Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001157 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001157
Unique NameTCONS_00001157
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3753

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001157 ID=TCONS_00001157|Name=TCONS_00001157|organism=Clytia hemisphaerica|type=transcript|length=3753bp
gcaaaattttccgGACACACCCCGAGAAGCATCTTTCCTGAGTAGTTTGA
ATGGTTTAAGAAGGGTTGTAGAACAAGTGAACCATGACTTTGACAAGATG
GACTACTGCACACAACAAGAGCTCTTACTCGCTACCATCTCCGAGTATTT
GATGGAACCCTCTTTCTCTACTCCTCTCACCCTCGGAATGTACTCGAGAT
GGGGTACTGGCAAATCTACACAACTAAAACGACTAGTCGaaTTATTAGAA
GAGGCGAAATCATCGGTGCCGATTATTCCATTCCGCGTGACAGCACCTGT
CGTTTTCATGTGTATCCTGGCTGCTGTCATTCTCTCTGTCGTCTTCTGGA
TCGCCACTGATTCCTGGGAAGTCGGTGTCGCGTCAGCCATCGTCCTTGTT
AACGTTTTCCTCATCTTTTTCGTGGTCGCACGTGTGACCTTGATCAGCCA
TAGTAGGGGTTTACGATCTGCTGGTGAGGCCATGACCAACTTCATTTATC
GTTGCGTTTGgtttttgaaattgatttatTGCATCCCTCCCTCAATACAA
GAAGTGAAACCTGCTCTACCCGTTCATTTAATGACTGTTGATTTAACGAG
AAGTGTTTTGGTGGGCGATAACCCGATGACGTCACTTGTCAATTTCATAC
GAGAACTGAATGATTCTATTGAACAAAATATAGGAATAGTAATCCCGAGG
CTGTACCGTATTTTCCAATCCGGACCATACCGGACACCGTCAGGTGGCAA
GTCTATTTTTCGGACAAAATGGAAGAAAAGTTGTTGTTGTGTACCCTCCT
TCTTGATCTCAATAGTGGTCTTTGCTTGTCTATTAGTTGGATTAATATTA
TACGGTGCTTGGAAGTTAAATGGACCGAGTGCAGCGATCGCCATCCAAAT
AGCTTGTTTATGCGTTCTTGGAGGCTTTTTGTTAGCCAATCTACTACGTT
TCTTTATCATTATATACTGTTTAGTACTTCCCATGAAAAAACGCGTCAAT
TTTGTTTCCACACAAGCAGGAATACAAGAAGAAACTTTTCTATCCGTTGT
CAAACAAGAATTAGATTTGTGCGTAGATATGTTAGAATGTCTTGATGGCT
TTGCACAACGCCAAACACGTATCATTGTTCATATTGATTTACTGGAATCT
CTGGAGCAACAAAAAGTACTGGGGCTCATCGACTCTCTCAAATTTATGAT
AAGTGCTCCTGGCCATCCGTTTATTTTCGTACTTTCAGTTGACCCAAGAC
TTCTAATTAAAGCTATGGACCAATCATTAACTATTGTACATGGACCTGTG
AACGCATACGATTATTTAAGAAACTTAGTAGACTTACCTTTTTATATATC
AGAACcgtcaaaaacgaaagtggatgGTTTAGTACCTTTAGAACTACGAA
ATATTTTGGAAGATCAACAAATCTCAGATAATGAAGAAAGTGAACTTGAA
TGGGATGATAATGCAGACATTAACGGTGACGTCATCTCTCGCGTATCTTT
ACCACGTGATCAACAGAAACATGACGTCATCGCAAATGGAGGAAACGGTC
ACGTGCCTAATGGGAACGGTACGGTACCGAAATTACGATCAGTGAAGTTC
CCTCCGGAACAAAGTGGAAATGATGGTTGCACCAACAATAATGAGTCCAT
CTCTGAGGATATTTCAAACATGATTCGAACAAATATGAATGGAAATTTAA
ACGATATCAAACGTGTCATGAACGTTATCTCGCTTAAAGCACGTATCTTG
AAAAGCTCCGATATACATTTCCAATTACCACGACTCGGTATTTGGGTCAA
TATGTGCGACGTGTGGCCTCATAAAGCCAGTTGGTTCATTTTACTATGTA
TGGATGTTTCGTTGGCTCTTCCCGATAAAATGAGTATCCGCAGGCTTTAC
AACTTGCTCGGATACGCGATGCCCATGGTAGGCGATCACGAAGAGAATAC
TGGCAATGCTGCCAATTATTTTGATACGTTTTTAGCATCACATAAACCGG
TGATTAATGTGGCGgacgttcgaatgtttacacCCTTCCTGTTTTACTTG
GACCCAACCATCCGTAGTTTGATGATTGATTACATGGTAGCATTGAAGAG
TGGAACAATCTCTAAGAACCCCTCCATCGCACACCAGTTCTCCAGTAGAT
CAAACTTTCCCATTTCACCAAGCGACTCCAGCAAGTTTATTTGGCGAGGT
