Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001158 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001158
Unique NameTCONS_00001158
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5052

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001158 ID=TCONS_00001158|Name=TCONS_00001158|organism=Clytia hemisphaerica|type=transcript|length=5052bp
CAACAAGGAGATAAGAGCTCGCTTAAATATGGTCTGAGTTTCAAACAGAA
ACATCATGACAAATTTACGAAGAGAAAGACTCATTGAGATGAGAATGGAG
GAGGATGTTCGGATACAGTTGTTCCAATCGATCGAAAACAATAATTTAGA
CGGTGTCATCGATTGTATCGAAGAAGGTGTCAACCTCGAAGAAGCTGATT
CGCATGGACAAACACCACTGATATTTGCAGCAGAGAAAGGCCACCTGGAA
ATTGTTGCGGAACTTCTCAATCGAAATGTCGATGCTAACGCCAAAGACCA
AGACGGTTGGACACCACTGATAGCGGCATCAAAAGAAGGCCACGTGGATG
TTGTCGGTGTTTTGTTGGAGAATGCTGCTAAATATAACATCCCTGATATG
GGTGGTTGGACACCTTTGGTGTGGGCAGCGTATAAAGGTCACACTGATGT
TGTTCATGAGCTCCTTAATTACGGTGCCAACCCTGAAGCTAGAGGGCAGC
ATAATATGACAGCATTGATTTGGGCGTCAGGGCGTGGTCATACTGGCGTT
GTTTCTAAACTCATCAATAGAGGTGCAAAAGCAGAAGTAGCTGATAAGTA
TGGTACAACGGCATTAATATGGGCGTGTCGCAAAGGTCATTATGAAGTCA
TCAAAATGCTTTTAAATGCTGGTGCTAATTGCAATGCAGTGGGCACGcaT
GGTTGGACACCGATCATAATGGCGGCTAAAGGAGGTTATGGAGATGTGTT
GACTTTATTGTTGGACGAAAGCACCAATGTAAATGCTGTCGATCACCAAG
GTCTGTCGGCCTTAGGATGGGCAGCcaaagaaggttacgaagaaCTAGTT
GGGAAGCTGATCGGTAAAGGAGCTTTCCTGAATATCCCTGACAATCGCGG
TGATTCTCCCTTGATCATTGCTTCAAAGGAAGGACATGCAAGTGTCGTTC
GCACATTAGTCAACGCCTATGCTGAGATAGAGATCACTGACTCCgatgga
aaaacagctttgtTCCATGGCGTTGAGAAAGGTCACGTGGCAGTAGTTCG
GGAGCTCTTATTGGCTGGTGCAAACACAGAAGTAACGAACAAGGAAGGAG
AAACGCCCTTGTTGAGGGGCGCCAAACGTAAACACACGCAATGCGTCAAA
CTGCTTCTTGAGAAAGGTGCAAACCCTGCCATCACAGATAAGAAAGGAGA
TACGCCTCTACACATTGCCATTCGCAATCGATTCGCTGGTCTTTGCGAAG
CCTTACTAAACGACCAGAAGAATTCCAAGATTCTACACCAGCCAAACAAA
GCCGGCGAAACACCGTATTCGATCGACCTTCAAAACAAACCATCCATTTT
ACCTGGCTTCTTTCAAGGACAACAAGTGAACCATGACTTTGACAAGATGG
ACTACTGCACACAACAAGAGCTCTTACTCGCTACCATCTCCGAGTATTTG
ATGGAACCCTCTTTCTCTACTCCTCTCACCCTCGGAATGTACTCGAGATG
GGGTACTGGCAAATCTACACAACTAAAACGACTAGTCGaaTTATTAGAAG
AGGCGAAATCATCGGTGCCGATTATTCCATTCCGCGTGACAGCACCTGTC
GTTTTCATGTGTATCCTGGCTGCTGTCATTCTCTCTGTCGTCTTCTGGAT
CGCCACTGATTCCTGGGAAGTCGGTGTCGCGTCAGCCATCGTCCTTGTTA
ACGTTTTCCTCATCTTTTTCGTGGTCGCACGTGTGACCTTGATCAGCCAT
AGTAGGGGTTTACGATCTGCTGGTGAGGCCATGACCAACTTCATTTATCG
TTGCGTTTGgtttttgaaattgatttatTGCATCCCTCCCTCAATACAAG
AAGTGAAACCTGCTCTACCCGTTCATTTAATGACTGTTGATTTAACGAGA
AGTGTTTTGGTGGGCGATAACCCGATGACGTCACTTGTCAATTTCATACG
AGAACTGAATGATTCTATTGAACAAAATATAGGAATAGTAATCCCGAGGC
TGTACCGTATTTTCCAATCCGGACCATACCGGACACCGTCAGGTGGCAAG
TCTATTTTTCGGACAAAATGGAAGAAAAGTTGTTGTTGTGTACCCTCCTT
CTTGATCTCAATAGTGGTCTTTGCTTGTCTATTAGTTGGATTAATATTAT
ACGGTGCTTGGAAGTTAAATGGACCGAGTGCAGCGATCGCCATCCAAATA
GCTTGTTTATGCGTTCTTGGAGGCTTTTTGTTAGCCAATCTACTACGTTT
CTTTATCATTATATACTGTTTAGTACTTCCCATGAAAAAACGCGTCAATT
TTGTTTCCACACAAGCAGGAATACAAGAAGAAACTTTTCTATCCGTTGTC
AAACAAGAATTAGATTTGTGCGTAGATATGTTAGAATGTCTTGATGGCTT
TGCACAACGCCAAACACGTATCATTGTTCATATTGATTTACTGGAATCTC
TGGAGCAACAAAAAGTACTGGGGCTCATCGACTCTCTCAAATTTATGATA
AGTGCTCCTGGCCATCCGTTTATTTTCGTACTTTCAGTTGACCCAAGACT
TCTAATTAAAGCTATGGACCAATCATTAACTATTGTACATGGACCTGTGA
ACGCATACGATTATTTAAGAAACTTAGTAGACTTACCTTTTTATATATCA
GAACcgtcaaaaacgaaagtggatgGTTTAGTACCTTTAGAACTACGAAA
TATTTTGGAAGATCAACAAATCTCAGATAATGAAGAAAGTGAACTTGAAT
GGGATGATAATGCAGACATTAACGGTGACGTCATCTCTCGCGTATCTTTA
CCACGTGATCAACAGAAACATGACGTCATCGCAAATGGAGGAAACGGTCA
CGTGCCTAATGGGAACGGTACGGTACCGAAATTACGATCAGTGAAGTTCC
CTCCGGAACAAAGTGGAAATGATGGTTGCACCAACAATAATGAGTCCATC
TCTGAGGATATTTCAAACATGATTCGAACAAATATGAATGGAAATTTAAA
CGATATCAAACGTGTCATGAACGTTATCTCGCTTAAAGCACGTATCTTGA
AAAGCTCCGATATACATTTCCAATTACCACGACTCGGTATTTGGGTCAAT
ATGTGCGACGTGTGGCCTCATAAAGCCAGTTGGTTCATTTTACTATGTAT
GGATGTTTCGTTGGCTCTTCCCGATAAAATGAGTATCCGCAGGCTTTACA
ACTTGCTCGGATACGCGATGCCCATGGTAGGCGATCACGAAGAGAATACT
GGCAATGCTGCCAATTATTTTGATACGTTTTTAGCATCACATAAACCGGT
GATTAATGTGGCGgacgttcgaatgtttacacCCTTCCTGTTTTACTTGG
