Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001152 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001152
Unique NameTCONS_00001152
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6726

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001152 ID=TCONS_00001152|Name=TCONS_00001152|organism=Clytia hemisphaerica|type=transcript|length=6726bp
aaataattcaaaaaagaaCAGACAAAGTACAGAGATAACTGACATGACAT
AAAAATTGACTTGACAATGACTGCCCTTACCTATGGTAtggtattttatt
ttttcattattacGAAAATAACAACAACTTACTTACATTAACTTGTTTCA
ACAATGACGACAAAATCACCACTACAACGAACTGCATCANATTAACTTGT
TTCAACAATGACGACAAAATCACCACTACAACGAACTGCATCAGCTGTCG
ATATCCATACAGACTTGGTAAAAGCATGTGAAGAAGGAGATTTAAACCTG
TTGATGAGTCTATCCTACAACAATCAGAACGTCTTCAGTAAACTCATCTC
TGGAGATTTGAATTATCCACATAAGAGTAAATATGGTTCTTATAAACCTG
GTGATTATCTCTTCATTGCCTGTGAGAACAATCATTCAGATGTTGCTGCA
CAACTATTGATATTTGGAGCTGAGAACAGACCCTTTGGGAAACTGACTCC
ACTTTTGGTTTGTTGCAAACTTGGTCATCTGGAGgctttgaaaattttag
caccAAAGAAGTTTCCTTTACATGTTGATGATATGCCTCTGAAAGATTCA
CCCATATTCTACTGTTGTCGATATGGTCATACTGAATTGTTGAGTTACAT
CATTGAAGAGATTCCAGGTATACTGAGTCATAAATCATTTGGTGGCCTCG
GAGAATGTCCTAAAACAAGATATATTCAAGAATGGTCTGAGTTGACCAGA
ATCATCAAGAAGGAAGAAGAGGTGGTCATAGgTACAATGTTGTTGTTCAT
TGCATGTTTGTTGGAACACAGAGATATGGTGGAGTTCCTGATCAAGAAAG
GAGTTGGTGTCAATACAAGTCTCTCCAAAAATCAATTCTATGATTACCTT
TCGCCACTTTCGGTAGCATGTAAAACCAACAATATGGAAATCATtgaatt
tctttggaaaaataAAGCGGAAATTACTGAATCCATTGCTATTCAAAATC
CTGAAATCACCGGAACTTTATTGGAAAGACATACACAACCCTATACAAGA
ACATATAGCGTGAAAACTGTAATCAAAGACAAAACACCTCCTATAGAATT
CAAGTCATTTTACTGGGACAATCTAAACCTTCACAAGATCCATTTCTCCT
GGCTGGAAGCTTATGGCAATAAAGTTGCACGAGTGGATATCCACAGTAAC
AAACTATCCAGTTTACCAATCAACTTTTTTGAGTTGTTGCCGAACTTGGA
AGATCTTGACATCTCCTGCAACACAATTACCAAGTTGCCGGATGATGGAG
TACACGATTTGAGACTGACTCGAATAATTGCATGTAGCAATGAGATAACA
GCAATCCCCTTGGCTTTCTTTCTCAACCCACACATTTCATTCATGGATTT
TTCGAAGAATAAACTACTCACTTTACCCTCCTTCAGTAAAGATCAAAGTG
GAACAGTCAGCCCTAATGAATGCTTTTGGgattgtcaaaatttgaaagtg
tTGAAATTATCAAGGAACTTACTGACAGATCTACCGAAAGCTATACACGG
TGCAAAGGGACTTGAGAAATTGTCTTTGGATGAAAACCAGTTTACCTCCT
TTGAAACTGTTTGGAGTTGTCCACTGGTGGAGCTTGATATTTCGAAAAAT
CAACTGGCACAGTTTTCTGGTATGACCAAATTAGTCTGGTCTAAATCTTT
GATCAGGTTGAATCTGTCGCGCAACAGCCTTCGGAGCATCTCAACAAGCA
TCAGTCATCTCCAGAATCTTCAATACCTTGACTTGAGCCACAACCGAATC
AGTACCCTACCTCCTGCAAGCAATTGGAAATGTTCTATGCTCATGAAATT
CGATCTTTCTCATAATAAGTTCACCGGCAAATCAGCATATGATGGGATGG
CAgagaaaccatttgtcagtaCTTGTGAATTTCCGGCCGAACTTTTTCAA
CACACCTTGGAAAATTTGAACCTCAGTGACAACGACTTGCAAGTGTTCCC
AGATACTATTTGTGAATTAACAGCATTGCAAGATCTCAATTTGAGCAGGA
ATCACAATTTACATACGATACCAAGCACATTGGGAAAACTGAAGAATATT
TGGACGCTGAAACTTGCTGAATTAACCATTCCTGAATTAGCAAGTTTCAA
CCTCGATGATAAAAACGTTGCGAAAGATATCCTACCTTTCTTGAGAGCAA
AACTAAGGAAATCAGAATCTTTCAATCGAATGAAACTCATGATTGTTGGT
TTACAGGGTCGTGGAAAAACTACTTTGTTGTCAGTCATACAAGGGAAAAA
CCTGCCAGAAAACATTTCGACTGTTGGTATTACTGTTGAGCAATTCACGT
TACCGTTAAAGTCTAAACTGCCTGGCTTCCTTGTGAGTAACCAGAAACCA
GGGATCAAGTTTAGTGCATGGGATTCTGCAGGCCAACAAGTGTATTACGC
GACCCATCAATGTTTCTTGACTAGTCAAACACTTTATTTGGTGGTGTTCA
ATGTCACCCATGGTCGTCAAGGAATCATTGATCTAGAACCCTGGCTTGCC
AATATTCAGGCTCGTGCAAAGAATTCGCGTTGCATTATTGTGGGAACGCA
CACAGACTGTATGCCCAGTGAGAACAAAAAGCAAACGTTGGCAGGTTACG
AGAAAGAAATTCATACGCGTTACTACAAGAAGAAAGGATTCCCGGACATC
GAAGGCTACTTGTTCATTTCAAGCGTCAGTGGTGAAGGTGTGGAGGGTAT
GAGACAAATGATTTACAATGTGGCTGAGTCAATGAACAGTGGAAGCAATA
CATTGACTGGTGCTCCTAATCGGAAAATGGCTCCTCGCAGCTACATCAAC
TTATACGACGAAATTTTGAAAGAGAAAGATCGGCGCGCCAAGAATTTTAT
CCCTCCAATACTTACGACAGATGAGATGTTACAGTTGGCTGATCAAAACC
CTGAGGATAATGATATCTTCACCGTGGAAGAATTGGTCCTAGCAACACGA
TTTCTTCACGAGAACGGGATAGTTTTACACTTCGACGATCATTTACATGA
ACtgaacaacatttttttcatCGACCCTTCATGGTTGGTAGACATGTTCG
CTTTGGTGGTCACCATTCCCGAGTGCAATCGGTACGCCCAATCGGGATAC
ATCGAACGCAAAATGTTGATTCAAATCCTCAGTGAAAACCCACGGCTTCC
AGAAAACTTTTTACCACAGTATTTGAGATTATTGGAGAGGTTTGAAATCG
CGTTATGTTTGGACGTGCAAACACAGTTTCTCATCCCTGCAATGTTACCC
AGTGATCGACCAGAGTTGACGGAACAATTGGAGAGATACATCGAAATTGA
ACTTGCAAATGATTCCAAACATTACTGCTTGAATCGAACTTACCATATGA
GTTATATTCCAGCTGGATTCTGGAGTCGTCTCATCGCCCGACTAATGATA
GCTGTTCAGAAGTGGGGAATGCAGATCTCCGATGAGCCGACATCTGAGAC
AGAAAATTATGAGCACAAAGTGTGGCGAGAAGGAGTAATGGTCACCTATG
ATGATGGTTTTTATTTGGTCGAATCTTTCCACGATGAGACACAGTACCCA
GCATGGAGCAACAAAGGAGTTTCGATCACAGTGTGGTCATTGGAGCAAGA
TTTCTCGGTAATGGGGTTTATCGTCGACCATTTGGATATGTTGATCACTG
AATGGTACCCAGGTTTGGAAGATGTTGATAACAATGGAGATTGTTTGGTT
CAAAAACTCATCACTTGTCCCATGTGTCGTAAAAACCGTCAAGACGTTCT
ACAAAATGAGATCATAGGTTTCCGACCGATCAATCGATATGATACTGAAT
ACAGTCATTATTTCAGGGACGTTCAGCATGTCAACCAGTTCTATCTGTTG
ACTTGTGCATCAGCTGCAATCAGCTATAAAGCCATCCTCTGTGAGAAGCA
TCCCCAACAATATGTGGATTTGAGCTTAGTTGTACCTGACCTCATGTTGA
CCGATCTCCCACCTTATTTTGTCATCGATCCAGGCCGCTTCATGTTTGCG
CCCTCGGAAGAAACCCGTCTTGGCGTAGGAGGGGCGGGTGGCGTTTATAA
AGGAGGTTACAAAGAGTGCCAAGTGGCGGTCAAGCAGTTCCATTCCACTA
CCAAAGCAAAACAATTCGACACGTCGATGGCAGAAGAGCGAGATGAAACA
GATGGGATAAGCAATGTCTTCAAACCCACTCCACAAAGCACACAAGAACA
ACTTGAAGATACCAAAATCATCCAAGCTTTTTGGGAACTTAGGCAAGAGG
TATCAATGCTTTGCCGTCTCCAGCACGCCAACATCATTCAGTTTATCGGT
GTATGTCATTCACCTTTGTGTTTCGTGATCGAGCTTGCACCACAAGGAAG
TTTGCAAGGGATATTAGAGAAGAAACAACAACAAAGGGACGAACATTCAG
ATGGGTTGGTCTCAGATAGTCATATGTATGGCTCCATACTGGGAAGATTC
ATCAGTTATAAAATCGCGTTTCAGGTGATCGATGCGCTGTATTACTTGCA
CGATTCCGAAATCGTTTATCGGGATTTGAAATCGGATAACGTTTTGGTGT
