Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001168 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001168
Unique NameTCONS_00001168
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3465

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001168 ID=TCONS_00001168|Name=TCONS_00001168|organism=Clytia hemisphaerica|type=transcript|length=3465bp
CGAGTTTGtggctcatttatttttctgtgTTAGGGTCCCACTGGGTCCGT
GATATACAGGAAGGCGTGTAATTTTTACACATAGTCTCACGTCACATCTA
CATCCACCTCATCATGAATGTTCTAGTTGCTTCTAGAGGGTAAAAAAGTT
CCACGATGTTTTGAGTAATATTGAAACTATTTGTTTTTTACTAATCCAAA
TGAAATCCACCCTGTCATAAGAAATACCTACATATCACGAAGAAGATCTC
GATGTCCCacaataaacaaaaacaataatTCAGGTAGTTATTTGAATAAA
AGAGGCAAAAACCCTTCAGATTCTTAAATTAATCTTTTGAGGTTTGCTTA
AGAGGTCTTTGAGCAAACAAAATGAAAGAGGTTAGATTGTAAATATATAC
TTGCAAATAATGTGGAAAAATAACCGATTCGAAAACAAGCAACATCATAA
GAAGGAGGAGGTATAGTCGAAATTTTACGAGTTCGCCATTTTGATTCGGT
AAATTTAAAGTCAAGGAGTTGAACACAATTAAAATGGGCGTTGAGGGCGT
CACAAACGAATCGTTCCACCATCAGGGTGAGGACCATCAACATCAACACG
GAACATCTAAACACGCTGACCTCAAACACCTTCAAGAACATTACGATGAA
ATCACAGATACAAAACTCCCTGAAAATCTACACCGTGGTGACATCACAAC
TGTCAACCGTTTCCTTGGTTACCATGATGCCATGATGGCTACCTGCGGTA
CCTTTCTCGTCTTACCATTACGTAATATCAACAACATGGTCAAAGCAAGT
GATTATGACGAGTTAAAAAAGAATCACAAACTGCCCCATGACCCTATCGT
TGTTGATGATTTAGCTGGTTATCTGGACGCAATGAAAACCGAATTCATTA
TGTTCTTCCTTGGTTTTCTTATTATATGCACGATTTGGGAGACCAACATC
ATTCGAACAAACGTCATCAAAAGATACGATGATTTCATGGTGATANTTGG
TTTTCTCATTATTTGCACGATTTGGGAGACCAACATCATTCGAACAAACG
TCATCAAAAGATACGATGATTTTATGGTCATGCTTGGACTCTTCCAGATG
GCAGCCATTGTGGTTCTCCCATTCTCCATCGCTTTGAATGGTGCATACCC
AAGAGAGGATGTGACTGTGCTCCTCACCATAACCATTTTGATcattatca
acattttcgaacTGATCATGATTTTGTACGGATTCTACTGTCCAAGGTTG
CTCAATATGGCTATGAAAGACTGGAGCAATAAGGAGGTCCGACGGTTCAT
GCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCTGCTGGTTGGAGTGG
CAGGGGCTTTCACACTTCTGAATTACCAGATTGCGTGGGCCATGTTAGCC
TTGCTGGTCATTTCTCCGTTGATGCGGAAGTTAGGTTATTATTACGAACG
CCATCATGTGGGTTACGAGAAGAGAGAAAAATGCCgtttcttttatttct
acaCAAAGGGACAGATCAGTAAAGAGAGAGTGGAAGCTATGTCGGATGCA
GCGATCGCAATTATAGcctgtgttttgattttggacATCACAGTGGAAGA
CTTCCCTACAAAACATGCTGTCCATGAAGAAGGTCTGATCAATGTTTTAA
GAGAAATGAAATTCGATTTTGGAGCATTCTTCGGAGCATACTGTGGTGTT
TCCATTTTGTGGTACATCAACCACACTGTGCTCAACCTTTTCCACACTAT
CGACATTGGTACCTTGTATCTTCAAAAGATCTTCCTagctttcctttgtt
