124..728229TCONS_00001182-exon-sc0000007-1575043694:728124..728229Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1575043694:727726..727935TCONS_00001182-exon-sc0000007-1575043694:727726..727935Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1575043694:723905..724098TCONS_00001182-exon-sc0000007-1575043694:723905..724098Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1575043694:723532..723678TCONS_00001182-exon-sc0000007-1575043694:723532..723678Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1575043694:723051..723122TCONS_00001182-exon-sc0000007-1575043694:723051..723122Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1575043694:721829..722094TCONS_00001182-exon-sc0000007-1575043694:721829..722094Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:729659..729862TCONS_00001182-exon-sc0000007-1510915933:729659..729862Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:729203..729271TCONS_00001182-exon-sc0000007-1510915933:729203..729271Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:728124..728229TCONS_00001182-exon-sc0000007-1510915933:728124..728229Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:727726..727935TCONS_00001182-exon-sc0000007-1510915933:727726..727935Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:723905..724098TCONS_00001182-exon-sc0000007-1510915933:723905..724098Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:723532..723678TCONS_00001182-exon-sc0000007-1510915933:723532..723678Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:723051..723122TCONS_00001182-exon-sc0000007-1510915933:723051..723122Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1510915933:721829..722094TCONS_00001182-exon-sc0000007-1510915933:721829..722094Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:729659..729862TCONS_00001182-exon-sc0000007-1491911889:729659..729862Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:729203..729271TCONS_00001182-exon-sc0000007-1491911889:729203..729271Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:728124..728229TCONS_00001182-exon-sc0000007-1491911889:728124..728229Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:727726..727935TCONS_00001182-exon-sc0000007-1491911889:727726..727935Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:723905..724098TCONS_00001182-exon-sc0000007-1491911889:723905..724098Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:723532..723678TCONS_00001182-exon-sc0000007-1491911889:723532..723678Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:723051..723122TCONS_00001182-exon-sc0000007-1491911889:723051..723122Clytia hemisphaericaexon
TCONS_00001182-exon-sc0000007-1491911889:721829..722094TCONS_00001182-exon-sc0000007-1491911889:721829..722094Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001182-proteinTCONS_00001182-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:721829..729862 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
39.5615 34.0986 77.7385 96.129 63.6769 41.8866 41.0182 53.761 23.0138 16.2512 27.4103 18.3584 15.3538 19.9203 22.1745 17.4197 26.8246 25.5305 21.4253 10.505 33.3148 33.944 57.0664 56.9367 22.1968 48.6694 35.3482 24.2779 27.4793 30.3061
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003618TFIIS_cen_dom
IPR003617TFIIS/CRSP70_N_sub
IPR001222Znf_TFIIS
IPR035100TF_IIS-typ
IPR006289TFSII
IPR017923TFIIS_N
Vocabulary: Biological Process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0006351 transcription, DNA-templated
cellular_component GO:0005634 nucleus
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00001182 vs. Swiss-Prot (Human)
Match: TCEA1 (Transcription elongation factor A protein 1 OS=Homo sapiens GN=TCEA1 PE=1 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 5.500e-75
Identity = 138/311 (44.37%), Postives = 196/311 (63.02%), Query Frame = 1
Query:  142 LEQDVLTIGHQLEKLVSEGKSDNETISDLLKRLKELPITLDILQKTRIGMTVNVVRKASNKDDIQTVAKGLIKSWXXXXXXXXXXXXXXXXXXXVNKQTSQEKESKPAPRDSRADSGG------------SYEVPPPKG---NDPIRIQCREMLVKSLKLEGRPEFNPAYIAAD-------IEEATYQMFKDTGSKYKNRIKSRVMNLRDKRNPALKQMVAEGEISPERFANMTAEEMATDELRAEREKMTKQAINEHQLATSAGTSTGQFKCHRCGKRKTSYSQVQTRSADEPMTTFVYCNECGNRWKFC 1008
            +E +V+    +++K+V   K +     DLLK LK +P+TL++LQ TRIGM+VN +RK S  +++ ++AK LIKSWKKLLD    +K+ +++K    K+ +   ++ P  R+    SG             +Y    P+    +D +R++CREML  +L    R   +   I AD       IEEA YQ  ++T  KYKNR++SR+ NL+D +NP L++ V  G I P+ FA MTAEEMA+DEL+  R+ +TK+AI EHQ+A + GT T  F C +C K+  +Y+QVQTRSADEPMTTFV CNECGNRWKFC
Sbjct:    1 MEDEVVRFAKKMDKMVQ--KKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGPSTEKDLDEKK----KEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAAL----RTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC 301          
The following BLAST results are available for this feature:
BLAST of TCONS_00001182 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TCEA15.500e-7544.37Transcription elongation factor A protein 1 OS=Hom... [more]
back to top