GGTCACTTGATCCAAATGATGTCATTAACATCAAACTTTCTGATTACGGA
ATCGCCACTTTCTCCACGCCCCAGGGTGTGATTGGTGAGGGTGGAACGCA
CGGTTTTCAAGCGCCTGAAGTACGGTTTAGTTCACCTTATGACGAAAAGG
TTGACATCTTTTCCTTTGGAATTTGGCTTTACGAGTTGTTGTCCGGCTAT
CGACCGTTCCGCACTTTTCGGACAGGATCAGAGATGAAAAAGGCTATACT
TCGTGGTGTTCGACCAAACTTGAGACAAGATTTCATCAACTCAGATCTTC
CATTCCTCGAATGTATCATGGAGGACTGCTGGCAACAGAATCCGAACAGT
CGACCTTCCTCTCAAGAACTTGCCATGTGTTTGAAGCAACCCGATGTTTG
TATGCTGCAAAACATCTATCCTCCTTCCGATGTGCTGACCTTGCAGAAAG
TTCGTGTCGCTATCCCATGGACTCGCTCTGaaaaatcagcAAAGGAAGAA
GAGATTTTAATTTGGTCAGAGTATGGAGCCGACAGACGCTACCAGTTGAT
CGACATTCGTAATGATAAACCttctaacaacaacaacaatcgaGAAAAAA
TCTTGGCTGGTCCCAGGATTCTTTGCGCATGTCAAGTGGAGAATCATGTT
TGGTTGGGAAACGAGGGATGTCAAATCGAAGTATTTGGCCAGCTCTCTAA
CCAACAGAGACCGTCCATTTTATGGAAGTTCTCATTGGCCAAACTGAAGT
ATGCTCTTGACATGAAGACCTATCAACATGACGGCATTCTGAAGGTGTTC
GCATCTTTGGTGGACGGTCATTTATGTATATTCACCAAAGACTTGCACAG
CACCTCCAACAGTCGCCCTATCTTCGACGAAACTGAAGAGGATATTGTTC
AATTCGAAAAAGATAAATGGGACGTTCAAGATTTGAATCTAGGTACACGA
GGTTATCCAGCAAAATGTATGAGCTTAACACGAAACAATACAGAATTGTG
GGTAGGTTCTGGCAGTCTGATAGTGATTGTTGATCCACATAGTAACACCA
TCAAAGAGCACATCGAAACCACCATTCGCACCAATCGCCTTATTTCACTG
ATGACGTCAGATGAATTTGACAACATGTGGACGTGTGAACGCGGTATGTC
TTTCGTCACGCAATGGGATGTGGCCTCGCGTACTAAATTATGGGAATTTC
AATGTAATATTGAGAATCCTGTTGATCGTGTTTTAGTATGTGAGAACACG
GGCCACAGAAGTGACTCAGTGACGTCAGTAGATGAAGTTTTTGTTGAGAG
TATCAACAATGCGAAGAAAGATGAAACTGAAGTCATTGCAGAAATCCTCG
ACCTCAAGCCAGTCCCACCTCGTTCACGAACGATCTCTATCACCAAACCT
GACAAAATAAGGCGAATTTCGGATGGCTTGTTTGGTACTTCGCCGACCAA
AGGTAAATCCAAGGATGATAAAGCTCGTTCGAAATCTGATGACGCTCCTT
TGAGTAGCTCACCAAAGAAAAGTCATTTTGCGAAagaagaaaactttttg
aaagatCTCGTTAAACCTGATGGTTTTGTTAAACGTTCATTGGTCAAAAA
ACCGTCTCTGATGCACCCTACGAATGGTCGATCAACACGTAAGAAACAAG
AACAAGTACACGCAGAACTTCTCAGCAACTCACTACCACGACAGCGCACT
GGTAACGTAGTGACTGGTAAACCTGTACGTGTAACCGGCCTCGTTTATGC
TAAAGATGCGTTATGGGTTGGTCGGAATAATGGAGACATTCTGGTCATTG
CTATGAAGAATACAGAGCAAGTGAGTAACGGTACAGTGTTGGCGGTTCTT
GGTGGTCTTCAGGTGCGCTCGCTTGGTGGCACCAGCAGGACGATCACAAG
TTTGTCCAGAATTTCAGAAGATCGTATGTTGGCTTTGGTCAAATTCGATA
ACAAGACAAACACAAAGTCACCACGACTTCTTCGCACATCAGAGTCAGCG
CCCGCCTTTGAGAATTATCAGTTGTTGAAATATGATATCAAATCTACTGA
TGAGATTGTACAATTCAAATCCCGTCAAGTTTTAAATCATTCATGATccg
aattttttattttcataacttatttt
Run BLAST on NCBI

transcript from alignment at sc0000007:513015..530703-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001152 ID=TCONS_00001152|Name=TCONS_00001152|organism=Clytia hemisphaerica|type=transcript|length=17689bp|location=Sequence derived from alignment at sc0000007:513015..530703- (Clytia hemisphaerica)
AAATAATTCAAAAAAGAACAGACAAAGTACAGAGATAACTGACATGACAT AAAAATTGACTTGACAATGACTGCCCTTACCTATGGTATGGTATTTTATT TTTTCATTATTACGAAAATAACAACAACTTACTTACATTAACTTGTTTCA ACAATGACGACAAAATCACCACTACAACGAACTGCATCANATTAACTTGT TTCAACAATGACGACAAAATCACCACTACAACGAACTGCATCAGCTGTCG GTAAGAGAGGACTTAACTAATTCTCTAATGCACTAACAGCACAAAACAAT GCATGCACACAGGTAATTTTCACACATTCATTCTATTTTCTGTTTACTTT AACTTAAGAAGAGCTAAAGCTTTTTTCAAAATATGGGAAATGTATTATTG TATCAACAAAATTTGAATTTCCTTTTCAAGATATCCATACAGACTTGGTA AAAGCATGTGAAGAAGGAGATTTAAACCTGTTGATGAGTCTATCCTACAA CAATCAGAACGTCTTCAGTAAACTCATCTCTGGAGATTTGAATTATCCAC ATAAGAGTAAATATGGTTCTTATAAACCTGGTGATTATCTCTTCATTGCC TGTGAGAACAATCATTCAGATGTTGCTGCACAACTATTGATATTTGGAGC TGAGAACAGACCCTTTGGGAAACTGACTCCACTTTTGGTTTGTTGCAAAC TTGGTCATCTGGAGGTAAATTTTAGATGAGATATGCAAACTCTGTCACAG TTTGTTTATGCACATGGTTTATTTTTCGATGTTTACCTATTATATCAGGT CTGCCTGCAGTTCATCATTTTAATGTTATTTTCTTCAATTTTCCTCAAAT TTTAAAGCTAATAAACAACTCTAGATTGATTTGGTTGTTTCTAGGCTTTG AAAATTTTAGCACCAAAGAAGTTTCCTTTACATGTTGATGATATGCCTCT GAAAGATTCACCCATATTCTACTGTTGTCGATATGGTCATACTGAATTGT TGAGTTACATCATTGAAGAGATTCCAGGTATACTGAGTCATAAATCATTT GGTGGCCTCGGAGAATGTCCTAAAACAAGATATATTCAAGAATGGTCTGA GTTGACCAGAATCATCAAGAAGGAAGAAGAGGTGGTCATAGGTACGTCTT TTTAATCAAAGGCTACGTTATTTTTTATCTATCTCGCTAACATACTTATT TATTGTCCTTTGGGGGGCTCTTTATGGCTGCTACCTTAATATCACGATAG TGAAAAAAATTCTAATTTGAATCATTTTAACTTTCTTGGAATTAGGCTGA ATTAGGCAGTATGTAGTTTTGCTTTCTTAGTTCATTTCCTTTACCAAAAA CATTCACCGTTATGAATATGATTTCTTTCTCTTTTTTAGGTACAATGTTG TTGTTCATTGCATGTTTGTTGGAACACAGAGATATGGTGGAGTTCCTGAT CAAGAAAGGAGTTGGTGTCAATACAAGTCTCTCCAAAAATCAATTCTATG ATTACCTTTCGCCACTTTCGGTAGCATGTAAAACCAACAATATGGAAATC ATTGAATTTCTTTGGAAAAATAAAGCGGAAATTACTGAATCCATTGCTAT TCAAAATCCTGAAATCACCGGAACTTTATTGGAAAGGTACTCCGAGTTTT GCTATTTCAATCAGCATCTGGATACGTTTCAGTTATGATATGAATTGTGG TTTGATGAAATTATTTTAAGTTATACTCCCTTTTTATTTCTAACTTATTC TTTACTAGACATACACAACCCTATACAAGAACATATAGCGTGAAAACTGT AATCAAAGACAAAACACCTCCTATAGAATTCAAGTCATTTTACTGGGACA ATCTAAACCTTCACAAGATCCATTTCTCCTGGCTGGAAGCTTATGGCAAT AAAGTTGCACGAGTGGATATCCACAGTAACAAACTATCCAGTTTACCAAT CAACTTTTTTGAGTTGTTGCCGAACTTGGAAGATCTTGACATCTCCTGCA ACACAATTACCAAGTTGCCGGATGATGGAGTACACGATTTGAGGTATTTC TTTCAATTCATTGTTTTGGTTTGATCACTTTTTTCCCAAGATAACAAATT GTTAGATTAAAATATTATGTATAAAAATGAAAAGTGAAAGCAATAGAACT ATTTTATAACAACTCTTTTCCATAAACACAAGAGGATACTTTTCAACTTG ATTCAAACTTACAATATTGTGCTTGATGATTTTTTAGAACTTGCAAGCAT TTTATGAATTATCCGCCAAGACCCGTGCATTTTTTATCAATACAGTTTAC AACCATTTTCTTTCAGACTGACTCGAATAATTGCATGTAGCAATGAGATA ACAGCAATCCCCTTGGCTTTCTTTCTCAACCCACACATTTCATTCATGGA TTTTTCGAAGAATAAACTACTCACTTTACCCTCCTTCAGTAAAGATCAAA GTGGAACAGTCAGCCCTAATGAATGCTTTTGGGATTGTCAAAATTTGAAA GTGTTGAAATTATCAAGGAACTTACTGACAGATCTACCGAAAGCTATACA