ACCCAACCATCCGTAGTTTGATGATTGATTACATGGTAGCATTGAAGAGT
GGAACAATCTCTAAGAACCCCTCCATCGCACACCAGTTCTCCAGTAGATC
AAACTTTCCCATTTCACCAAGCGACTCCAGCAAGTTTATTTGGCGAGGTG
GCATCGACGAACAATATTTATCCAAAATGACACCAGAAGACGTCGTTTCA
CAGCTGGCAGAGATCGAAGGTATTGAGACGAGTTTGGTGCCATCTTATCG
CGATCGTATCTTGGAGAACAACATCAATGGTCGTGTGTTGATCTCTTGTG
ATATGAATGAACTTCGTGAAGCGATGCAAATGAAATTCGGTGATTGGCAG
CTTTTCAAAGCGTGGATCAACTCGTCCAGATTCAAAGACAACAGTTCAAG
GAGTGAGAAATCATATTACCGCCCTTCATCACGAAGTGCAAATGGTGACG
GGAGCCAATCAGAATCGATCCCCGGTTCACCGAAACAATCATCTGTCAGT
AGTTACAACCCAACGCAAAAAGGGACGAGTCGATTGCCTGCGTTGAACGA
GACACCGGATTCCTCGTCTAACCAACCTTACACCAGTCACTCTCCGCGCA
ATTCACCTCTCCAAAGTCGCACGCGAAGCGGAAAACAACGCAAAGGAGGT
AAAAGTAAAACTCGTTCACTGGAAAGTGAGGGAAGCTCTCCATTGAAAGG
ACCTTCACCTAACCCAACATTGCAACGATCGGCAGATTCGAGTTTTGCCA
GTACGGATGCTGATAATCGCTCCCAACAATTGAGTTCATTCTCTGATAAC
GAACCGTCTTCAAGTCGCTACGTGCAACGAGTGGGATCAAACAATCGACA
GGTGACGCGACCTAAACAATACCATCAACAACCACAGCGTAACCGTGTAC
CACCAATAGCAGGTCTCGATCAAGGAGTTGATTCTCTGGAGCGAGGAACA
AAACCAAGCGATACTTGGATAGGAAAGAACGAAAGATctttcaataaaac
aaacgatacAATCAGTTCCACTTCATCACAGGAGTTCATCCAAACGTCGT
TCGAAAAACAAGAAGAATCGTTACATCAAATCAAACCATGGCAACTATCA
GATGGAGACGAGTCATGTTCAGAACGAGGCAATGAAATTGTGGAAACAAG
TTTTACCTCTACACATCAAAAGCGTCATTTGACGTCAGGTCTTCGTAAAG
AGACACGCCCTCCATCGCTTTCAGAGGTACCTTTACCACCAGCCTCCATG
TTGAATGAATCGCATGAAGACTACATCGATCTCGAGAACCACGACAGTGA
ACATGACGCCCTTCTCTCCTCTTCACCGCCCACCTCCCTCGACCGCAAAA
ACGCTTTCCAAAATTCCGCCCGATTACGAGGAATGTCGAACTATACCACA
TCTACGGACTCTGATAGGCAATATTTAGTTGAAAATAATAATGTAGTCGA
CAGCTAATagtttttagtttatttttagtTACCAATTCTTTTATTACCTT
GCTCGATTGCACATAGTTGAACTTGTGtacatatttttccaaaagtttcc
ccccttttccttcattttttatgtttaaatatttataaatttcttttttt
aacgaTGATGGAATCTGTGCCCTTtggtttttttagttttcaagttaTAA
ATGTACGGAGGAgctatattttttatataaatatatTATTACActatttg
aa
Run BLAST on NCBI

transcript from alignment at sc0000007:597726..611654-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001158 ID=TCONS_00001158|Name=TCONS_00001158|organism=Clytia hemisphaerica|type=transcript|length=13929bp|location=Sequence derived from alignment at sc0000007:597726..611654- (Clytia hemisphaerica)
CAACAAGGAGATAAGAGCTCGCTTAAATATGGTCTGAGTTTCAAACAGAA ACATCATGACAAATTTACGAAGAGAAAGACTCATTGAGATGGTTTGAGCA TTTTTTTTTCTTTTCAAGGCCTACCAATGATACCAAGTGATACCAGGGTT GAATATATCAGCTCTCTAACATATTTTTTCTGCAGTAAGCCGCCTGATGT ACATCTATATGACGTGTTTGAAACGTACGTTTTCTAACGAAGTGTGTTCC CGTTTTCGTTTTGTTTGTAGAGAATGGAGGAGGATGTTCGGATACAGTTG TTCCAATCGATCGAAAACAATAATTTAGACGGTGTCATCGATTGTATCGA AGAAGGTGTCAACCTCGAAGAAGCTGATTCGGTAAGTACAACTTATATTC TTTCTTTACTTTTTGTCAACCCTTTGTTATCTTTATGGGTGGTGTCTTCA CGCATGGAGCGTGTACAAAGGCTAGTGTATAAGTGTTTTGTTTACGAAGT TTGGTTGTTGTTATGACAAATCTTGTCAAATCTTAACAAATATTTTCCTC TTTTCAACTATCTGCAGATGAGTATCGTGGTTGGTACTTATATCAGTAGA AAACAAGGAATTTTGTCAAACTCCCATAAAGCTGGATGAGAAATATTTTT GTTTTCGATTTTCCCTTCAAATATTTTAAGCTCAGACATATAACGATAGG ATTATGGGATAGAAAAAGAAAAAAGATGGGCCTCCTTAAAATATCTTGCA ATTTCAAGAAGGTTTTTTTCGTAATATCGTTAATAGGTCTGTCTCTGTCT ATTTTTGACATACGGTTGTTTTATTCATGTGTACAGCGAGAATAAAAAAT TGATTAATCCCAATGTTTTTTGAAACTTCAGAATTGTATTATTGATTTTT CAATTCATGTTTTCCTAGAAAACTTCATTAAAAATATTTTCGTGTGTTAA ATAACTAAGAATGAGCTATGAATAAAAAACAATTACAAATTTCGTATTTT CATCCTTCAATAATACATTGGAATTGGGAAGGGTTTGAAGAGCCCGAAAA TATCTCAGCAATTTACTTCCCACTCTAAATTCTTAAAAAATAATATAACA ATCACAATCCACCATTTGTGTCGTTCAAATTCCCCATGTGTAATTTTGTT CCACTGTTTCCATTGAATCAGCGAGACAAGGCTGTAAACATTTGCATTTT TATTTCAAAAATGTTCAAGATGAAGTTGTCTAAACAGTTTTTTGGTATTT TTTACAATATTTTCTTCCAAGTTTTTACCATATTGGAATGTTAAGTCCAC CGAAAAAAGAACAATTGTTTTAGCTTTGTTGTAACAAGTGAGTTTATTCT TTCCCATCTTAGCATGGACAAACACCACTGATATTTGCAGCAGAGAAAGG CCACCTGGAAATTGTTGCGGAACTTCTCAATCGAAATGTCGATGCTAACG CCAAAGACCAAGTAACATATCTCTTATGATATAATGTCACTTTATATCCA CTTGGTACCCTTTCTATTCCGTGCATACGTTTTTCCATGCAAAATACGAG AACTCTTACATGAATCTGAGATCGGTATTAAGGTGAAAAAATATTTAAGA TTCTGATTTCTGGTCCTACTGTCTCGCCCAAGTTTTCTCATCGCAAAAGA AAAGTTTAAGTAATATAAATTCATAATATCAATTATCATTGAACGGAGGT