Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001100 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001100
Unique NameTCONS_00001100
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2192

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001100 ID=TCONS_00001100|Name=TCONS_00001100|organism=Clytia hemisphaerica|type=transcript|length=2192bp
AAGTGAAAGGCTCCCGTAGCCGTAAAGACCTGTACATAAATCAATCTGTG
GGTTGGTTGGTTGTGGATGGTGGAAACTGCAAACTTTTCGTCTAAATCAA
ATATGTGATGCACAACAAAAAAAGATATAATTCAACAAAACCAAATGAAT
GTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAAGAAATAGAAATG
ACAAATGGTGATCaagttgaagatgaagaagCAGAAGAAGAAAACATTCT
TTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCAATGATAAACTTG
TTGTTGGACAGTCATGgTACATGTTAGATAAACATTGGTACAAACAGTTG
AAGAAATATATAGAAATTGGTGCTGATAATGTAGATCCTGAGAGTGAAAA
CCCTGGACCTATTGATAACACACCATTGTTTGAGACTGcTTCACAGAATG
TTAGAGAACACCTTCTTGAAGGATCAGAATTCAAGTTGATCAATAAGCGT
GGTTGGAAAAGATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCC
ATTACAACGTACTGTGATTGAGCATGGCATATTCCGAAAAGAAGCAAAAG
TTGAGATTTACCCTCTACGActtcaaatttgtttatttaaaaacttggaa
aatgaaattgttaaaATGATCAGCAAAACAACTACTCTAGATATTGTTGT
GAAAATTATGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAGGTCAGAC
TATGGAGTAAGTTCATGCAAAATACATATGAACTTCTGCTTATCAACCAG
GCAAAACCAACAACTTTGCAAGATCATGGCATCAATAGCGGTCAAACACT
TGTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCCTCGACAAACAAGAA
CAAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGAATGTAACTAATTCG
CCCTCAGAATCATCATTTTCTAGtgCAAGCAACTACTCATCCTATTCATC
ATATCAACGTCAGCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGA
GCAATCTTGGCAACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGC
AATACTACACCTCTGATGAAGTATTTCCTTGCAAATACACACAAGTCTGA
ATTAAACCCAACCAATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGTT
ACGCTGATTTGATGCATCAAATGTGGAGTGGAAACCAATCACATGTCTCT
CCAAGACAGTTCAAGATGACTGTTGGGAGATTCGCTCCACGGTTTTCCGG
CTACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATTGGATGGTC
TCCATGAAGATTTGAATCGTGTCAAACAAAAGCCATACATTGAAATCCCT
GATGATAAAGGCAGAGCAGACGAGGTATTAGCACAAGAAGCATGGACCAA
TCACTCCAAAAGGAACGATTCCGTCATCACCGACAATTTTCACGGATTGT
TCAAATCAACTGTGGAATGTCCAGAATGTGGAAAGCGTTCCATCACCTTC
GATCCATTCTGCTACTTATCGTTACCGCTGCCAATCAAACGTGAACGGAC
GTTGAAAATCACTTTCGTTCCCATCGATCACTCAAAACGCCCAATACAAA
TGAAAGTGACCATTCCCAAGCTAGGACAAACGATCGCCTTATGTGAGGCT
GTTTCCAAATTGACTGGTGTTGAGCCAGATAAGATGATAATCACAGACGT
CTTCAATTCCAAATTCCACAAGCGATTCACTCGAAATGAAAGCCTCAGTC
AAATCACAGATAAAGATGACATTTTTGTcTACGAAATACCAGTGCGCATT
AAGGAGATCGATGAATCTAATTTAGCTGTCGTTCCAATCTACATGAAAAC
TGTTGTGGCAAGGAGTACGTATTCATCATATCCTAGTACTTCTTTGTTTT
GGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACGAT
GTCTATCATATTATCATCAAAGCCATgagACGATTTGTAAAAGTTCCGAA
GGTGGAAGTGAAGGAGGAGGTGAATGAAgtggaaagtgacgaaaaagaAG
TCAACCAACACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCTCTAGAA
AAAGACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTAATC
Run BLAST on NCBI