CGGTGCAAAGGGACTTGAGAAATTGTCTTTGGATGAAAACCAGTTTACCT CCTTTGAAACTGTTTGGAGTTGTCCACTGGTAAGGACTGTCATTTTCATT TTCTACAGAACTCCTTTTTAATATATAGAAATAAAGTCTGATTCTTTTTA CTGATGATTAAATCAACTTTGCAGGTGGAGCTTGATATTTCGAAAAATCA ACTGGCACAGTTTTCTGGTATGACCAAATTAGTCTGGTCTAAATCTTTGA TCAGGTTGAATCTGTCGCGCAACAGCCTTCGGAGCATCTCAACAAGCATC AGTCATCTCCAGAATCTTCAATACCTTGACTTGAGCCACAACCGAATCAG TACCCTACCTCCTGCAAGCAATTGGAAATGTTCTATGCTCATGAAATTCG ATCTTTCTCATAATAAGGTAGCTGTTTCCATTATTTTTGGACCTACCTGG AGGTCCTATAAATTAACCTCTGTCCGTCCGTCCGTTCGTCCGTCTGTTAC CAGCTTTTCTCAGGATTGGCTCATTAATTTTTTCTGATTTTTGGCACAAT GATGCAAAATGGCAATGCCTAAAATGTGACGGAGCCCGAAAAAAAATATA TTTGGGCAAATTTGGGCCAAAAACTGCCCAAAAATAGGGTTTTTGGACTC ACCATCACAGGCTTCGGCATATTAGGCGTGCGATCGCACGCGCACGCCTC CGCACACGCCTAAAAGCCTTTTAGGCGTGCAATTTATCACACGCCATAAA TCATGAAAACTTAGCGAGGCGTGCGATCAATCGCACATGCAAAAATTTAT TCTAGAAATATTTTTTCTGCTTGTTGAAAGAATATCAAATATCATTTTCT ACTTTAATCATAAGAACCAAATAGATGAAAGATAAACTTTCCTTTACTCT TTCAAACTGCTATATGTATACAAAATTTCTTATAAAGAAGTTACTCTAAT GGATACACATCTTCTCTCTCCTCTTTCTCTCATACTATGCTTTGGTCTTC AATAAACAAGCCTTTCTCAAAAATAACTTTTGCTGCACGTTTTTTCGTCT CTCTAAAACCTTTTTTAAAAAATCACTTTTGCTGTATGACTTTTCCTCTC TCAAATCTTTTTCCTTCCCTCTCGCATGCTATGTTTATGAGGTCGTTGGT TTATGACAATAAACTAGCTCTTCTTAAAAGTTACTTTTGCTGCATGATTC TTCGGATCTCATTTGTTTTCCTCCTATTCTCTTTCTTGATTATTCAGTGC TCTTTTGGTTTCTGTTTTTGTTTTTCAAATATGAAGATTGAATATACACT TTCTTCTTTCCTGTTGTCTAGTTTTTATGTAGATAAAANNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNAAAGAAAATGAGGCGTGCCATGATTCGCACGCCTAA ATTACTAAAAATTACTATGTAGGCGTGCGATGATCACACGCCTTCTTTTT TCTTATGCCGAAGCCTGCATCAAGCATGATTCAATTGTCAATAAAACTGA TTTTTGCGACCAGAACTTTCTATTTATTTTTTCCCTACAACCCTTCCCTT TCCCCCATCAACAATCAATGATGAATTTATTGCGTTATGCATTTTCGCTA GAACACTATATTTTCTGACTGATTTTTTTTCATTTTTCTCCTCGCATTGC TATCTAACTTTCATCATCAGGTAGGTCCATTCAGCATCTAGCTTGTTTAG TAATAAAACAGTATCTCTTGTGAACCCTATCTGAGTGGCTAGCTGTAGAA AAGCAGAAACTAACTCTCAATCTATAGAGATTCCCCCAGACATACCCCAT TTATCAAATAAAAGGCAGTACTCTAATCAATAATGAGACGTCTTATATAT TTTACTTTGTTGATCACAGTTCACCGGCAAATCAGCATATGATGGGATGG CAGAGAAACCATTTGTCAGTACTTGTGAATTTCCGGCCGAACTTTTTCAA CACACCTTGGAAAATTTGAACCTCAGTGACAACGACTTGCAAGTGTTCCC AGATACTATTTGTGAATTAACAGCATTGCAAGATCTCAATTTGAGCAGGT GAGTCACTGGGTCAAACATTTTATGTATTGGAAACCAATTTTTTTCTTGA TACGATAAGTGTGAGATAATTTTTTCAATGAAAACCAACCAATTTTTTAA ATGAATCATTTTCTTATGAATATTATTTCATGTTCCATTGCTGCATTTTT ATAGGAATCACAATTTACATACGATACCAAGCACATTGGGAAAACTGAAG AATATTTGGACGCTGAAACTTGCTGAATTAACCATTCCTGAATTAGCAAG TTTCAACCTCGATGGTAAGCTTGTTGCATTAATCTTTCGTATGGAGATGT TGAATATCCGATATCTAGGGGTTTATAAACAATCAGCAGGCTGCGTCTTT GAATTCAAATTTTGTGTGCCACTTCAGTTGTCATTTCAACATTTCAAACT CGTAGATATCTAAGAATGTCCATAGATTGTCTGTCACAGTATTGTAATTC TTTGGTCTTCAAGCAGAAAGAAGTTCATTTTAAACTTGCAACTAAGACTT CCCTGATGAAAAGACTTAAAGGTTTTGTTTTGATTGAAAGGTCTGTAGTA AAAACAAGAGAGACAAGATTAGAAAAAAGTTTTGAAAAAATGAAAATGCA TTGAATAAAAAAACATTCCTCAAACAAAGGGGACTTTTACTGATACTCTT TCGAATGTTTTTTATGTTTATAATAAATAGAACGTTTTCTATCTATAATC AGAACATTCGATTGTAAATTTGCTCGAAATCAACTTTGCTATTTTTTTGT TTACAAAAGCAATAGAATGTTTGCAGGATATCGTTGCGTAAAAATGTACC GGGTGCGCCACAAAAAAGTTTCTCTCTTTAAAAGTAATTTTCTCGAAATC TAAAAATTTTAAAAGAACCATTCCTATTTTATTGGAAAGAAGAAAGATAA ACTTAAATTTTGATGGATCATTTATCGAATTTGATTTATTAGATCAAAAG TTATGCTCGATTGAATAAAAAAGTGACGAATTTAATAAATGACCCATCAA AATTTAAGTCTTATCTTTTTTCTTTCAAATGAAATAGGAATGGTTCTTTT AAAATTTTTAGATTTTGAGAAATTTGATTTCAAAGAGAGAAACTTTTTTG TGGCGCACCCGGTAGCTTTAATTTATCTGACTCAGCATGAAGACACTGCC TAAAATAAGCTCCTTTTTTATTATCGTAGAAAACCTTTAATGAGACTTTT CGAATTGTCCAGATTCACCAAGGGTTGTTGCTTATACACCATGTTCCAAT CGCTTTAACTATGCACTCGTTTTTGCCATTATGTAGAAACCACTCTCAAG GAAGGTATTCTAATTAAACTGACATGGTTTCCACGTGATAGTAAAAGGAG AGTGCGAATGGTCTTTAGATCTTCTACAATGTGATCACAGTTTAGAGTAA AATAACCAAAGATTATTTTTTCTCTTCTAGATAAAAACGTTGCGAAAGAT ATCCTACCTTTCTTGAGAGCAAAACTAAGGAAATCAGAATCTTTCAATCG AATGAAACTCATGATTGTTGGTTTACAGGTATGGGAAGTATAATCAGTAC TAGTTTTAAGTTTCATTCTCTTGATAGAAATTGAATTCTTCCTACTGCTT CGCGTCTTTGAACCTTTAACATTATATCGCTGCTACACGAACTTCTAATT TAAATTCACATTTCAGGGTCGTGGAAAAACTACTTTGTTGTCAGTCATAC AAGGGAAAAACCTGCCAGAAAACATTTCGACTGTTGGTATTACTGTTGAG CAATTCACGTTACCGTTAAAGTCTAAACTGCCTGGCTTCCTTGTGGTAAG TAACTTCTTCTAACAGCCAAGATTATATTCCAAAAGAGCATCCAAAAGAG CTGTTCTTTCCATTAGGGCTATAAGCTTTCATTCGTTCACTTTTAGAGTA ACCAGAAACCAGGGATCAAGTTTAGTGCATGGGATTCTGCAGGCCAACAA GTGTATTACGCGACCCATCAATGTTTCTTGACTAGTCAAACACTTTATTT GGTGGTGTTCAATGTCACCCATGGTCGTCAAGGAATCATTGATCTAGAAC CCTGGCTTGCCAATATTCAGGTATTTACTTGTTAAGTTTCTAAATGGAAA TTTCGACCTGGTATATTTTCCAATTTTCTTTTCGAAGTCTTTCTAGCAAC TTCAATTTGGTCATAAGACACTTTCTAATAACGATTTTATTACATGGATT CTATACAATTTCAGGCTCGTGCAAAGAATTCGCGTTGCATTATTGTGGGA ACGCACACAGACTGTATGCCCAGTGAGAACAAAAAGCAAACGTTGGCAGG TTACGAGAAAGAAATTCATACGCGTTACTACAAGAAGAAAGGATTCCCGG ACATCGAAGGCTACTTGTTCATTTCAAGCGTCAGTGGTGAAGGTGTGGAG GGTATGAGACAAATGATTTACAATGTGGCTGAGTCAATGAACAGTGGAAG CAATACATTGACTGGTGCTCCTAATCGGAAAATGGTATGAACGGTTTTCA CTCGCCCTCATAAGAACACCATATTATATCACTCCTTGTAACCTCCTTCC TCTCGCTAAAAATAGGTTGACTTTAAGATCTCTTTCCTTTTTCAATCACT TTCCTTTTTCATTCTCTAGGATTGTTAAGTAAGATACTTTAAAAGGAGAA TTACTTGAGGAACGTTAACAACATAATTTTTTTGCCGAGAAGGAGTTTTT CCAGTGAAATGTAAGTAATTAGTAGACTTTAGATCATCTTTTTGTATAAT ACAACGCGCTTCATTTTATCTCCACCCTTACCGAAACGGAAAAGTTCGTT TTATCAGACAATTTAAGTAAAGACGATTATATTTCTCTTCCAGGCTCCTC GCAGCTACATCAACTTATACGACGAAATTTTGAAAGAGAAAGATCGGCGC