TTTTAATAATTTCAAAATGGCATTTTACAGGACGGTTGGACACCACTGAT AGCGGCATCAAAAGAAGGCCACGTGGATGTTGTCGGTGTTTTGTTGGAGA ATGCTGCTAAATATAACATCCCTGATATGGTAAGTGTTGCATTTCCAAGG GATAACTATTGCTATGTTTCATAAAGATTGTTTCCTGGATCTTTTCGTAC CCCCTATATTGCCTGCTAACTATTATGTTTTATTTGTATCATACTTCATC ATTTTTGATGTAAATTCTAGTGTTGATATGATGAACTCTCATCCTTTATT TACGTTAATCTTGTTTCGTCTCAACCATGCGCTCGACTGATTACGTTTGA TAAGAGAGTGAGAGAAAGAGAGAAGGGGAGTTATGTTATGCCATGCATGC GAGATAGTGTAAATGATACCTCTCTTTTCCATTATCTGTTTATGAAACAG TAACTTGCACAGCGTGGTCAACAGAATGGCTAATCGTCTTATAAGCCACA AAAACCCAAACCATCGTGTAACTTCATTTGAGCCAGTTTAAGCTCATCAA ATATTTTCGCAGCCAGCGTGACCTATTCCATGAGCTGTCTCCATAATTCT GTTAATCTCAATTAAAATATGTCAAGGGAAAAGTTGAAATGTATCACTGA TAATAACGATCAATCTCAAAATTGATATGTCTAAACTCTAAAGCCTTTTT AATTTCGCTATAACTACTTTTCTACTACGGCAGTGACCTGATCTTTGATA GTAAATTGCGCGTATTCTTTTAATGGTAATTGATTAAATGAAATTCCTTT TGTCTTGACAGGGTGGTTGGACACCTTTGGTGTGGGCAGCGTATAAAGGT CACACTGATGTTGTTCATGAGCTCCTTAATTACGGTGCCAACCCTGAAGC TAGAGGGCAGGTAGGCTCATCTAATTTTCTATACCACGTTCAATCCAATG TATGTTTTTATTATTTATTTTTGAAATTAAAGCGATACCCTTTATTTGTA AAGTACTAATTAATCTATTGAGAAAATATTAAAAGATGAATAAAAATTAA CATGCTCGACTGTGCATGACGCCAATTAATCGTTATCGATACCTAATTAC TCTTAATCTCTTATGACGCAATTCGTTCGCTCTCCCTTAGCATAATATGA CAGCATTGATTTGGGCGTCAGGGCGTGGTCATACTGGCGTTGTTTCTAAA CTCATCAATAGAGGTGCAAAAGCAGAAGTAGCTGATAAGGTACCTACATC CATTTCTTACTATTTCTCACTATAGACTATGATTGCCAATTAAAAAGAAT ACAAATCTTTATTTGTAAGATGACAGGTCAAGATATTGTCATTAGTTAGA AATCAAGTTTTCAAATTTTTCTTTACTATACTCTGTACCATGCGATAACT ATTACTTATAGTGAGAGCAGAGTGATTATACATAGGCGTATAATCCATGT AATTAACGATTCCCTCTTTCTCTCACAATTTAGTATGGTACAACGGCATT AATATGGGCGTGTCGCAAAGGTCATTATGAAGTCATCAAAATGCTTTTAA ATGCTGGTGCTAATTGCAATGCAGTGGGCACGGTAAGATCGATTTCTCCC AAAAAGGGGTTTGTTTTCTCTAGGAAAGCTGGCAATTTCTTACATTTAAA TACAGATTTGATCACGGACATCGTATACTCTCGTATAGAATTGTGTAGGT TTGAGATTTTGAGAATTAAGAGAATATTTGAATGCTAGTCACTCTTCCAT TTTGAGACAATTGTTCGGATGATTGATATACTGCATCAGGACATTTCTAT ATTTGAAATGATTAATTGAAAAAGTATGCATTAATATCGCACTTTCTTTT GATATCTTCATCAGCAAGTTTTTTGATGCGTCTAAAGTTGTAAAATATTT CACCTTTTTTTTCTTGAGTGGCTTTTGTATAAGACTGTATTAAAATCTAG TGATCTAATTAAAGTTTCTTTCTTCTGATTGTATTGACGTGATATTCTCA GAGTAGAGAAATAATGCAATGGCCTGTGGATGGCATTGATTGATATCTTC TCTCATGCTAGACTTGGACAAACATTATGATCAATCGATGGGTAGATATA TAAGGCTTTTAGATTTCAGTCTGGAACTTTTTCAGGCTGGATCTATTCTT CTTTGTTGTCTAATCATTGTTATTGGTTGATGGATTTAACTTAACTCTAT TGGTCCTGTATAGATTTTTCTCTGATCTTGGAATGTAATTTCGTGAAATT CGTCATTGGGTTTTTTGAAAGTTTTAGTCAAAGTAAAATTTAACAGAGAT TTCAATTGTGTGATTTAGTTGTCCTGTATTGTGTGCCATTTCTATGCTAT TTCTATGCTATTTCTACACATCAGATTAAAGGACTTTTCTATGATACACA TCTCTTTAAACTGATTAAGAATGTTCATTAACAGAAAGGAGAGAATGAGG GGGAGTTAATATTCCAATGCATTCTAATTAGGCTTTTTAATTTGGCAGAA AAGTTTTAATGGTGTGAATTGACGAGGTGAAGGTCGTGACATCTCATTGG CGGTCTGTCATTTTATCAATTTGACCCTTGAAATTGGGAAATATTACTTC AGTACTTGACAAGGATTTAGCTGGGAAGACTTTGGATTTTGTTGTTTCTG CAATTTTTCAGATAAGTTTCTTGATTTGTTAATTTGGTTAGCAAACTGAT AAATTTCTTGATCAGTGATAATGAACTGATAAGACAAAAAACAAAAAGAC TGAGGGAAAATGGAAGAATGTTTGATCAATGCAGACGACCTCACTTTTTA TAAACAGGTAAAGTGGAGAGAACGAAGGAGTGAAAAAGTTTGATTGTGTT TGACATGATTTTTTGTTTGGAAGCTCCTCTTCAGGCTTCTTCTGAGTCCT ATAAGTTGTGCTTGACAGCTCAAAAGAGCCCTATAGTTGTGATAGCTCAA ATTTGGGATGGTGCCAATAAAAACTAATGTTTTAGATTTTGAGATACACA CTTAAAATGCACAGTATCCAAGAAGATGTATTTTATTAATTGATTTTAAA TTGATATTCTTTTTTGGTCAAGTATCGATCCATATGAAATCTATCTTTCG TATTTTTTCTATTTTTAGCATGGTTGGACACCGATCATAATGGCGGCTAA AGGAGGTTATGGAGATGTGTTGACTTTATTGTTGGACGAAAGCACCAATG TAAATGCTGTCGATCACGTGAGTTTCCTTGGTTTTTTAGAGTGTCTGGAT AGTTTTAGTCTTCTATTAAACCGGTGGCAAGAAATTCATCGTAATTAATC TTACCCATGCCTTGACAGACATAAATTCCAAGTATACGCTTAATTTAATA ATACACGCTTTTTTTATAAGAATGGTGGAAATCCATTTCATCATGGATAT TCTTACAGCATTCTTAGGTTAGGATTCAGACTATTTCAGACTAGATTTAG TACATACGTCTCAAGCCTAAAATGGTATTTTTGTGAAAGGGGTGAGCCTT ACTTGAGGGTAATTGACAATTTATAATTGAAAATGCTCTAAAAATGGAAT TCTTAGCTTGAGTATCAAAATTCCATGATGGTGATATTCTTAGCATATTC TTAATTTTTTTGGCCATTTTCATCACGGGCATTCTTATAAAGTGTTTTCT TATAAAAAATAGTGTGTAATACGCGGCTTGTTTGTCTTGAAAAGCACGTC TGATCCTTCGTTTAATCTCAGCGGTTTAAGCTATCGTCGTTTGACTGTTT