GGCATCGACGAACAATATTTATCCAAAATGACACCAGAAGACGTCGTTTC
ACAGCTGGCAGAGATCGAAGGTATTGAGACGAGTTTGGTGCCATCTTATC
GCGATCGTATCTTGGAGAACAACATCAATGGTCGTGTGTTGATCTCTTGT
GATATGAATGAACTTCGTGAAGCGATGCAAATGAAATTCGGTGATTGGCA
GCTTTTCAAAGCGTGGATCAACTCGTCCAGATTCAAAGACAACAGTTCAA
GGAGTGAGAAATCATATTACCGCCCTTCATCACGAAGTGCAAATGGTGAC
GGGAGCCAATCAGAATCGATCCCCGGTTCACCGAAACAATCATCTGTCAG
TAGTTACAACCCAACGCAAAAAGGGACGAGTCGATTGCCTGCGTTGAACG
AGACACCGGATTCCTCGTCTAACCAACCTTACACCAGTCACTCTCCGCGC
AATTCACCTCTCCAAAGTCGCACGCGAAGCGGAAAACAACGCAAAGGAGG
TAAAAGTAAAACTCGTTCACTGGAAAGTGAGGGAAGCTCTCCATTGAAAG
GACCTTCACCTAACCCAACATTGCAACGATCGGCAGATTCGAGTTTTGCC
AGTACGGATGCTGATAATCGCTCCCAACAATTGAGTTCATTCTCTGATAA
CGAACCGTCTTCAAGTCGCTACGTGCAACGAGTGGGATCAAACAATCGAC
AGGTGACGCGACCTAAACAATACCATCAACAACCACAGCGTAACCGTGTA
CCACCAATAGCAGGTCTCGATCAAGGAGTTGATTCTCTGGAGCGAGGAAC
AAAACCAAGCGATACTTGGATAGGAAAGAACGAAAGATctttcaataaaa
caaacgatacAATCAGTTCCACTTCATCACAGGAGTTCATCCAAACGTCG
TTCGAAAAACAAGAAGAATCGTTACATCAAATCAAACCATGGCAACTATC
AGATGGAGACGAGTCATGTTCAGAACGAGGCAATGAAATTGTGGAAACAA
GTTTTACCTCTACACATCAAAAGCGTCATTTGACGTCAGGTCTTCGTAAA
GAGACACGCCCTCCATCGCTTTCAGAGGTACCTTTACCACCAGCCTCCAT
GTTGAATGAATCGCATGAAGACTACATCGATCTCGAGAACCACGACAGTG
AACATGACGCCCTTCTCTCCTCTTCACCGCCCACCTCCCTCGACCGCAAA
AACGCTTTCCAAAATTCCGCCCGATTACGAGGAATGTCGAACTATACCAC
ATCTACGGACTCTGATAGGCAATATTTAGTTGAAAATAATAATGTAGTCG
ACAGCTAATagtttttagtttatttttagtTACCAATTCTTTTATTACCT
TGCTCGATTGCACATAGTTGAACTTGTGtacatatttttccaaaagtttc
cccccttttccttcattttttatgtttaaatatttataaatttctttttt
taacgaTGATGGAATCTGTGCCCTTtggtttttttagttttcaagttaTA
AATGTACGGAGGAgctatattttttatataaatatatTATTACActattt
gaa
Run BLAST on NCBI

transcript from alignment at sc0000007:597726..602888-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001157 ID=TCONS_00001157|Name=TCONS_00001157|organism=Clytia hemisphaerica|type=transcript|length=5163bp|location=Sequence derived from alignment at sc0000007:597726..602888- (Clytia hemisphaerica)
GCAAAATTTTCCGGACACACCCCGAGAAGCATCTTTCCTGAGTAGTTTGA ATGGTTTAAGAAGGGTTGTAGGTAAGAGGAAAGAGTGCAAACTGAAATAC TTTCATTTTAGTATTTTCACTAATCCAAACTGTTAAATGTAGCGATTGTG AGTCGATCTGAACTGTATTTATTTTTTCTTTCCTCCCATAGAACAAGTGA ACCATGACTTTGACAAGATGGACTACTGCACACAACAAGAGCTCTTACTC GCTACCATCTCCGAGTATTTGATGGAACCCTCTTTCTCTACTCCTCTCAC CCTCGGAATGTACTCGAGATGGGGTACTGGCAAATCTACACAACTAAAAC GACTAGTCGGTTAGTATTCTTCATATTGGACTTGTCTTGTTTAAAATTGA ACTTTGTGTGGATTATTATCTCACTGCTCAACAAAGTTGATGTTATCATG GGAACTGTATATTATTTGAGAGGAACTGGTCTTTCTTATGGTTTGATAAT ATCTGATGATTCCCCCTCATTTGAACATTGTAATCTTAAACAGTTTGACA TAATTCTACCGCTTCTTCTGTTTTTTTCCCTCACTACGGTCGAAATATTA CTTTAAAATTGTATAAAGAACGACCATACAAACATATAAAATCATTTATG