GCCAAGAATTTTATCCCTCCAATACTTACGACAGATGAGATGTTACAGTT GGCTGATCAAAACCCTGAGGATAATGATATCTTCACCGTGGAAGAATTGG TCCTAGGTGAGATTAAGTACCTATTGTTTGGAGTTTTTATAAGATACTTT AATAATTGGTCATTTAAAGTAATAAAAATGACGCGTTCTTTAGAAAAAGT AACAAAATTGTTTTATTAATTGTTAACGACCAACCAAATCAAATAAGAGC TTGTAAAAACTCCATCTCGTCCCATTGTTTCATCGAAGACTTTATGAGAC CTTTTAGCAAGACTGTCAGCTGGATGTACACAGTATATTGGAATGATACA GAATCGAATTGTGAAGCCTTTCTACGAGAAGCCGTTTTCCGAAATAAAAG TTATGCTATCATTCTATCAGGTTATGGTTAAGTATATAAAAAATTTTCTG AGATTTAAGAAAAGACGTTTTGTTTTTCAGCAACACGATTTCTTCACGAG AACGGGATAGTTTTACACTTCGACGATCATTTACATGAACTGAACAACAT TTTTTTCATCGACCCTTCATGGTTGGTAGACATGTTCGCTTTGGTGGTCA CCATTCCCGAGTGCAATCGGTACGCCCAATCGGGATACATCGAACGCAAA ATGTTGATTCAAATCCTCAGTGAAAACCCACGGCTTCCAGAAAACTTTTT ACCACAGGTATTCATTTCCTTTCGTCCTGTCATATCTTTAATACTGATAG ATTCATAGACTTGGCTTCTCCTTTTAAAAAATTTCTCGTCAATATTTAGT TATACTTACAGTTACAAACAATAAAACTTCTTGAAATAATTAGGCTCAAT TCATGATATGCACCATTGCAATGTCTTCCATTCCACCCAATAGCTGATTG GTTGAAAGTGACGTAAAAGCAGTCAATACGTCACTTTCAACCAATCAGCT ATTGGGTGGAACGGAAGACATTGCAATGGTGCATATCATGAATACTCAAT TCTTTCTTTTCAGTATTTGAGATTATTGGAGAGGTTTGAAATCGCGTTAT GTTTGGACGTGCAAACACAGTTTCTCATCCCTGCAATGTTACCCAGTGAT CGACCAGAGTTGACGGAACAATTGGAGAGATACATCGAAATTGAACTTGC AAATGATTCCAAACATTACTGCTTGAATCGAACTTACCATATGAGTTATA TTCCAGCTGGATTCTGGAGTCGTCTCATCGGTAAGTTGTTACAACTTTCT TATTGATTATTTAATGGAAATATAGTTTCAGAATTTATATGACAAATTAT TTGAAACTGATCAAAACAAGATTTAGGATACGACTTTGAATATGTTTATA TTATACTTTACTTTTTGCATACAGCCCGACTAATGATAGCTGTTCAGAAG TGGGGAATGCAGATCTCCGATGAGCCGACATCTGAGACAGAAAATTATGA GCACAAAGTGTGGCGAGAAGGAGTAATGGTCACCTATGATGATGGTTTTT ATTTGGTCGAATCTTTCCACGATGAGGTATTTATCTAAAAAGTTAAAGAG ATAATCAGATGGTTTGTAATATGTGGGATCCTTCTATTGTCCTGAGCGAA ATTTCAAAATATTTTTGCCTAACTATTTTCCAAAGTCGAGATATTTTGTC AAGAGTTTTTGGCTTTTACAGGGTTCAGACAGACCCTGGAAAACCTGGAA AACCTGGAAATATGATAAATTTTCAGAAAAATCAGGGAAACTCAGGGAAA CCCAGGGAAAAAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNTGGTTTGCTTGATACTCAGGGAAAAAATAGCTAAAATGAGGA ATTTCTCAGGGAAAAAACCTTTGAAAATTGATTAAAATTCAGGGAAACTC AGGGAATTTTTTTTTCGAAGGTCTGTCTGAACCCTGTTTTAGGATGAAAA CAATAGACTTTCAACGTAAAAACCCGTGTAAAGAACCCATCTTCAAAAAA TTAAAATTTTGATATCTCAATTTTGGAAAATTGTTACACAAGAATATTTT TTGAGGTTTTACTAAGGAGCACAGAAGGTGTCTGTAATCTAAATATCTTA TCCCTTTAATAATCATATCTAGCACCAAATCAACCCTATTCCTTCTCGCT CGTTTACGATATCTTGAAAAGCTTATGCAAGCAATTTAGGATCCAAACTT TGTCTTGGAATCAAAAGAAAGAATGAATATAATTAAACTTTTCAAACCTC ATCAGATCCTTTTGAAAACCAAGCCCCCTTGAACTCTAATCTTGCATGTT TCTTCAGACACAGTACCCAGCATGGAGCAACAAAGGAGTTTCGATCACAG TGTGGTCATTGGAGCAAGATTTCTCGGTAATGGGGTTTATCGTCGACCAT TTGGATATGTTGATCACTGAATGGTACCCAGGTATGAAGAAATGTGGTCT TTTCTCTCCTTTCTTCATGTTATCTTTGATAACGAATCCAACCTCCACAG GAATTACTTCTTAACAAAAAAGTTTTATTCATGTCGAAAGATTTAATTAT CATCCATTTAACTGAAGAAAAATCTTATGGTAAGTAAGGGGGTGGACGCT TTGTNTTAGGATCCAAACTTTGTCTTGGAATCAAAAGAAAGAATGAATAT AATTAAACTTTTCAAACCTCATCAGATCCTTTTGAAAACCAAGCCCCCTT GAACTCTAATCTTGCATGTTTCTTCAGACACAGTACCCAGCATGGAGCAA CAAAGGAGTTTCGATCACAGTGTGGTCATTGGAGCAAGATTTCTCGGTAA TGGGGTTTATCGTCGACCATTTGGATATGTTGATCACTGAATGGTACCCA GGTATGAAGAAATGTGGTCTTTTCTCTCCTTTCTTCATGTTATCTTTGAT AACGAATCCAACCTCCACAGGAATTACTTCTTAACAAAAAAGTTTTATTC ATGTCAAAAGATTTAATTATCATCCATTTAACTGAAGAAAAATCTTATGG TAAGTAAGGGGGTGGACGCTTTGTTTTTTTAACACTACTTTTCTTCGTTA GGTTTGGAAGATGTTGATAACAATGGAGATTGTTTGGTTCAAAAACTCAT CACTTGTCCCATGTGTCGTAAAAACCGTCAAGACGTTCTACAAAATGAGA TCATAGGTTTCCGACCGATCAATCGATATGATACTGAATACAGTCATTAT TTCAGGGACGTTCAGCATGTCAACCAGTTCTATCTGTTGACTTGTGCATC AGCTGCAATCAGCTATAAAGCCATCCTCTGTGAGAAGCATCCCCAACAAT ATGTGGATTTGAGCTTAGTTGTACCTGACCTCATGTTGACCGATCTCCCA CCTTATTTTGTCATCGATCCAGGCCGCTTCATGTTTGCGCCCTCGGAAGA AACCCGTCTTGGCGTAGGAGGGGCGGGTGGCGTTTATAAAGGAGGTTACA AAGAGTGCCAAGTGGCGGTCAAGCAGTTCCATTCCACTACCAAAGCAAAG TAAATTCATTTTCATTCTTGTCTCGCCTTTTTTATTTCTGTCAACTTATC TTTGGCTGTTTTTAATCTCAATATAAAAAGGAATCGGAACTCTTAATAGT CATCAAATCTATTCTTTTCAGACAATTCGACACGTCGATGGCAGAAGAGC GAGATGAAACAGATGGGATAAGCAATGTCTTCAAACCCACTCCACAAAGC ACACAAGAACAACTTGAAGATACCAAAATCATCCAAGCTTTTTGGGAACT TAGGCAAGAGGTAGCCGGTTTTGCAATTACTGTCCTTTTCCTCCTCTTTT TACCAAGTCATTACTGAGATGTTTTCTCCATCTATCTTTATTACCTTATG GTATTATATTGACTAGGCGTAGTGGTGTGGTGGTCATCGCTCTTGACTTC CGTCTGGGAGGTCCGAGTTCGATTCCCGCTGTAGTACTACGGTTCACTTG AACACACCTTCGCCCGGGTCAACCCGGGTCAACCCATACCATGTGAGGGG AATTGGGTACCACTACTCTGATACAAGAGTGTGGGTGATATGCCAGACAT TGTGATGTGTTGTGTCACTCAACCCGTTCTGCGCCTGCGACGAGCTATAT GCTCTCCCGCGTAGATCGAGTGTCATCACTATGCATCATGGCATCATGTG TCTCGCGTGCACTGAACCAGTGGTTGAAAAAGGAGGAATTCCTATTTCGT AAGGAGTCCATTCCTCGATGGGGAGGGCTCACAACTTCATTATNCTATTT CGTAAGGAGTCCATAACTTCATTGTACTGACTTCTTGAACTATTTGTACC AGATGACATTCAATCGTAACACTGCTTCTTTGTTTACCATATACAACAGG TATCAATGCTTTGCCGTCTCCAGCACGCCAACATCATTCAGTTTATCGGT GTATGTCATTCACCTTTGTGTTTCGTGATCGAGCTTGCACCACAAGGAAG TTTGCAAGGGATATTAGAGAAGAAACAACAACAAAGGGACGAACATTCAG ATGGGTTGGTCTCAGATAGTCATATGTATGGCTCCATACTGGGAAGATTC ATCAGTTATAAAATCGCGTTTCAGGTATTTGTGAATGCTTTTAGCTTAAT GATTATTTCCCGAGACCTTGTTCGCAAAATGCTGACACGTTCTCAAAAGT GCTCAATACTCGATCGAAACAAGCTGCTTTCATTCTTTTCTTTCAACATG TGTCTTGAATTGAATGTTCAGGACATTCCCTTTTCATTATTTCTATTTGA TTTTTGACAGGTGATCGATGCGCTGTATTACTTGCACGATTCCGAAATCG TTTATCGGGATTTGAAATCGGATAACGTTTTGGTGTGGTCACTTGATCCA AATGATGTCATTAACATCAAACTTTCTGATTACGGAATCGCCACTTTCTC CACGCCCCAGGGTGTGATTGGTGAGGGTGGAACGCACGGTTTTCAAGCGC CTGAAGTACGGTTTAGTTCACCTTATGACGAAAAGGTTTGTATTCTNACG