ttcttccCATTGTCAATAACATGATGGTAAGATACGGTTTCGGACAGGAA
GGTACGCAAGCGGACCGTCGATTGGCTATTCAATGGTCTGGTGGAATATC
TTTTGCAGCAGGTATCACTCAAACCATGATGGTCGTTTGGGGATATTTCC
GTAAAGAGAAGCTCCTTCACCGTTGGGCCACGTGCAACAAAAGTGAAATG
AATCGCAAGCAACTTTTGTATGTCCGAAGCAAAATTTGCGCTGTTCCCAT
TTGGGCGCTTCTTTGTATTTTCTCATCCTTGGCACCAGGGTCGACGTCAG
TCTATCTGCTCCTGGCGTGTGCCGTGGGTAACCTTCTTACCATGTTGATC
CTGAAGTTCATGTTTATGAACCACATCAATGAGCCAGGTATCTCCATCTT
CGATCATTCCAATCACGGATCCATACTTTCCAACGGTAGTGGTTGCGAAA
TGCGTAAACAGATGAAGCAAGAGATCGCTGATGGTTTCTACGATTCAAGA
GACCATTCTGCGGGCGAATGTGACCTTCGAAAGGGTATGGCGGAAGAGAT
AGCGGATGGGAAAGTTTACCAGGATGAAAATGAGATGGAGAGAGAAGTTC
TGGAAGAGGcggaaaagaaagaaatttaagACGAACAAAAGGAAGAACGG
CAGGAAAATGACATGGCTCAAAACCACCTTCAAGGTGACAAGCAAGACAC
TATCTGTTGACGATTGATCATTGACTGATTCGAGTTTATTTGATAATTGA
TTTTAGGTTATTTCAACAGTAAATATATAACTAAGTAGTATTGCATATAT
TTTTAAGGTTACATTGTTAAGTTATCTTTTCGTAAGTTTAATTCTTGGAT
TTTTTACACTCACTATGTCTAACTGAAATTGTACTACTTTCGTCTCAATT
TACACCTCGTCAAATATTTTGGTTTACTTTTCACTTCAATCGGAGTCAGT
ACTTTGTTTACTCACTCCTTTTTCATTTGGATTAGAATTACCAAATATTT
AAACATTTGTAAAATAAAGATACTGTATAACATATGATTATATAATAATA
GCATGGCTAAGAATTGGTTTTATTAGAAAGAAACAAATTTTGCTACGATT
CTGTACTTAAAGGGCTCGCCACCTACTTGCCTACTTAATTGTAAGTTCAA
ATAAAAGTGGTATTTACATTTCAGAGGGCGTGCCAAAAAATAATGATCGG
tgcaaattcaaaatgaagtgAACTGTGCCTAAccttcgagcatcttccta
tttattttactTGAGAAGCATCTTGGGGGAGGGGGGGGCTTAAAATCTAA
AGATTGAAAAGTAttatgaccttgaaatttctaCCAGTGGTAGGTATGGA
TGATTGGAGATAATTAGCGTTTGGCCACCTGCCTGATTAGTACTTCACAG
ATCAGAATAtaaatttggctaaaatcaCATATTCGCCGATTGACTCGTTC
GATTTGATTAAAATTTGCTGCTGAAAGCTGGTTTGTCAAATAATGCAATC
CCTGGATAAAGTAACCAACCCAGTCCTATTGtcggcattttcaaaaaata
gcgATGTCATCAGGTAGCGATGAAGGTATCAATAATGCCAAAAATGTAAC
CAAGGATGCCAATTCATATAtagaatttcaagtcaattggggaatatttt
caaagttctcaaatt
Run BLAST on NCBI

transcript from alignment at sc0000007:650377..654241-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001168 ID=TCONS_00001168|Name=TCONS_00001168|organism=Clytia hemisphaerica|type=transcript|length=3865bp|location=Sequence derived from alignment at sc0000007:650377..654241- (Clytia hemisphaerica)