GATAGTCTGTTCTCTATGAATGATAATCTATTTAGCACTTTATGTTCATA CATTTCTTTGTATTTATTTTTCGAACCGAATCGTTTCCTCTTTACATTCT TCAGTTTTTAGCATGATCTAAATAGTCCGAGTAATGAGAAAAGAACCCAT CTTTCCAGCTGATGCAAACCTCTTTATAAAAATCGGTAATTTAAATTCTC CTTCGTTGGCATACACCAGACCCAAACATATCTCGATATTTGCCATCTTG TCTCTTCCATAGCAAGGTCTGTCGGCCTTAGGATGGGCAGCCAAAGAAGG TTACGAAGAACTAGTTGGGAAGCTGATCGGTAAAGGAGCTTTCCTGAATA TCCCTGACAATCGCGGTGATTCTCCCTTGATCATTGCTTCAAAGGAAGGA CATGCAAGTGTCGTTCGCACATTAGTCAACGCCTATGCTGAGATAGAGAT CACTGACTCCGTAAGTTAAACAATCCACCTTCAATGATTTTCTTCCTTTC ATAAATAAGAACACTTATCATACATATTGCTATGTCGTGGAGCTATTTTT CTATTCAAGTCAGCAAAGCAGTGGGCAAAAAAGTCCCATTAAGTTGATTC CTGATTATGAATTAGATCAGTATGTTTATGATAAAAATAATTTTGCGGTT TTTGATTGAGAAGCCGGGTTGAGAAGCGATCCGCCTTCCTCCTTTTTGGA CCTACCCCGGTGGAGGTCCTATAAATTAACCTTTGTCCGTTCGTTCGTCT GTTCGTTCGTTATTAGCTTTCCTCATGATTGGCTCATTAGTTTTTTCTGA TTCTTTGCACAAAGATGCATAACTATAAACCCTCAAATGTGACGGAGCCC GATTTTCAAAAAAAAAAATTTCGGGCAAATTTGGGCCAAAAAACGGCTAA AAAACGGTTTTTTTGGACTTAGTGAAAAATTAGATCGTTAATTTTTTCTG ATTTTTTTGCAGGAAAGTAGGTTAAAAGATGGCTTAAGCAGATTTTTGCG AAAACATTTTGTTGGCTCAAAAAACGCATGTTTATCTATAGAATCACTAT TAATAAGCATACATCAATGTTCTTAGCCAAATTACTCAATTTTTTATGAG ATAGATGTTTTTTTTGCTCACGAGGGTTTACTTTTAAACAATATGTGTGT TTAGACATGAAATTTTGGTTGCTGGGCGTGTTTTTATAGAAAAACTGGCC AAATTTGATATTTTTTTATAAGCACATTATCAATTACTTAGGTATTAGCT TTTCTCGAGATTGGCTCTTTTATTCTTTATGATTTTTTTGCACAAAGATG CATAACTATAAACCCTCGAATGTGACGGAGCTTGATTTTTGGAAAAAAAC TTTTTGGGGTAAATTTCAGCTAAACAACGGCTAAAAACGGGTTTTTTGGA CTTTGTGAAATATTGGATCATTGTTTTTTCTGACTTTTTGCATGAAAGTA GGCAAAAGATGGCTCAAGCAGATTTTTGTAAAAAAAAATAATTTTCCAGC TCAAAAAACGCATGTTTATCTATAAGAATCACTATTAATAAGCATACATC AATGTTCTTAAAATTACTGAATTTTTTGATGAGATATGTTTTTTTGCTCT CGAAGTCTTGAATATGAAAGAATATTTCAAGAGCATGAAATTTTGGTTTC CANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTTTCCAAACGTTTTTTTATAAGAAACAAACG ACTAATTTTAATAGATCGTCACTATTTGTGTTCTGAATGATTGTTTAATG GTCACGCTCATGTAGATATCATTTATATATGTGTTAAATGCATAACCAGG TAGGTCCATAAAAGTATCACTTGTTTTCATTACCCAGGCTCTTGCTCAAA TTATAGGATGGAAAAACAGCTTTGTTCCATGGCGTTGAGAAAGGTCACGT GGCAGTAGTTCGGGAGCTCTTATTGGCTGGTGCAAACACAGAAGTAACGA ACAAGGAAGGAGAAACGCCCTTGTTGAGGGGCGCCAAACGTAAACACACG CAATGCGTCAAACTGCTTCTTGAGAAAGGTGCAAACCCTGCCATCACAGA TAAGGTAACATTTTAATATCCAATCTGTTCATCTTGTATGCCAACTTTTA TTTTCCTTCTAATCAATTCCAAATACAAAACACAACTGAACACAAAGAAC TTTTGAAGTTTTGTCACAATAACGTCAATCGAATCAGCCTGACAATGACA ACATTGTGTTTCCTTCCATAAGCAAATTTGCTCAAGCCTTTTAAAAATTC TTCTTTTTTATCACAACAGAAAGGAGATACGCCTCTACACATTGCCATTC GCAATCGATTCGCTGGTCTTTGCGAAGCCTTACTAAACGACCAGAAGAAT TCCAAGATTCTACACCAGCCAAACAAAGCCGGCGAAACACCGTATTCGAT CGACCTTCAAAACAAACCATCCATTTTACCTGGCTTCTTTCAAGGACGTA GGTTTTGTTATCTCCCCTGTTTCTGTTTTTGTTGGCAGACTGATTGGCTA ACCCGCAATCAAAATGAACAGTTCTCATTAATAGTCAATGAACTCGACCG CCTCATTTCCATGAAATCTAAACTTTTTTTTTCTACGGGGTCAAACAGGA AATTTCGTTGTTTTGTTTACCTGCTTGGAGGTATTTTGAAAGAGTTAAAG GGGTAGATTTTTCATATGATGTATCGTGAATTATTTTCAGCCCAAATTAG ATTTTTCAAACGGTACAATGTGAGTGCTGTTTATTTGCATAAACAATGTG AAGTTTCTCTGCTTGTCCTGCAGTTAATTCATGCAGAGGTTATGCAATAT TACTCTTTAAAGTAAAAAAATCTAATGTTTATCAATCTGGTGTTTTTGTT GCAAATGTGGGAAAAAATCAATCATTACGCTTAATGACCAGAACATGATG ATATAGTACACATTCTTCTCTTTGAGTGGTCATCGAAAGATATTTTTAAT CTATTGGTTCACTAGTCATCAAAATTTCAACAATATCTTCATTCATAAGA GATGAATGGTCTGGATATCCTTCCGATATTTAATATTCAGTTTCCTTCAT GTTATGAATAAGCCCTCCTGAAGAAACTTCTGAATGGCACGAATAGTTAC ATTTCATTAAGTGGAAAGACTGTTGTGGACAAATTCTTGAAACAAAACTT ATTCTGAAAAAAAGTCGAAGAAACTTCAAGTGAAAAATATGGGAATAATA AAGTTGTTGATAATGACTTGTTTTATGAAGCTTTTGTTGTTTTGATTTCA TTATTATGTTCAAATTGCAAAATTTTCCGGACACACCCCGAGAAGCATCT TTCCTGAGTAGTTTGAATGGTTTAAGAAGGGTTGTAGGTAAGAGGAAAGA GTGCAAACTGAAATACTTTCATTTTAGTATTTTCACTAATCCAAACTGTT AAATGTAGCGATTGTGAGTCGATCTGAACTGTATTTATTTTTTCTTTCCT CCCATAGAACAAGTGAACCATGACTTTGACAAGATGGACTACTGCACACA ACAAGAGCTCTTACTCGCTACCATCTCCGAGTATTTGATGGAACCCTCTT TCTCTACTCCTCTCACCCTCGGAATGTACTCGAGATGGGGTACTGGCAAA TCTACACAACTAAAACGACTAGTCGGTTAGTATTCTTCATATTGGACTTG