TTGTTGCATTCTTATAAGAATGAACTTTCTGTACCTCTTCTATGTTTTTC CTTTTTTACTTTTTCAGAATTATTAGAAGAGGCGAAATCATCGGTGCCGA TTATTCCATTCCGCGTGACAGCACCTGTCGTTTTCATGTGTATCCTGGCT GCTGTCATTCTCTCTGTCGTCTTCTGGATCGCCACTGATTCCTGGGAAGT CGGTGTCGCGTCAGCCATCGTCCTTGTTAACGTTTTCCTCATCTTTTTCG TGGTCGCACGTGTGACCTTGATCAGCCATAGTAGGGGTTTACGATCTGCT GGTGAGGCCATGACCAACTTCATTTATCGTTGCGTTTGGTTTTTGAAATT GATTTATTGCATCCCTCCCTCAATACAAGAAGTGAAACCTGCTCTACCCG TTCATTTAATGACTGTTGATTTAACGAGAAGTGTTTTGGTGGGCGATAAC CCGATGACGTCACTTGTCAATTTCATACGAGAACTGAATGATTCTATTGA ACAAAATATAGGAATAGTAATCCCGAGGCTGTACCGTATTTTCCAATCCG GACCATACCGGACACCGTCAGGTGGCAAGTCTATTTTTCGGACAAAATGG AAGAAAAGTTGTTGTTGTGTACCCTCCTTCTTGATCTCAATAGTGGTCTT TGCTTGTCTATTAGTTGGATTAATATTATACGGTGCTTGGAAGTTAAATG GACCGAGTGCAGCGATCGCCATCCAAATAGCTTGTTTATGCGTTCTTGGA GGCTTTTTGTTAGCCAATCTACTACGTTTCTTTATCATTATATACTGTTT AGTACTTCCCATGAAAAAACGCGTCAATTTTGTTTCCACACAAGCAGGAA TACAAGAAGAAACTTTTCTATCCGTTGTCAAACAAGAATTAGATTTGTGC GTAGATATGTTAGAATGTCTTGATGGCTTTGCACAACGCCAAACACGTAT CATTGTTCATATTGATTTACTGGAATCTCTGGAGCAACAAAAAGTACTGG GGCTCATCGACTCTCTCAAATTTATGATAAGTGCTCCTGGCCATCCGTTT ATTTTCGTACTTTCAGTTGACCCAAGACTTCTAATTAAAGCTATGGACCA ATCATTAACTATTGTACATGGACCTGTGAACGCATACGATTATTTAAGAA ACTTAGTAGACTTACCTTTTTATATATCAGAACCGTCAAAAACGAAAGTG GATGGTTTAGTACCTTTAGAACTACGAAATATTTTGGAAGATCAACAAAT CTCAGATAATGAAGAAAGTGAACTTGAATGGGATGATAATGCAGACATTA ACGGTGACGTCATCTCTCGCGTATCTTTACCACGTGATCAACAGAAACAT GACGTCATCGCAAATGGAGGAAACGGTCACGTGCCTAATGGGAACGGTAC GGTACCGAAATTACGATCAGTGAAGTTCCCTCCGGAACAAAGTGGAAATG ATGGTTGCACCAACAATAATGAGTCCATCTCTGAGGATATTTCAAACATG ATTCGAACAAATATGAATGGAAATTTAAACGATATCAAACGTGTCATGAA CGTTATCTCGCTTAAAGCACGTATCTTGAAAAGCTCCGATATACATTTCC AATTACCACGACTCGGTATTTGGGTCAATATGTGCGACGTGTGGCCTCAT AAAGCCAGTTGGTTCATTTTACTATGTATGGATGTTTCGTTGGCTCTTCC CGATAAAATGAGTATCCGCAGGCTTTACAACTTGCTCGGATACGCGATGC CCATGGTAGGCGATCACGAAGAGAATACTGGCAATGCTGCCAATTATTTT GATACGTTTTTAGCATCACATAAACCGGTGATTAATGTGGCGGACGTTCG AATGTTTACACCCTTCCTGTTTTACTTGGACCCAACCATCCGTAGTTTGA TGATTGATTACATGGTAGCATTGAAGAGTGGAACAATCTCTAAGAACCCC TCCATCGCACACCAGTTCTCCAGTAGATCAAACTTTCCCATTTCACCAAG CGACTCCAGCAAGGTAACCATTACATTCATCCCTCTTCTCGTCTCATTCT ACCTTCATACTGTTGCAGACTCTGCACTAATGATTCGCACTTCTCTTTGA CATGTTATTTGGCATGATTATCTTTTTGCCAAAGTGGCTTAACTGAGTAC CCACTTTTTCATTCAGTGGTCCAAAACTTTTAAAGAACTAAATAGATACA ATGTAATAGTAATCGATCAGTGCCTAGGAGGTATTTCCCATTTTTCCTTT TACAATGCCATTCTAATATCTTGGTCTGTTACATTTCAGTTTATTTGGCG AGGTGGCATCGACGAACAATATTTATCCAAAATGACACCAGAAGACGTCG TTTCACAGGTAACTTTTATTTGTTTTGTCCCCATTGCACGCAACCTCAAA TTCTCTGCCAAGGACTTTGTGTTCCCAGGGCTAACATGTCTCTGTATTCC CAGGGCTTGGTTGTAAATTTTGGTTCCATATCTTGACTACGACTTTGATG TGATCAGTATTCTCAACGCTGCCAATTCAAATTCGTTTTACATTTTCTCT