CGAGTTTGTGGCTCATTTATTTTTCTGTGTTAGGGTCCCACTGGGTCCGT GATATACAGGAAGGCGTGTAATTTTTACACATAGTCTCACGTCACATCTA CATCCACCTCATCATGAATGTTCTAGTTGCTTCTAGAGGGTAAAAAAGTT CCACGATGTTTTGAGTAATATTGAAACTATTTGTTTTTTACTAATCCAAA TGAAATCCACCCTGTCATAAGAAATACCTACATATCACGAAGAAGATCTC GATGTCCCACAATAAACAAAAACAATAATTCAGGTAGTTATTTGAATAAA AGAGGCAAAAACCCTTCAGATTCTTAAATTAATCTTTTGAGGTTTGCTTA AGAGGTCTTTGAGCAAACAAAATGAAAGAGGTTAGATTGTAAATATATAC TTGCAAATAATGTGGAAAAATAACCGATTCGAAAACAAGCAACATCATAA GAAGGAGGAGGTATAGTCGAAATTTTACGAGTTCGCCATTTTGATTCGGT AAATTTAAAGTCAAGGAGTTGAACACAATTAAAGTAAGTATTTCACAGAA CAATGATTAAACCTTTCAAAAATCATAGCGATGAGTACGACTTTCAAACA TCTTTTTGTCAGGAAAGAAGAGATCGAAAGATTAGCATGCATTTATTACA CGTACTTTAAAGTATATACAAAGACAACATGGTATAGATTTCAGTCTTAT TCAAATAGTTTAGAATAGTCCCTTATTTCTGACTCCCGACTTCCCTCTCA GTCACATTATATACAACTTATTCAGACATCATTTCTGCTCCAAGAGGACT CAACCCAAATATTCTCTTTTTGTAGATGGGCGTTGAGGGCGTCACAAACG AATCGTTCCACCATCAGGGTGAGGACCATCAACATCAACACGGAACATCT AAACACGCTGACCTCAAACACCTTCAAGAACATTACGATGAAATCACAGA TACAAAACTCCCTGAAAATCTACACCGTGGTGACATCACAACTGTCAACC GTTTCCTTGGTTACCATGATGCCATGATGGCTACCTGCGGTACCTTTCTC GTCTTACCATTACGTAATATCAACAACATGGTCAAAGCAAGTGATTATGA CGAGTTAAAAAAGAATCACAAACTGCCCCATGACCCTATCGTTGTTGATG ATTTAGCTGGTTATCTGGACGCAATGAAAACCGAATTCATTATGTTCTTC CTTGGTTTTCTTATTATATGCACGATTTGGGAGACCAACATCATTCGAAC AAACGTCATCAAAAGATACGATGATTTCATGGTGATANTTGGTTTTCTCA TTATTTGCACGATTTGGGAGACCAACATCATTCGAACAAACGTCATCAAA AGATACGATGATTTTATGGTCATGCTTGGACTCTTCCAGATGGCAGCCAT TGTGGTTCTCCCATTCTCCATCGCTTTGAATGGTGCATACCCAAGAGAGG ATGTGACTGTGCTCCTCACCATAACCATTTTGATCATTATCAACATTTTC GAACTGATCATGATTTTGTACGGATTCTACTGTCCAAGGTTGCTCAATAT GGCTATGAAAGACTGGAGCAATAAGGAGGTCCGACGGTTCATGCTGAGAA TGTGCATTAAGCCAGTAATGGAGATTCTANGATTCTACTGTCCAAGGTTG CTCAATATGGCCATGAAAGACTGGAGCAATAAGGAGGTCCGACGGTTCAT GCTGAGAATGTGCATTAAGCCAGTAATGGAGATTCTGCTGGTTGGAGTGG CAGGGGCTTTCACACTTCTGAATTACCAGATTGCGTGGGCCATGTTAGCC TTGCTGGTCATTTCTCCGTTGATGCGGAAGTTAGGTTATTATTACGAACG CCATCATGTGGGTTACGAGAAGAGAGAAAAATGCCGTTTCTTTTATTTCT ACACAAAGGGACAGATCAGTAAAGAGAGAGTGGAAGCTATGTCGGATGCA GCGATCGCAATTATAGCCTGTGTTTTGATTTTGGACATCACAGTGGAAGA CTTCCCTACAAAACATGCTGTCCATGAAGAAGGTCTGATCAATGTTTTAA GAGAAATGAAATTCGATTTTGGAGCATTCTTCGGAGCATACTGTGGTGTT TCCATTTTGTGGTACATCAACCACACTGTGCTCAACCTTTTCCACACTAT CGACATTGGTACCTTGTATCTTCAAAAGATCTTCCTAGCTTTCCTTTGTT TTCTTCCCATTGTCAATAACATGATGGTAAGATACGGTTTCGGACAGGAA GGTACGCAAGCGGACCGTCGATTGGCTATTCAATGGTCTGGTGGAATATC TTTTGCAGCAGGTATCACTCAAACCATGATGGTCGTTTGGGGATATTTCC GTAAAGAGAAGCTCCTTCACCGTTGGGCCACGTGCAACAAAAGTGAAATG AATCGCAAGCAACTTTTGTATGTCCGAAGCAAAATTTGCGCTGTTCCCAT