GTTTTCAAGCACCTGAAGTACGGTTTAGTTCACCTTATGACGAAAAGGTT TGTATTCTTTTTATTCTAGTGCAAACCATGTTATGGAAAATGCTTTTTAG ATCTAGTTGAAATCGCGTGGATTCACCTTTCACTAAAAACGTCTATTTTA AAAGAAGTCATCTACTCAATATCTGTCCTTGCAAGACTTGATCCCGAAAT CTCACAACTTTCCTTTTTTTAATCTTACAGGTTGACATCTTTTCCTTTGG AATTTGGCTTTACGAGTTGTTGTCCGGCTATCGACCGTTCCGCACTTTTC GGACAGGATCAGAGATGAAAAAGGCTATACTTCGTGGTGTTCGACCAAAC TTGAGACAAGATTTCATCAACTCAGATCTTCCATTCCTCGAATGTATCAT GGAGGTATTCTCAATTTTCTCGCCTACTTCCAAACATGCTTAATATTGAT TAGTGAAATTCAAGGCAAAAGGCACAATTTTCTTATCAGCAATTATTTTG ATCGTTTAAGTATGTGAATATACATCCGTCACATTGGGCCATTTCATTTT ATATCCATACAGGGGGGGCTGTATGGATTTTTAATGAAACAGTCCATTAA GACATCAGAACCATAGTATTTTTTACTGACGAATATTTTATTGATCGATG AAGTTTTCGGATATGCCATTTTCTTCTTATGGGTCCAGTTTTTGTGGGAT CATAGATTTTAATTTTATTTTTTCTCTTTGGTAGGACTGCTGGCAACAGA ATCCGAACAGTCGACCTTCCTCTCAAGAACTTGCCATGTGTTTGAAGCAA CCCGATGTTTGTATGCTGCAAAACATCTATCCTCCTTCCGATGTGCTGAC CTTGCAGAAAGTTCGTGTCGCTATCCCATGGACTCGCTCTGGTAAGTTTC CTACATAGTTTCAAGAGGATTACATCCTCTGCTAAACCCCATGTGTAAGA TTTTCTTTTTTTGTCCGCGAATTAAATATCTGTAAACACTATCAAGCTTT CTTTGAGTTAAAAGAAAAAAATTTTTTTTTTGGAAAGGGCTTGGTACTCA AAAAATGAAAGAGTGATTTTAGGCTTACTTTAAAGAAAAAGTTGAACACG AAGAATGTCGGTGCTCTAAGAATTATCAATGGATTGCTTTTAGAAAAATC AGCAAAGGAAGAAGAGATTTTAATTTGGTCAGAGTATGGAGCCGACAGAC GCTACCAGTTGATCGACATTCGTAATGATAAACCTTCTAACAACAACAAC AATCGAGAAAAAATCTTGGCTGGTCCCAGGATTCTTTGCGCATGTCAAGT GGAGAATCATGTTTGGTTGGGAAACGAGGTATCAAAGGTATAGGTTCCAA TACCAGAAATGTTCGTTATTCGCATGTAATACGCATTCTGCTTACATTAT ATTACCTTGGAGAAACGAAATAAGTTTTCATATGAAGACTATCCATTCAT TGAGTGTTTTTTTTGGTTTATCCATTCATTGAGTGATGTTGAGTATTTGT TCAAAAATAATCACTTATTCATCTCCCTAATCATTTCCAGGGATGTCAAA TCGAAGTATTTGGCCAGCTCTCTAACCAACAGAGACCGTCCATTTTATGG AAGTTCTCATTGGCCAAACTGAAGTATGCTCTTGACATGAAGACCTATCA ACATGACGTGAGAATTCTGTTTGATAATTTTACAGTGTTTGTATCCTATA AATTGACATCTGTTGGCAGAAATTCGTCACCATTTTTTTTGACAATCCTC TCCGCAAACAAGTTCGTACCACTGACATTTTGAGTTTGAATTTTGTATGT CCTGTTCCCTAAACACAAGTCCTAGGGGCATTGCTGGAATTTCCAGATTC GTGTATTTTGCAGACAATCAAATGTTGATCTTTTTTACCACGATATGAAA TATTATTCTATTGTTCCTTCTTTTCTTCTGCACAGGGCATTCTGAAGGTG TTCGCATCTTTGGTGGACGGTCATTTATGTATATTCACCAAAGACTTGCA CAGCACCTCCAACAGTCGCCCTATCTTCGACGAAACTGAAGAGGATATTG TTCAATTCGAAAAAGATAAATGGGACGTTCAAGTAGGGTTCTCTATCTTT CGATTCTTTTTTAGCCATCGCCCTTATCCCAGCGATTTACTAGTAGGAAG GATAACGATAGTTGGACCAGGCCTTCATGTGTCTCCTCCCTCGCTGTCCT ATTTATACTGTGATAACAGATTTGCAACGATTCTCTTTTCAGGATTTGAA TCTAGGTACACGAGGTTATCCAGCAAAATGTATGAGCTTAACACGAAACA ATACAGAATTGTGGGTAGGTTCTGGCAGTCTGATAGTGATTGTTGATCCA CATAGTAACACCATCAAAGAGCACATCGAAACCACCATTCGCACCAATCG CCTTATTTCACTGATGACGTCAGATGAATTTGACAACATGTGGACGTGTG AACGCGGTATGTCTTTCGTCACGCAATGGGATGTGGCCTCGCGTACTAAA TTATGGGAATTTCAATGTAATATTGAGAATCCTGTTGATCGTGTTTTAGT ATGTGAGAACACGGGCCACAGAAGTGACTCAGTGACGTCAGTAGATGAAG TTTTTGTTGAGAGTATCAACAATGCGAAGAAAGATGAAACTGAAGTCATT GCAGAAATCCTCGACCTCAAGCCAGTCCCACCTCGTTCACGAACGATCTC TATCACCAAACCTGACAAAATAAGGCGAATTTCGGATGGCTTGTTTGGTA CTTCGCCGACCAAAGGTAAATCCAAGGATGATAAAGCTCGTTCGAAATCT GATGACGCTCCTTTGAGTAGCTCACCAAAGAAAAGTCATTTTGCGAAAGA AGAAAACTTTTTGAAAGATCTCGTTAAACCTGATGGTTTTGTTAAACGTT CATTGGTCAAAAAACCGTCTCTGATGCACCCTACGAATGGTCGATCAACA CGTAAGAAACAAGAACAAGTACACGCAGAACTTCTCAGCAACTCACTACC ACGACAGCGCACTGGTAACGTAGTGACTGGTAAACCTGTACGTGTAACCG GCCTCGTTTATGCTAAAGATGCGTTATGGGTTGGTCGGAATAATGGAGAC ATTCTGGTCATTGCTATGAAGAATACAGAGCAAGTGAGTAACGGTACAGT GTTGGCGGTTCTTGGTGGTCTTCAGGTGCGCTCGCTTGGTGGCACCAGCA GGACGATCACAAGTTTGTCCAGAATTTCAGAAGATCGTATGTTGGCTTTG GTCAAATTCGATAACAAGACAAACACAAAGTCACCACGACTTCTTCGCAC ATCAGAGTCAGCGCCCGCCTTTGAGAATTATCAGTTGTTGAAATATGATA TCAAATCTACTGATGAGATTGTACAATTCAAATCCCGTCAAGTTTTAAAT CATTCATGATCCGAATTTTTTATTTTCATAACTTATTTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000631XLOC_000631Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001152-exon-sc0000007-1575043694:530454..530703TCONS_00001152-exon-sc0000007-1575043694:530454..530703Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:529990..530273TCONS_00001152-exon-sc0000007-1575043694:529990..530273Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:529563..529809TCONS_00001152-exon-sc0000007-1575043694:529563..529809Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:529068..529314TCONS_00001152-exon-sc0000007-1575043694:529068..529314Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:528661..528945TCONS_00001152-exon-sc0000007-1575043694:528661..528945Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:528075..528387TCONS_00001152-exon-sc0000007-1575043694:528075..528387Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:527737..527979TCONS_00001152-exon-sc0000007-1575043694:527737..527979Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:525906..526084TCONS_00001152-exon-sc0000007-1575043694:525906..526084Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:525640..525749TCONS_00001152-exon-sc0000007-1575043694:525640..525749Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:524376..524473TCONS_00001152-exon-sc0000007-1575043694:524376..524473Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:524109..524237TCONS_00001152-exon-sc0000007-1575043694:524109..524237Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:523834..524007TCONS_00001152-exon-sc0000007-1575043