GATTTCTAGCTGGCAGAGATCGAAGGTATTGAGACGAGTTTGGTGCCATC TTATCGCGATCGTATCTTGGAGAACAACATCAATGGTCGTGTGTTGATCT CTTGTGATATGAATGAACTTCGTGAAGCGATGCAAATGAAATTCGGTGAT TGGCAGCTTTTCAAAGCGTGGATCAACTCGTCCAGATTCAAAGACAACAG TTCAAGGTAGGCGAAGTTGTCATGTAGTTATACCTTTTTGTTAGTCCAAT TAAATTTGGCGATTGCTCAGTATATAGTAGTAACTATAGTAACGTTTGAA GGATTCTTAAACAGATCACTCTGTTGTCAGGTGATAAAATGGTTTTTGAA TGAAAATGCAAAACTTATCTCAAATATATGCATGCCTTACTTCAATCAAA AATCGAGGCAAAATAATGAAAATTATTACGGCTGTATATAATCGACTTTG ATTTTCTTTATCTTTGTACTTTAAAAAATTCTGAAAAATCCAAACAAATG TTTGAAAACATGACAGGTTCAAAGAAATTTCTATAAATATCTTTTTACTT AACAGGAGTGAGAAATCATATTACCGCCCTTCATCACGAAGTGCAAATGG TGACGGGAGCCAATCAGAATCGATCCCCGGTTCACCGAAACAATCATCTG TCAGTAGTTACAACCCAACGCAAAGTAAGTTCTCCTCCCTTGAACCTTTT ACCAGGTTATATATTAGCATATGTCAACTACTTTCAAATATCATCCTACA ATTACTAAAAGTGATTCTCTTCTACCTTAGAAGGGACGAGTCGATTGCCT GCGTTGAACGAGACACCGGATTCCTCGTCTAACCAACCTTACACCAGTCA CTCTCCGCGCAATTCACCTCTCCAAAGTCGCACGCGAAGCGGAAAACAAC GCAAAGGAGGTAAAAGTAAAACTCGTTCACTGGAAAGTGAGGGAAGCTCT CCATTGAAAGGACCTTCACCTAACCCAACATTGCAACGATCGGCAGATTC GAGTTTTGCCAGTACGGATGCTGATAATCGCTCCCAACAATTGAGTTCAT TCTCTGATAACGAACCGTCTTCAAGTCGCTACGTGCAACGAGTGGGATCA AACAATCGACAGGTGACGCGACCTAAACAATACCATCAACAACCACAGCG TAACCGTGTACCACCAATAGCAGGTCTCGATCAAGGAGTTGATTCTCTGG AGCGAGGAACAAAACCAAGCGATACTTGGATAGGAAAGAACGAAAGATCT TTCAATAAAACAAACGATACAATCAGTTCCACTTCATCACAGGAGTTCAT CCAAACGTCGTTCGAAAAACAAGAAGAATCGTTACATCAAATCAAACCAT GGCAACTATCAGATGGAGACGAGTCATGTTCAGAACGAGGCAATGAAATT GTGGAAACAAGTTTTACCTCTACACATCAAAAGCGTCATTTGACGTCAGG TCTTCGTAAAGAGACACGCCCTCCATCGCTTTCAGAGGTACCTTTACCAC CAGCCTCCATGTTGAATGAATCGCATGAAGACTACATCGATCTCGAGAAC CACGACAGTGAACATGACGCCCTTCTCTCCTCTTCACCGCCCACCTCCCT CGACCGCAAAAACGCTTTCCAAAATTCCGCCCGATTACGAGGAATGTCGA ACTATACCACATCTACGGACTCTGATAGGCAATATTTAGTTGAAAATAAT AATGTAGTCGACAGCTAATAGTTTTTAGTTTATTTTTAGTTACCAATTCT TTTATTACCTTGCTCGATTGCACATAGTTGAACTTGTGTACATATTTTTC CAAAAGTTTCCCCCCTTTTCCTTCATTTTTTATGTTTAAATATTTATAAA TTTCTTTTTTTAACGATGATGGAATCTGTGCCCTTTGGTTTTTTTAGTTT TCAAGTTATAAATGTACGGAGGAGCTATATTTTTTATATAAATATATTAT TACACTATTTGAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000633XLOC_000633Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001157-exon-sc0000007-1575043694:602818..602888TCONS_00001157-exon-sc0000007-1575043694:602818..602888Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1575043694:602530..602697TCONS_00001157-exon-sc0000007-1575043694:602530..602697Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1575043694:600226..602171TCONS_00001157-exon-sc0000007-1575043694:600226..602171Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1575043694:599881..599949TCONS_00001157-exon-sc0