protein sequence of TCONS_00001100-protein

>TCONS_00001100-protein ID=TCONS_00001100-protein|Name=TCONS_00001100-protein|organism=Clytia hemisphaerica|type=polypeptide|length=695bp
MHNKKRYNSTKPNECRMTINTSSVDSEEIEMTNGDQVEDEEAEEENILFA
KQKELLHSDVNDKLVVGQSWYMLDKHWYKQLKKYIEIGADNVDPESENPG
PIDNTPLFETASQNVREHLLEGSEFKLINKRGWKRLLTQFGLAEGQEPLQ
RTVIEHGIFRKEAKVEIYPLRLQICLFKNLENEIVKMISKTTTLDIVVKI
MKEGLGIPEDEEVRLWSKFMQNTYELLLINQAKPTTLQDHGINSGQTLVL
EQKNEENKWPRQTRTRSVSGSSSSAMNVTNSPSESSFSSASNYSSYSSYQ
RQHSTTYKPGLCGLSNLGNTCFMNSALQCLSNTTPLMKYFLANTHKSELN
PTNPLGMNGKVAEGYADLMHQMWSGNQSHVSPRQFKMTVGRFAPRFSGYQ
QQDSQELLAFLLDGLHEDLNRVKQKPYIEIPDDKGRADEVLAQEAWTNHS
KRNDSVITDNFHGLFKSTVECPECGKRSITFDPFCYLSLPLPIKRERTLK
ITFVPIDHSKRPIQMKVTIPKLGQTIALCEAVSKLTGVEPDKMIITDVFN
SKFHKRFTRNESLSQITDKDDIFVYEIPVRIKEIDESNLAVVPIYMKTVV
ARSTYSSYPSTSLFWRPMLVVVPKKAANADDVYHIIIKAMRRFVKVPKVE
VKEEVNEVESDEKEVNQHQEVDGDGPTPPLEKDQDEAGTFSTFLI
Run BLAST on NCBI