694:523834..524007Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:523420..523689TCONS_00001152-exon-sc0000007-1575043694:523420..523689Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:522898..523060TCONS_00001152-exon-sc0000007-1575043694:522898..523060Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:522297..522523TCONS_00001152-exon-sc0000007-1575043694:522297..522523Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:521774..521990TCONS_00001152-exon-sc0000007-1575043694:521774..521990Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:521478..521629TCONS_00001152-exon-sc0000007-1575043694:521478..521629Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:518603..518726TCONS_00001152-exon-sc0000007-1575043694:518603..518726Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:517955..518402TCONS_00001152-exon-sc0000007-1575043694:517955..518402Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:517694..517832TCONS_00001152-exon-sc0000007-1575043694:517694..517832Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:516880..517104TCONS_00001152-exon-sc0000007-1575043694:516880..517104Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:516469..516693TCONS_00001152-exon-sc0000007-1575043694:516469..516693Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:516050..516223TCONS_00001152-exon-sc0000007-1575043694:516050..516223Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:515563..515719TCONS_00001152-exon-sc0000007-1575043694:515563..515719Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:515126..515310TCONS_00001152-exon-sc0000007-1575043694:515126..515310Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:514797..514913TCONS_00001152-exon-sc0000007-1575043694:514797..514913Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:514372..514518TCONS_00001152-exon-sc0000007-1575043694:514372..514518Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1575043694:513015..514211TCONS_00001152-exon-sc0000007-1575043694:513015..514211Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:530454..530703TCONS_00001152-exon-sc0000007-1510915933:530454..530703Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:529990..530273TCONS_00001152-exon-sc0000007-1510915933:529990..530273Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:529563..529809TCONS_00001152-exon-sc0000007-1510915933:529563..529809Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:529068..529314TCONS_00001152-exon-sc0000007-1510915933:529068..529314Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:528661..528945TCONS_00001152-exon-sc0000007-1510915933:528661..528945Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:528075..528387TCONS_00001152-exon-sc0000007-1510915933:528075..528387Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:527737..527979TCONS_00001152-exon-sc0000007-1510915933:527737..527979Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:525906..526084TCONS_00001152-exon-sc0000007-1510915933:525906..526084Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:525640..525749TCONS_00001152-exon-sc0000007-1510915933:525640..525749Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:524376..524473TCONS_00001152-exon-sc0000007-1510915933:524376..524473Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:524109..524237TCONS_00001152-exon-sc0000007-1510915933:524109..524237Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:523834..524007TCONS_00001152-exon-sc0000007-1510915933:523834..524007Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:523420..523689TCONS_00001152-exon-sc0000007-1510915933:523420..523689Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:522898..523060TCONS_00001152-exon-sc0000007-1510915933:522898..523060Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:522297..522523TCONS_00001152-exon-sc0000007-1510915933:522297..522523Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:521774..521990TCONS_00001152-exon-sc0000007-1510915933:521774..521990Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:521478..521629TCONS_00001152-exon-sc0000007-1510915933:521478..521629Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:518603..518726TCONS_00001152-exon-sc0000007-1510915933:518603..518726Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:517955..518402TCONS_00001152-exon-sc0000007-1510915933:517955..518402Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:517694..517832TCONS_00001152-exon-sc0000007-1510915933:517694..517832Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:516880..517104TCONS_00001152-exon-sc0000007-1510915933:516880..517104Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:516469..516693TCONS_00001152-exon-sc0000007-1510915933:516469..516693Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:516050..516223TCONS_00001152-exon-sc0000007-1510915933:516050..516223Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:515563..515719TCONS_00001152-exon-sc0000007-1510915933:515563..515719Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:515126..515310TCONS_00001152-exon-sc0000007-1510915933:515126..515310Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:514797..514913TCONS_00001152-exon-sc0000007-1510915933:514797..514913Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:514372..514518TCONS_00001152-exon-sc0000007-1510915933:514372..514518Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1510915933:513015..514211TCONS_00001152-exon-sc0000007-1510915933:513015..514211Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:530454..530703TCONS_00001152-exon-sc0000007-1491911889:530454..530703Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:529990..530273TCONS_00001152-exon-sc0000007-1491911889:529990..530273Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:529563..529809TCONS_00001152-exon-sc0000007-1491911889:529563..529809Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:529068..529314TCONS_00001152-exon-sc0000007-1491911889:529068..529314Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:528661..528945TCONS_00001152-exon-sc0000007-1491911889:528661..528945Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:528075..528387TCONS_00001152-exon-sc0000007-1491911889:528075..528387Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:527737..527979TCONS_00001152-exon-sc0000007-1491911889:527737..527979Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:525906..526084TCONS_00001152-exon-sc0000007-1491911889:525906..526084Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:525640..525749TCONS_00001152-exon-sc0000007-1491911889:525640..525749Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:524376..524473TCONS_00001152-exon-sc0000007-1491911889:524376..524473Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:524109..524237TCONS_00001152-exon-sc0000007-1491911889:524109..524237Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:523834..524007TCONS_00001152-exon-sc0000007-1491911889:523834..524007Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:523420..523689TCONS_00001152-exon-sc0000007-1491911889:523420..523689Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:522898..523060TCONS_00001152-exon-sc0000007-1491911889:522898..523060Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:522297..522523TCONS_00001152-exon-sc0000007-1491911889:522297..522523Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:521774..521990TCONS_00001152-exon-sc0000007-1491911889:521774..521990Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:521478..521629TCONS_00001152-exon-sc0000007-1491911889:521478..521629Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:518603..518726TCONS_00001152-exon-sc0000007-1491911889:518603..518726Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:517955..518402TCONS_00001152-exon-sc0000007-1491911889:517955..518402Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:517694..517832TCONS_00001152-exon-sc0000007-1491911889:517694..517832Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:516880..517104TCONS_00001152-exon-sc0000007-1491911889:516880..517104Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:516469..516693TCONS_00001152-exon-sc0000007-1491911889:516469..516693Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:516050..516223TCONS_00001152-exon-sc0000007-1491911889:516050..516223Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:515563..515719TCONS_00001152-exon-sc0000007-1491911889:515563..515719Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:515126..515310TCONS_00001152-exon-sc0000007-1491911889:515126..515310Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:514797..514913TCONS_00001152-exon-sc0000007-1491911889:514797..514913Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:514372..514518TCONS_00001152-exon-sc0000007-1491911889:514372..514518Clytia hemisphaericaexon
TCONS_00001152-exon-sc0000007-1491911889:513015..514211TCONS_00001152-exon-sc0000007-1491911889:513015..514211Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:513015..530703 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 1.11923e-08 1.04636e-06 0 0.0190943 0 0.0890043 0 3.04903e-10 0 0 0.247991 0.206349 0.198602 0.0342662 0 0.563398 2.95478e-09 0.614471 0.54437 0.263297 1.32282e-09 0.339044 0.245801 1.10862 0.000468523 0.905434 0.143807 0.161864 0.550144
Blast
BLAST of TCONS_00001152 vs. Swiss-Prot (Human)
Match: LRRK1 (Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 529/1817 (29.11%), Postives = 839/1817 (46.18%), Query Frame = 1