TCTTGTTTAAAATTGAACTTTGTGTGGATTATTATCTCACTGCTCAACAA AGTTGATGTTATCATGGGAACTGTATATTATTTGAGAGGAACTGGTCTTT CTTATGGTTTGATAATATCTGATGATTCCCCCTCATTTGAACATTGTAAT CTTAAACAGTTTGACATAATTCTACCGCTTCTTCTGTTTTTTTCCCTCAC TACGGTCGAAATATTACTTTAAAATTGTATAAAGAACGACCATACAAACA TATAAAATCATTTATGTTGTTGCATTCTTATAAGAATGAACTTTCTGTAC CTCTTCTATGTTTTTCCTTTTTTACTTTTTCAGAATTATTAGAAGAGGCG AAATCATCGGTGCCGATTATTCCATTCCGCGTGACAGCACCTGTCGTTTT CATGTGTATCCTGGCTGCTGTCATTCTCTCTGTCGTCTTCTGGATCGCCA CTGATTCCTGGGAAGTCGGTGTCGCGTCAGCCATCGTCCTTGTTAACGTT TTCCTCATCTTTTTCGTGGTCGCACGTGTGACCTTGATCAGCCATAGTAG GGGTTTACGATCTGCTGGTGAGGCCATGACCAACTTCATTTATCGTTGCG TTTGGTTTTTGAAATTGATTTATTGCATCCCTCCCTCAATACAAGAAGTG AAACCTGCTCTACCCGTTCATTTAATGACTGTTGATTTAACGAGAAGTGT TTTGGTGGGCGATAACCCGATGACGTCACTTGTCAATTTCATACGAGAAC TGAATGATTCTATTGAACAAAATATAGGAATAGTAATCCCGAGGCTGTAC CGTATTTTCCAATCCGGACCATACCGGACACCGTCAGGTGGCAAGTCTAT TTTTCGGACAAAATGGAAGAAAAGTTGTTGTTGTGTACCCTCCTTCTTGA TCTCAATAGTGGTCTTTGCTTGTCTATTAGTTGGATTAATATTATACGGT GCTTGGAAGTTAAATGGACCGAGTGCAGCGATCGCCATCCAAATAGCTTG TTTATGCGTTCTTGGAGGCTTTTTGTTAGCCAATCTACTACGTTTCTTTA TCATTATATACTGTTTAGTACTTCCCATGAAAAAACGCGTCAATTTTGTT TCCACACAAGCAGGAATACAAGAAGAAACTTTTCTATCCGTTGTCAAACA AGAATTAGATTTGTGCGTAGATATGTTAGAATGTCTTGATGGCTTTGCAC AACGCCAAACACGTATCATTGTTCATATTGATTTACTGGAATCTCTGGAG CAACAAAAAGTACTGGGGCTCATCGACTCTCTCAAATTTATGATAAGTGC TCCTGGCCATCCGTTTATTTTCGTACTTTCAGTTGACCCAAGACTTCTAA TTAAAGCTATGGACCAATCATTAACTATTGTACATGGACCTGTGAACGCA TACGATTATTTAAGAAACTTAGTAGACTTACCTTTTTATATATCAGAACC GTCAAAAACGAAAGTGGATGGTTTAGTACCTTTAGAACTACGAAATATTT TGGAAGATCAACAAATCTCAGATAATGAAGAAAGTGAACTTGAATGGGAT GATAATGCAGACATTAACGGTGACGTCATCTCTCGCGTATCTTTACCACG TGATCAACAGAAACATGACGTCATCGCAAATGGAGGAAACGGTCACGTGC CTAATGGGAACGGTACGGTACCGAAATTACGATCAGTGAAGTTCCCTCCG GAACAAAGTGGAAATGATGGTTGCACCAACAATAATGAGTCCATCTCTGA GGATATTTCAAACATGATTCGAACAAATATGAATGGAAATTTAAACGATA TCAAACGTGTCATGAACGTTATCTCGCTTAAAGCACGTATCTTGAAAAGC TCCGATATACATTTCCAATTACCACGACTCGGTATTTGGGTCAATATGTG CGACGTGTGGCCTCATAAAGCCAGTTGGTTCATTTTACTATGTATGGATG TTTCGTTGGCTCTTCCCGATAAAATGAGTATCCGCAGGCTTTACAACTTG CTCGGATACGCGATGCCCATGGTAGGCGATCACGAAGAGAATACTGGCAA TGCTGCCAATTATTTTGATACGTTTTTAGCATCACATAAACCGGTGATTA ATGTGGCGGACGTTCGAATGTTTACACCCTTCCTGTTTTACTTGGACCCA ACCATCCGTAGTTTGATGATTGATTACATGGTAGCATTGAAGAGTGGAAC AATCTCTAAGAACCCCTCCATCGCACACCAGTTCTCCAGTAGATCAAACT TTCCCATTTCACCAAGCGACTCCAGCAAGGTAACCATTACATTCATCCCT CTTCTCGTCTCATTCTACCTTCATACTGTTGCAGACTCTGCACTAATGAT TCGCACTTCTCTTTGACATGTTATTTGGCATGATTATCTTTTTGCCAAAG TGGCTTAACTGAGTACCCACTTTTTCATTCAGTGGTCCAAAACTTTTAAA GAACTAAATAGATACAATGTAATAGTAATCGATCAGTGCCTAGGAGGTAT TTCCCATTTTTCCTTTTACAATGCCATTCTAATATCTTGGTCTGTTACAT TTCAGTTTATTTGGCGAGGTGGCATCGACGAACAATATTTATCCAAAATG ACACCAGAAGACGTCGTTTCACAGGTAACTTTTATTTGTTTTGTCCCCAT TGCACGCAACCTCAAATTCTCTGCCAAGGACTTTGTGTTCCCAGGGCTAA CATGTCTCTGTATTCCCAGGGCTTGGTTGTAAATTTTGGTTCCATATCTT GACTACGACTTTGATGTGATCAGTATTCTCAACGCTGCCAATTCAAATTC GTTTTACATTTTCTCTGATTTCTAGCTGGCAGAGATCGAAGGTATTGAGA CGAGTTTGGTGCCATCTTATCGCGATCGTATCTTGGAGAACAACATCAAT GGTCGTGTGTTGATCTCTTGTGATATGAATGAACTTCGTGAAGCGATGCA AATGAAATTCGGTGATTGGCAGCTTTTCAAAGCGTGGATCAACTCGTCCA GATTCAAAGACAACAGTTCAAGGTAGGCGAAGTTGTCATGTAGTTATACC TTTTTGTTAGTCCAATTAAATTTGGCGATTGCTCAGTATATAGTAGTAAC TATAGTAACGTTTGAAGGATTCTTAAACAGATCACTCTGTTGTCAGGTGA TAAAATGGTTTTTGAATGAAAATGCAAAACTTATCTCAAATATATGCATG CCTTACTTCAATCAAAAATCGAGGCAAAATAATGAAAATTATTACGGCTG TATATAATCGACTTTGATTTTCTTTATCTTTGTACTTTAAAAAATTCTGA AAAATCCAAACAAATGTTTGAAAACATGACAGGTTCAAAGAAATTTCTAT AAATATCTTTTTACTTAACAGGAGTGAGAAATCATATTACCGCCCTTCAT CACGAAGTGCAAATGGTGACGGGAGCCAATCAGAATCGATCCCCGGTTCA CCGAAACAATCATCTGTCAGTAGTTACAACCCAACGCAAAGTAAGTTCTC CTCCCTTGAACCTTTTACCAGGTTATATATTAGCATATGTCAACTACTTT CAAATATCATCCTACAATTACTAAAAGTGATTCTCTTCTACCTTAGAAGG GACGAGTCGATTGCCTGCGTTGAACGAGACACCGGATTCCTCGTCTAACC AACCTTACACCAGTCACTCTCCGCGCAATTCACCTCTCCAAAGTCGCACG CGAAGCGGAAAACAACGCAAAGGAGGTAAAAGTAAAACTCGTTCACTGGA