000007-1575043694:599881..599949Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1575043694:599483..599679TCONS_00001157-exon-sc0000007-1575043694:599483..599679Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1575043694:599015..599133TCONS_00001157-exon-sc0000007-1575043694:599015..599133Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1575043694:597726..598908TCONS_00001157-exon-sc0000007-1575043694:597726..598908Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1510915933:602818..602888TCONS_00001157-exon-sc0000007-1510915933:602818..602888Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1510915933:602530..602697TCONS_00001157-exon-sc0000007-1510915933:602530..602697Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1510915933:600226..602171TCONS_00001157-exon-sc0000007-1510915933:600226..602171Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1510915933:599881..599949TCONS_00001157-exon-sc0000007-1510915933:599881..599949Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1510915933:599483..599679TCONS_00001157-exon-sc0000007-1510915933:599483..599679Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1510915933:599015..599133TCONS_00001157-exon-sc0000007-1510915933:599015..599133Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1510915933:597726..598908TCONS_00001157-exon-sc0000007-1510915933:597726..598908Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1491911889:602818..602888TCONS_00001157-exon-sc0000007-1491911889:602818..602888Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1491911889:602530..602697TCONS_00001157-exon-sc0000007-1491911889:602530..602697Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1491911889:600226..602171TCONS_00001157-exon-sc0000007-1491911889:600226..602171Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1491911889:599881..599949TCONS_00001157-exon-sc0000007-1491911889:599881..599949Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1491911889:599483..599679TCONS_00001157-exon-sc0000007-1491911889:599483..599679Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1491911889:599015..599133TCONS_00001157-exon-sc0000007-1491911889:599015..599133Clytia hemisphaericaexon
TCONS_00001157-exon-sc0000007-1491911889:597726..598908TCONS_00001157-exon-sc0000007-1491911889:597726..598908Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:597726..602888 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.92 1.21536 0.733024 0.344898 11.3939 4.81509 7.67646 7.06777 1.41511 2.49509 2.62124 1.85672 5.8256 3.94172 0.919679 3.04247 0.535675 1.09475 6.67529 4.85489 4.6343 4.24359 5.08497 3.40487 4.52724 6.80764 8.46095 11.6355 0.97593 1.21355