Query:  523 GHLEALKILAPKKFPLHVDDMPLKDSPIFYCCRYGHTELLSYIIEEIPGILSHKSFGGLGECPKTRYIQEWSELTRIIKKEEEVVIGTMLLFIACLLEHRDMVEFLI-KKGVGVNT-SLSKNQFYDYLS-PLSVACKTNNMEIIEFLWKNKAEITESIAIQNPEITGTLLERH---TQPYTRTYSVKTVIKDKTPPIEFKSFYWDNLNLHKIHFSWLEAYGNKVARVDIHSNKLSSLPINFFELLPNLEDLDISCNTITKLP----DDGVHDLRLTRIIACSNEITAIPLAFFLNPHISFMDFSKNKLLTLPSFSKDQSGTVSPNECFW-DCQNLKVLKLSRNLLTDLPKA-IHGAKGLEKLSLDENQFTSFETVWSCPLVELDISKNQLAQFSGMTKLVWSKXXXXXXXXXXXXXXXXXXXXHLQNLQYLDLSHNRISTLPPASNWKCSMLMKFDLSHNKFTGKSAYDGMAEKPFV---------------STCEFPAELFQHTLENLNLSDNDLQVFPDTICELTALQDLNLSRNHNLHTIPSTLGKLKNIWTLKLAELTIPELASFNLDDKNVAKDILPFLRAKLRKSESFNRMKLMIVGLQGRGKTTLLSVIQGKNLPENI---STVGITVEQFTLPLKSKLPGFLVSNQKPGIKFSAWDSAGQQVYYATHQCFLTSQTLYLVVFNVTHGRQGIIDLEPWLANIQARAKNSRCIIVGTHTDCMPSENKKQTLAGYEKEI-----HTRYYKKKGFPDIEGYLF--ISSVSGEGVEGMRQMIYNVAESMNS-----GSNTLTGAPNRKMAPRSYINLYDEILKEKDRRAKNFIPPILTTDEMLQLADQNPEDNDIFTVEELVLATRFLHENGIVLHFDDHLHELNNIFFIDPSWLVDMFALVVTIPECNRYAQSGYIERKMLIQILSENPRLPENFLPQYLRLLERFEIALCLDVQTQFLIPAMLPSDRPELTEQLERYIEIELANDSKHYCLNRTYHMSYIPAGFWSRLIARLMIAVQKWGMQISDEPTSETENYEHKV-------------------------WREGVMVTYDDGFYLVESFHDETQYPAWSNKGVSITVWSLEQDFSVMGFIVDHLDMLITEWYPGLEDVDNNGDCLVQKLITCPMCRKNRQDVLQNEIIGFRPINRYDTEYSHYFRDVQHVNQFYLLTCASAAISYKAILCEKHPQQYVDLSLVVPDLMLTDLPPYFVIDPGRFMFAPSEETRLXXXXXXXXXXXXXXECQ-VAVKQFHSTTKAKQFDTSMAEERDETDGISNVFKPTPQSTQ-EQLEDTKIIQAFWELRQEVSMLCRLQHANIIQFIGVCHSPLCFVIELAPQGSLQGILEKKQQQRDEHSDGLVSDSHMYGSILGRFISYKIAFQVIDALYYLHDSEIVYRDLKSDNVLVWSLDPNDVINIKLSDYGIATFSTPQGVIGEGGTHGFQAPEVRFSSPYDEKVDIFSFGIWLYELLSGYRPFRTFRTGSEMKKAILRGVRPNLRQDFINSDLPF--LECIMEDCWQQNPNSRPSSQELAMCLKQPDVCMLQNIYPPSDVLTLQKVRVAIPWTRSEKSAKEEEILIWSEYGADRRYQLIDIRNDKPSXXXXXREKILAGPRILCACQVENHVWLGNEGCQIEVFG-----QLSNQQR----PSILWKFSLAKLKYALDMKTYQHDGILKVFASLVDGHLCIFTKDLHSTSNSRPIFDETEEDIVQF------EKDKWDVQDLNLGTRGYPAKCMSLTRNNTELWVGSGSLIVIVDPHSNTIKEHIETTIRTNRLISLMTSDE 5715
            G LE ++ L  K+  + +   P  D+P      +GHT ++  ++E +PG            C   R +  W                  +L +AC   H  +V+ L+   G    + ++ KN+F   +  PL  A K+ N +I  FL ++ A     I + +P+ +  LL ++     P   +Y  KT ++ K          W +L L  +   WL     ++  +D+ +N L++LP      L NL  L++S N + +LP     D +   RL  I   SN+++ +P  F     +  +  SKN L  L  F ++       N   W   + L+ L +S N LT+LP   +H  K L  L++  N    F   W+CPL     S+N L        + W   L  ++ S N+L+ +   +  L  L +L L  N+++ LPP   W C  L   DLS N+  GK+  DG+  K                  S  EFPA     +LE L L+DN L   P ++C L +L +L L  N  L  +P  LG+L N+W L   +LTI  + +     K   K +L +LRA+LRK+E    MK++IVG   +GK+TLL ++Q    P+ +   +T+  T  +   P  S+        +   ++F+ WD  G       +QCF T + LY+VV+N+  G + + +L+ WL NI+A+A N+  ++VGTH D + ++ + + +A     +          +  GFPDI       IS  S EG EG+RQ+I++V  SM       G   L G    ++ PRSY++L + +L E+ RR+++     LT  ++ QL +Q P DNDI   E+L  A  FL E G +LHF D  H L N++F+DP WL +    +  I      A++G I R   +++L       +    QY + L +FEIAL +     +L+P +LPS +P L     R+     AN      + R + MS++P GFW R IAR++I++ +  +Q+  E    T++   KV                         W+EG++VT+D G+  VES   +  +    + G+ I   S  +DFS M FI DH++ LI +W+P L   +++G  L+++ + CP+C                      T+ S    DVQ+   F +  C   AI    I C +HP   V L  +VP+L +TD P    ++  +   +  E + LG GG+G V      + Q VAVK+FH     K+F                 F   P  T    L  T  ++ F E RQE SML  LQH  I+  IG+   PLCF +ELAP  SL  +L +  +           DS      LG  ++ KIA+Q+   L YLH   I++ DLKSDN+LVWSLD  + INIKLSDYGI+  S  +G +G  GT G+QAPE+R    YDEKVD+FS+G+ LYELLSG RP        ++ K + +G+RP L Q     ++ F  L+ +M +CW   P  RP +  +   +K P                + ++             +E  ++ W      R Y +++            +     G ++ C  QV+  +W   E  +I ++       L+  Q+    P+++  F        L +   + +  L V A L DG + +F           P+   T +D   +       + K+ + D +     YP K M +  + +E+W  +G  ++++D  S  I   +E  +  + + S++ S E
Sbjct:   98 GDLEMVRYLLSKRL-VELPTEPTDDNPAVVAAYFGHTAVVQELLESLPG-----------PCSPQRLLN-W------------------MLALACQRGHLGVVKLLVLTHGADPESYAVRKNEFPVIVRLPLYAAIKSGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYFIEASPLPSSYPGKTALRVK----------WSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWGLINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTASKNCLEKL--FEEE-------NATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFPDPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRLQGNQLAALPPQEKWTCRQLKTLDLSRNQL-GKNE-DGLKTKRIAFFTTRGRQRSGTEAASVLEFPA-FLSESLEVLCLNDNHLDTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQLDTEDLTISNVPAEI--QKEGPKAMLSYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQTGRAPQVVHGEATIRTTKWELQRPAGSR-------AKVESVEFNVWDIGGPASMATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG----RLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTP-DNDIKDYEDLQSAISFLIETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVI-RAEDLRMLLVGTGFTQQTEEQYFQFLAKFEIALPV-ANDSYLLPHLLPS-KPGLDTHGMRH---PTANT-----IQRVFKMSFVPVGFWQRFIARMLISLAEMDLQLF-ENKKNTKSRNRKVTIYSFTGNQRNRCSTFRVKRNQTIYWQEGLLVTFDGGYLSVES--SDVNWKKKKSGGMKIVCQSEVRDFSAMAFITDHVNSLIDQWFPALTATESDGTPLMEQYVPCPVCETAWAQ---------------HTDPSEKSEDVQY---FDMEDCVLTAIERDFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRARYQGQPVAVKRFH----IKKFKN---------------FANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIVALIGISIHPLCFALELAPLSSLNTVLSENAR-----------DSSFIP--LGHMLTQKIAYQIASGLAYLHKKNIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKVDMFSYGMVLYELLSGQRPALGHHQ-LQIAKKLSKGIRPVLGQP---EEVQFRRLQALMMECWDTKPEKRPLALSVVSQMKDPTFATF-----------MYELCCGKQTAFFSSQGQEYTVVFWDGKEESRNYTVVNTEKG----LMEVQRMCCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKGMCPLNTPQQALDTPAVVTCF--------LAVPVIKKNSYL-VLAGLADGLVAVF-----------PVVRGTPKDSCSYLCSHTANRSKFSIADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVVCSSE 1744          
The following BLAST results are available for this feature:
BLAST of TCONS_00001152 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LRRK10.000e+029.11Leucine-rich repeat serine/threonine-protein kinas... [more]
back to top