AAGTGAGGGAAGCTCTCCATTGAAAGGACCTTCACCTAACCCAACATTGC AACGATCGGCAGATTCGAGTTTTGCCAGTACGGATGCTGATAATCGCTCC CAACAATTGAGTTCATTCTCTGATAACGAACCGTCTTCAAGTCGCTACGT GCAACGAGTGGGATCAAACAATCGACAGGTGACGCGACCTAAACAATACC ATCAACAACCACAGCGTAACCGTGTACCACCAATAGCAGGTCTCGATCAA GGAGTTGATTCTCTGGAGCGAGGAACAAAACCAAGCGATACTTGGATAGG AAAGAACGAAAGATCTTTCAATAAAACAAACGATACAATCAGTTCCACTT CATCACAGGAGTTCATCCAAACGTCGTTCGAAAAACAAGAAGAATCGTTA CATCAAATCAAACCATGGCAACTATCAGATGGAGACGAGTCATGTTCAGA ACGAGGCAATGAAATTGTGGAAACAAGTTTTACCTCTACACATCAAAAGC GTCATTTGACGTCAGGTCTTCGTAAAGAGACACGCCCTCCATCGCTTTCA GAGGTACCTTTACCACCAGCCTCCATGTTGAATGAATCGCATGAAGACTA CATCGATCTCGAGAACCACGACAGTGAACATGACGCCCTTCTCTCCTCTT CACCGCCCACCTCCCTCGACCGCAAAAACGCTTTCCAAAATTCCGCCCGA TTACGAGGAATGTCGAACTATACCACATCTACGGACTCTGATAGGCAATA TTTAGTTGAAAATAATAATGTAGTCGACAGCTAATAGTTTTTAGTTTATT TTTAGTTACCAATTCTTTTATTACCTTGCTCGATTGCACATAGTTGAACT TGTGTACATATTTTTCCAAAAGTTTCCCCCCTTTTCCTTCATTTTTTATG TTTAAATATTTATAAATTTCTTTTTTTAACGATGATGGAATCTGTGCCCT TTGGTTTTTTTAGTTTTCAAGTTATAAATGTACGGAGGAGCTATATTTTT TATATAAATATATTATTACACTATTTGAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000633XLOC_000633Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001158-exon-sc0000007-1575043694:611564..611654TCONS_00001158-exon-sc0000007-1575043694:611564..611654Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:611274..611384TCONS_00001158-exon-sc0000007-1575043694:611274..611384Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:610194..610292TCONS_00001158-exon-sc0000007-1575043694:610194..610292Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:609826..609924TCONS_00001158-exon-sc0000007-1575043694:609826..609924Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:609045..609143TCONS_00001158-exon-sc0000007-1575043694:609045..609143Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:608716..608814TCONS_00001158-exon-sc0000007-1575043694:608716..608814Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:608373..608471TCONS_00001158-exon-sc0000007-1575043694:608373..608471Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:606738..606836TCONS_00001158-exon-sc0000007-1575043694:606738..606836Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:605745..605942TCONS_00001158-exon-sc0000007-1575043694:605745..605942Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:604101..604298TCONS_00001158-exon-sc0000007-1575043694:604101..604298Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:603708..603885TCONS_00001158-exon-sc0000007-1575043694:603708..603885Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:602530..602697TCONS_00001158-exon-sc0000007-1575043694:602530..602697Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:600226..602171TCONS_00001158-exon-sc0000007-1575043694:600226..602171Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:599881..599949TCONS_00001158-exon-sc0000007-1575043694:599881..599949Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:599483..599679TCONS_00001158-exon-sc0000007-1575043694:599483..599679Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:599015..599133TCONS_00001158-exon-sc0000007-1575043694:599015..599133Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1575043694:597726..598908TCONS_00001158-exon-sc0000007-1575043694:597726..598908Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:611564..611654TCONS_00001158-exon-sc0000007-1510915933:611564..611654Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:611274..611384TCONS_00001158-exon-sc0000007-1510915933:611274..611384Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:610194..610292TCONS_00001158-exon-sc0000007-1510915933:610194..610292Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:609826..609924TCONS_00001158-exon-sc0000007-1510915933:609826..609924Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