TTGGGCGCTTCTTTGTATTTTCTCATCCTTGGCACCAGGGTCGACGTCAG TCTATCTGCTCCTGGCGTGTGCCGTGGGTAACCTTCTTACCATGTTGATC CTGAAGTTCATGTTTATGAACCACATCAATGAGCCAGGTATCTCCATCTT CGATCATTCCAATCACGGATCCATACTTTCCAACGGTAGTGGTTGCGAAA TGCGTAAACAGATGAAGCAAGAGATCGCTGATGGTTTCTACGATTCAAGA GACCATTCTGCGGGCGAATGTGACCTTCGAAAGGGTATGGCGGAAGAGAT AGCGGATGGGAAAGTTTACCAGGATGAAAATGAGATGGAGAGAGAAGTTC TGGAAGAGGCGGAAAAGAAAGAAATTTAAGACGAACAAAAGGAAGAACGG CAGGAAAATGACATGGCTCAAAACCACCTTCAAGGTGACAAGCAAGACAC TATCTGTTGACGATTGATCATTGACTGATTCGAGTTTATTTGATAATTGA TTTTAGGTTATTTCAACAGTAAATATATAACTAAGTAGTATTGCATATAT TTTTAAGGTTACATTGTTAAGTTATCTTTTCGTAAGTTTAATTCTTGGAT TTTTTACACTCACTATGTCTAACTGAAATTGTACTACTTTCGTCTCAATT TACACCTCGTCAAATATTTTGGTTTACTTTTCACTTCAATCGGAGTCAGT ACTTTGTTTACTCACTCCTTTTTCATTTGGATTAGAATTACCAAATATTT AAACATTTGTAAAATAAAGATACTGTATAACATATGATTATATAATAATA GCATGGCTAAGAATTGGTTTTATTAGAAAGAAACAAATTTTGCTACGATT CTGTACTTAAAGGGCTCGCCACCTACTTGCCTACTTAATTGTAAGTTCAA ATAAAAGTGGTATTTACATTTCAGAGGGCGTGCCAAAAAATAATGATCGG TGCAAATTCAAAATGAAGTGAACTGTGCCTAACCTTCGAGCATCTTCCTA TTTATTTTACTTGAGAAGCATCTTGGGGGAGGGGGGGGCTTAAAATCTAA AGATTGAAAAGTATTATGACCTTGAAATTTCTACCAGTGGTAGGTATGGA TGATTGGAGATAATTAGCGTTTGGCCACCTGCCTGATTAGTACTTCACAG ATCAGAATATAAATTTGGCTAAAATCACATATTCGCCGATTGACTCGTTC GATTTGATTAAAATTTGCTGCTGAAAGCTGGTTTGTCAAATAATGCAATC CCTGGATAAAGTAACCAACCCAGTCCTATTGTCGGCATTTTCAAAAAATA GCGATGTCATCAGGTAGCGATGAAGGTATCAATAATGCCAAAAATGTAAC CAAGGATGCCAATTCATATATAGAATTTCAAGTCAATTGGGGAATATTTT CAAAGTTCTCAAATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000634XLOC_000634Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001168-exon-sc0000007-1575043694:653709..654241TCONS_00001168-exon-sc0000007-1575043694:653709..654241Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1575043694:652664..653416TCONS_00001168-exon-sc0000007-1575043694:652664..653416Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1575043694:650377..652555TCONS_00001168-exon-sc0000007-1575043694:650377..652555Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1510915933:653709..654241TCONS_00001168-exon-sc0000007-1510915933:653709..654241Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1510915933:652664..653416TCONS_00001168-exon-sc0000007-1510915933:652664..653416Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1510915933:650377..652555TCONS_00001168-exon-sc0000007-1510915933:650377..652555Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1491911889:653709..654241TCONS_00001168-exon-sc0000007-1491911889:653709..654241Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1491911889:652664..653416TCONS_00001168-exon-sc0000007-1491911889:652664..653416Clytia hemisphaericaexon
TCONS_00001168-exon-sc0000007-1491911889:650377..652555TCONS_00001168-exon-sc0000007-1491911889:650377..652555Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:650377..654241 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.217967 0.201715 0 0.0972702 0.411104 0 0 2.15627 6.18353 7.20043 1.33079 1.2217 0.849344 0.4185 7.66606 4.18429 4.1935 4.74874 0.277982 0.336968 1.08888 1.15643 2.70068 2.83831 0 0
Blast
BLAST of TCONS_00001168 vs. Swiss-Prot (Human)
Match: TM175 (Endosomal/lysomomal potassium channel TMEM175 OS=Homo sapiens GN=TMEM175 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.697e-16
Identity = 87/341 (25.51%), Postives = 154/341 (45.16%), Query Frame = 3
Query: 1002 FLIICTIWETNIIRTNVIKRYDDFMVMLGLFQMAAIVVLPFSIALNGAYPREDVXXXXXXXXXXXXXXXXXXXXXYGFYCPRLLNMAMKDWSNKEVRRFMLRMCIKPVMEILLVG-----VAGAFTLLNYQIAWAMLALLVISPLMRKLGYYYERHHVGYEKRE--KCRFFYFYTKGQISKERVEAMSDXXXXXXXCVLILDITVEDFPTKHAVHEE---GLINVLREMKFDFGAFFGAYCGVSILWYINHTVLNLFHTIDIGTLYLQKIFLAFLCFLPIVNNMMVRYGFGQEGTQADRRLAIQWSGGISFAAGITQTMMVVWGYFRKEKLLHRWATCNKS 1994
            FLI+   W  +     V+ + DD + +L L  M  I  LP++ +L   +P   + + L    +I I + + +++ Y F+ P LL+  ++  +++ + R       + V+ I+L G      A  F+L    +++ ++  +++ P + K+  +     +G+ +        F F     +SKERVEA SD   AI+A +LILDI  ++ P    V E     L+  L      F A+FG++  V +LW+ +H++             L  + LAF+  LP+       +   Q   + +R   ++ S  I F A I Q  M  W       LLH+  T   S
Sbjct:   85 FLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYR-------RHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFA-RQPRDELER---VRVSCTIIFLASIFQLAM--W----TTALLHQAETLQPS 408          
The following BLAST results are available for this feature:
BLAST of TCONS_00001168 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TM1752.697e-1625.51Endosomal/lysomomal potassium channel TMEM175 OS=H... [more]
back to top