Blast
BLAST of TCONS_00001157 vs. Swiss-Prot (Human)
Match: KDIS (Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3)

HSP 1 Score: 177.948 bits (450), Expect = 8.655e-45
Identity = 130/461 (28.20%), Postives = 242/461 (52.49%), Query Frame = 2
Query:   14 DTPREASFLSSLNGLRRVVEQVNHDFDKMDYCTQQELLLATISEYLMEPSFSTPLTLGMYSRWGTGKSTQLKRLVELLEEAKSSVPIIPFRVTAPVVFMCILAAVILSVVFWIATDSWEVGVASAXXXXXXXXXXXXXARVTLISHSRGLRSAGEA------MTNFIYRCVWF----LKLIYCIPPSI-QEVKPALPVHLMTVDLTRSVLVGDNPMTSLVNFIRELNDSIEQNIGIVIPRLYRIFQSGPYRTPSGGKSIFRTKWKKSCCCVPSFLISIVVFACLLVGLILYGAWKLNGPSAAI-AIQIACLCVLGGFLLANLLRFFIIIYCLVLPMKKRV-NFVSTQAGIQEETFLSVVKQELDLCVDMLECLDGFAQRQTRIIVHIDLLESLEQQKVLGLIDSLKFMISAPGHPFIFVLSVDPRLLIKAMDQSLTIV--HGPVNAYDYLRNLVDLPFYIS 1351
            D   + S L+ + G R +      D D + Y    +L  + +++ L EP+   P+ +G+Y++WG+GKS  LK+L + ++          F+ +  +VF+ +L    L ++F        +G+A ++  + +         +  I    G R  GE+      ++  + R + +    LKL++  PP + ++   ALPV  +  D  R   VG    TSL   I  L+D+ E+  G +  RL+R+F++      + GK     KWKK+ CC+PSF+I + +  C++ G+ L   ++++     + A+ I+   V+G   + N   ++ ++  L+   +KR+ N  S    ++ E F+ V+K E++L   M + +D F Q QTR++V ID L++ EQ KVL ++D+++ + S    PFI + + DP ++IKA++Q+L  V     +N +DY+RN+V LP +++
Sbjct:  411 DCSHQKSILTQIFGARHL-SPTETDGDMLGY----DLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHP-NLGIAVSLSFLALLY-------IFFIVIYFGGRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGE--TSLAEMIATLSDACEREFGFLATRLFRVFKT----EDTQGKK----KWKKT-CCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISIASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKVLKCEVELMARMAKTIDSFTQNQTRLVVIIDGLDACEQDKVLQMLDTVRVLFSK--GPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHLPVFLN 845          

HSP 2 Score: 92.8189 bits (229), Expect = 8.719e-19
Identity = 43/132 (32.58%), Postives = 79/132 (59.85%), Query Frame = 2
Query: 1706 IKRVMNVISLKARILKSSDIHFQLPRLGIWVNMCDVWPHKASWFILLCMDVSLALPDKMSIRRLYNLLGYAMPMVGDHE---ENTGNAANYFDTFLASHKPVINVADVRMFTPFLFYLDPTIRSLMIDYMVA 2092
            ++R++N++S+  R+L+++ I F   RL  W+N+ + WP++ SW IL  ++ +  +PD+M+++ +Y  +   +P   D E   E  G+  N F+ FL+S  PV+   DV++F P    LDP +R ++ D   A
Sbjct:  939 MRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLILY-LEETEGIPDQMTLKTIYERISKNIPTTKDVEPLLEIDGDIRN-FEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAA 1068          
The following BLAST results are available for this feature:
BLAST of TCONS_00001157 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KDIS8.655e-4528.20Kinase D-interacting substrate of 220 kDa OS=Homo ... [more]
back to top