:609045..609143TCONS_00001158-exon-sc0000007-1510915933:609045..609143Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:608716..608814TCONS_00001158-exon-sc0000007-1510915933:608716..608814Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:608373..608471TCONS_00001158-exon-sc0000007-1510915933:608373..608471Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:606738..606836TCONS_00001158-exon-sc0000007-1510915933:606738..606836Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:605745..605942TCONS_00001158-exon-sc0000007-1510915933:605745..605942Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:604101..604298TCONS_00001158-exon-sc0000007-1510915933:604101..604298Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:603708..603885TCONS_00001158-exon-sc0000007-1510915933:603708..603885Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:602530..602697TCONS_00001158-exon-sc0000007-1510915933:602530..602697Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:600226..602171TCONS_00001158-exon-sc0000007-1510915933:600226..602171Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:599881..599949TCONS_00001158-exon-sc0000007-1510915933:599881..599949Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:599483..599679TCONS_00001158-exon-sc0000007-1510915933:599483..599679Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:599015..599133TCONS_00001158-exon-sc0000007-1510915933:599015..599133Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1510915933:597726..598908TCONS_00001158-exon-sc0000007-1510915933:597726..598908Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:611564..611654TCONS_00001158-exon-sc0000007-1491911889:611564..611654Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:611274..611384TCONS_00001158-exon-sc0000007-1491911889:611274..611384Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:610194..610292TCONS_00001158-exon-sc0000007-1491911889:610194..610292Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:609826..609924TCONS_00001158-exon-sc0000007-1491911889:609826..609924Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:609045..609143TCONS_00001158-exon-sc0000007-1491911889:609045..609143Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:608716..608814TCONS_00001158-exon-sc0000007-1491911889:608716..608814Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:608373..608471TCONS_00001158-exon-sc0000007-1491911889:608373..608471Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:606738..606836TCONS_00001158-exon-sc0000007-1491911889:606738..606836Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:605745..605942TCONS_00001158-exon-sc0000007-1491911889:605745..605942Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:604101..604298TCONS_00001158-exon-sc0000007-1491911889:604101..604298Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:603708..603885TCONS_00001158-exon-sc0000007-1491911889:603708..603885Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:602530..602697TCONS_00001158-exon-sc0000007-1491911889:602530..602697Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:600226..602171TCONS_00001158-exon-sc0000007-1491911889:600226..602171Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:599881..599949TCONS_00001158-exon-sc0000007-1491911889:599881..599949Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:599483..599679TCONS_00001158-exon-sc0000007-1491911889:599483..599679Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:599015..599133TCONS_00001158-exon-sc0000007-1491911889:599015..599133Clytia hemisphaericaexon
TCONS_00001158-exon-sc0000007-1491911889:597726..598908TCONS_00001158-exon-sc0000007-1491911889:597726..598908Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:597726..611654 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.54222e-05 3.00608e-08 0 0.510954 1.5087 0.624871 1.22623 3.049 0.000380674 0.000114853 7.14757e-07 2.57235e-05 0.530863 0.00256932 0.000130809 0.678704 0.404318 3.18837 0.00482777 2.97254e-06 1.33073 2.16011 0.0509691 1.35343 3.69212 0.150213 9.49857 2.40476 9.84518e-06 0.000421008
Blast
BLAST of TCONS_00001158 vs. Swiss-Prot (Human)
Match: KDIS (Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3)

HSP 1 Score: 561.607 bits (1446), Expect = 4.968e-169
Identity = 320/858 (37.30%), Postives = 508/858 (59.21%), Query Frame = 2
Query:  131 IENNNLDGVIDCIEEGVNLEEADSHGQTPLIFAAEKGHLEIVAELLNRNVDANAKDQDGWTPLIAASKEGHVDVVGVLLENAAKYNIPDMGGWTPLVWAAYKGHTDVVHELLNYGANPEARGQHNMTALIWASGRGHTGVVSKLINRGAKAEVADKYGTTALIWACRKGHYEVIKMLLNAGANCNAVGTHGWTPIIMAAKGGYGDVLTLLLDESTNVNAVDHQGLSALGWAAKEGYEELVGKLIGKGAFLNIPDNRGDSPLIIASKEGHASVVRTLVNAYAEIEITDSDGKTALFHGVEKGHVAVVRELLLAGANTEVTNKEGETPLLRGAKRKHTQCVKLLLEKGANPAITDKKGDTPLHIAIRNRFAGLCEALLNDQKNSKILHQPNKAGETPYSIDLQNKPSILPGFFQGQQVN---HDFDKMDYCTQQELLLATISEYLMEPSFSTPLTLGMYSRWGTGKSTQLKRLVELLEEAKSSVPIIPFRVTAPVVFMCILAAVILSVVFWIATDSWEVGVASAXXXXXXXXXXXXXARVTLISHSRGLRSAGEA------MTNFIYRCVWF----LKLIYCIPPSI-QEVKPALPVHLMTVDLTRSVLVGDNPMTSLVNFIRELNDSIEQNIGIVIPRLYRIFQSGPYRTPSGGKSIFRTKWKKSCCCVPSFLISIVVFACLLVGLILYGAWKLNGPSAAI-AIQIACLCVLGGFLLANLLRFFIIIYCLVLPMKKRV-NFVSTQAGIQEETFLSVVKQELDLCVDMLECLDGFAQRQTRIIVHIDLLESLEQQKVLGLIDSLKFMISAPGHPFIFVLSVDPRLLIKAMDQSLTIV--HGPVNAYDYLRNLVDLPFYIS 2650
            +E  N+  +   +E+  +++E +  GQTPL+ AAE+G+LEIV EL+    + N +D D WT LI+ASKEGHV +V  LL+        DMGGWT L+WA YKG TDVV  LL++GANP   G +++  +IWA+GRGH  +V  L+  GAK   +DKYGTT L+WA RKGH E +K LL  GA+ +  G +  T +I+A KGGY   +  +L  + NVN  D  G +AL  A+KEG+ E+V  L+  G ++NIPD  GD+ LI A + GH  +VR L+  YA+I+I   D KTAL+  VEKG+  +VR++L    +TE+  K+GETPL++  K ++ + V+LLL+KGA  +  DKKGDTPLHIAIR R   L E LL + K+ ++L++PNKAGETPY+ID  ++ SIL   F  + ++    D D + Y    +L  + +++ L EP+   P+ +G+Y++WG+GKS  LK+L + ++          F+ +  +VF+ +L    L ++F        +G+A ++  + +         +  I    G R  GE+      ++  + R + +    LKL++  PP + ++   ALPV  +  D  R   VG    TSL   I  L+D+ E+  G +  RL+R+F++      + GK     KWKK+ CC+PSF+I + +  C++ G+ L   ++++     + A+ I+   V+G   + N   ++ ++  L+   +KR+ N  S    ++ E F+ V+K E++L   M + +D F Q QTR++V ID L++ EQ KVL ++D+++ + S    PFI + + DP ++IKA++Q+L  V     +N +DY+RN+V LP +++
Sbjct:   13 VEEENIPALKALLEKCKDVDERNECGQTPLMIAAEQGNLEIVKELIKNGANCNLEDLDNWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDKGAKVSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILTQIFGARHLSPTETDGDMLGY----DLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHP-NLGIAVSLSFLALLY-------IFFIVIYFGGRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGE--TSLAEMIATLSDACEREFGFLATRLFRVFKT----EDTQGKK----KWKKT-CCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISIASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKVLKCEVELMARMAKTIDSFTQNQTRLVVIIDGLDACEQDKVLQMLDTVRVLFSK--GPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHLPVFLN 845          

HSP 2 Score: 93.9745 bits (232), Expect = 5.912e-19
Identity = 44/138 (31.88%), Postives = 82/138 (59.42%), Query Frame = 2
Query: 3005 IKRVMNVISLKARILKSSDIHFQLPRLGIWVNMCDVWPHKASWFILLCMDVSLALPDKMSIRRLYNLLGYAMPMVGDHE---ENTGNAANYFDTFLASHKPVINVADVRMFTPFLFYLDPTIRSLMIDYMVALKSGTI 3409
            ++R++N++S+  R+L+++ I F   RL  W+N+ + WP++ SW IL  ++ +  +PD+M+++ +Y  +   +P   D E   E  G+  N F+ FL+S  PV+   DV++F P    LDP +R ++ D   A +  +I
Sbjct:  939 MRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLILY-LEETEGIPDQMTLKTIYERISKNIPTTKDVEPLLEIDGDIRN-FEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISI 1074          
The following BLAST results are available for this feature:
BLAST of TCONS_00001158 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KDIS4.968e-16937.30Kinase D-interacting substrate of 220 kDa OS=Homo ... [more]
back to top