transcript from alignment at sc0000007:165814..176071-

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001100 ID=TCONS_00001100|Name=TCONS_00001100|organism=Clytia hemisphaerica|type=transcript|length=10258bp|location=Sequence derived from alignment at sc0000007:165814..176071- (Clytia hemisphaerica)
AAGTGAAAGGCTCCCGTAGCCGTAAAGACCTGTACATAAATCAATCTGTG GGTTGGTTGGTTGTGGATGGTGGAAACTGCAAACTTTTCGTCTAAATCAA ATATGTGATGCACAACAAAAAAAGGTTGGAGCTCATGTATTTTGTAAGGT TTCAGAATTTCAATTTCTTATTACTTCATCTCATTGATCTTTCTCTTTTC CATTTCAAAAGTTGTTTAGGCGATAATAACTAATATACAGTATATTTTTT TAATGTTGACAACATCATCATAGGTACTGAATTTACTTTCGCTTTCAGTC AGTGGTTTTAATTTTGATTTAAGCCAACATCTAAGCAACAGGGTGCTTGC CTATAGCATCGAGTAACACTAGCATCCCGGGGAATTGGGTATAAGATTTA ATGCTGCAAAAGCCACCACTAAGTCTAAGACACTTTAATTGTTTATTTAC TTCACTACTGTTAACTCACAAGCAAAAGAATTTTTTTTAATTTTTTTTTC TATTTGGTTGAGTTGCAGGAGGCTTTAGAGGCCTATTCTCGCAACTATAG ACGCTTACTAATGAACGGGTTGACCCGGGCGAAGGAACGTTCACTTGCCA ATGTGAACTGATGCCGTGAGTGGGAATGCCAAGGTCGACTACCACTATAC CACGGCACCTATATAATGCACTGCAAAACTTTTAGAGAAAGGGGCCAATT ATTTTACATTTGATTGGCAAAAATTTTGCAATACACCATTTAGGAGTCTC GCCTCCTCCACCGTGTTCCAGCGTGAAAACGGTAGGTAAAAATGCGCACT TTAGTACTGTGGAAGGTTAGAGGAATGTAAACATTGTCAATTTTTTTCTT TCCTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNTGAACATGATATCAATGATAATTTTATGGATCTCTCCTGAAAATTTCA CAAAAATTCATCTAGAGGAAAAGAAGTTATGATTAAAAGGAGTTCCTTAC CTACCGTTTTTCTGCTGGGTTTCCTTATGAAAACCAAATTTTTACCTACC GTTTTTTTACGCTCTCCCCCGTAGTTTACCGCGATCGCTAATATCAAAAC AATGGAAAATTGTTTGGAAGTGTGCGCAGTCGACACTACTAAACGGTGTA TTGGGGTATAATTTTTTAAACATAAATGCCAAATAAAAAAGATGTGGTGG TGAATCTGTCCATTCTTGGAACTTTTGGAACTTACCTCCATAGTACAAAG GGCTATTCGACTCTGATTCCATCATGTCTGTAACATACAGGGGGGGGCGG ACTACACAGAATTTCTGAGGGAAAAAGTTTTCACCAAAATCCCAAGGCAA GAGAAGAAAATGTATGAATTTCTAGAGGCAATTGAATCAAAAACGGCAAA AAAGAGTGGAATTTCCAACACATTTTGCGAAAGTATGTGGATTTCCATTG GAATTTCCGACCACCACAGGAGAAAAAAAATTTCCAAGGGTAGAAAACAT TAATAAATGTAAGTCGCTCGACGAGGAAAACAAAGTTTCTAGGGTGGGCC AAAACACTGTTCCCATAAGACCTGGTGTTCTTTTTCCTTTCAAATGCCAA TTTTTTGCACTTTTGGCAAAGATTTTGAAAAATGAAGACCTTCCAAAATG CTAAAACAAAACAAGGCCCGCCAATCGGCAATTTGATTGGTAAAAAAAAC GCCTGCACGTGTAAACACTTCGCCCTCCACAAACAACCAACAGAAAAACT GCTGACGAAGCATCATGATAACTGAAATCAAGGCGGCATAGCGATGTAGG ATTTTGCCACAAATCTGTGATCTTTTGACATTAGAATTTGGATTTGGCAA AGCTGGTGTGTATATGGCAAATAAGTTTCTCAATCGAAAGGGCTGAATAA ATAAAGTAGATGAAAAACTGAAAAAATTTCTACCCTGAAAATCTTCCAAA ATAGCCAAAAATAGTCCCTGTCAGATACACTCTTTGAAAATTAGTAAATT TGGGACCCTGTATTCTTTGGGACCTTAAAAAAGGGACCCTGACCAGCGGG ATGTCTCGTAGCCAATTTTAACCAATCCCCCCCTGGGACCCAGTGTAAAT TTGATTATTTTTCAAAAGTGCACATAACATGCTAATTTGATCTTGAAATC AAAAGCTGCAAAAGGGGAATCAAAATGAGAACTTCATCTTCTGTAAAATT ATCTTCTTTTTGCTTCAATAAGTGAGAAAAAATGACCCATGGGAAAAAAT TCATCAATCTAATCTCTACTGTAGACTGTGTCAATTGAATGTAATGAAAC GTAATTGAAAGATGGTTATTTGATTGTCCATCTCAATTGAACATAAAGTT ATGAAGGGGGCTCTTTAAAAAGTAGGTAGGCCCTGAGAGGGATGATGGGG AGGGTACAACCAAAAGTGTATGAAAGTATAGGAGATTTTTAATAGAACGA AAAATCCAACCAAAGTTTGGTTAGCTATTGTGATTATTTCATTAACAAAG CGCGTTCGGTTATCGGACACTGCCCTTCCCAAATTCACTAAAATTTCGGT AAAAACAGCCTTTTTCTAAAATATTGCCTGACGGGGGTAATATTAAAGGC GTACATATGCTAAAAGGGGGTAATACCAAAGCTTACGAGAGCGTACAAGA GGGATGGGGTAGTTGATTTTCACTGATTTTGAGCATAGTACTTTTTGAAT GGTCCCAAGGGTCAGAAAGTTGAGGATTTTCCTTTCTGTTTTCAAACATT TTACCAAATCGATCCCAAATTTAGTATATACCTGGACTTGCTTGAGAGAT ATACACAACATTATTATAGTCAGTATCTTCGATGAATTATATGGTTATGT CTGAGAAAAACAAGTTCCAAGCTGTAAATCAGCCATTAAAACATCAAAAA CTGGCTGTGAACAAAGTTTACCACTTGTATTCTCAGACTAACTGTTACTG AACTACTAAAGATATTTCTTTATTTTATTTACAGATATAATTCAACAAAA CCAAATGAATGTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAAGA AATAGAAATGACAAATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGAAG AAAACATTCTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCAAT GATAAACTTGTTGTTGGACAGTCATGGTTAGTTTAATTTAACCATCTTCA TTAAGGGACATAAACAAGCTGCATATTCAAAATTTGCAATAGCATGTCTG TTTTCATCACTAAAAAGTTGTACCAACTACAGTTCTTACAGTTCCCTGTT CACCATATCCATTGCAAGGTGTATAGCACAAACTTCAGATTTCTAGCAAA CTAAACTGAGATTATTCATTGTTGCTGTATGCCCAATTTAAATTTTTAGG TACATGTTAGATAAACATTGGTACAAACAGTTGAAGAAATATATAGAAAT TGGTGCTGATAATGTAGATCCTGAGAGTGAAAACCCTGGACCTATTGATA ACACACCATTGTTTGAGACTGGTATGGAATTAATTATATCAGATCTCTAT CAAAAGGGAAATATTCAAAATTCATTGTCTAGGGTTTTAAGCACAACCAG TAAAAGAGTGGTATGATGTGTCAAAAAGGCACATAATACACATGATAATC ATACCATGGAGTTGCTTGGCTACCTGTAGAACCCTTTATTTAAGTCAACC CCTTCCAAAGATACGAAATTGCTTTTAAACAAAGGTTTTTTAGCATTTTT GTGTTTACCACAATATTTTACCAGGAATTCCACAAATATTTCTTTTTTTT AGTTAATTCAACTTGAAGTTTGGTATAATAATATAGGTGATTTTGAATAG AAAATAAACCTAAACCATTTCTTTTTGCCATCCCAAAAATCACTAAAAAG AGCCCAACAACCTTTGATACTTCTAGGTATCAAACAAAATTTTGTGTTAT GATTGTTAGCTGTAATTGAACAATTAGTAAATGCACTTTCATTTTTACAG CTTCACAGAATGTTAGAGAACACCTTCTTGAAGGATCAGAATTCAAGTTG ATCAATAAGCGTGGTTGGAAAAGATTACTCACACAGTTTGGTTTGGCTGA AGGCCAAGAGCCATTACAACGTACTGTGATTGAGCATGGCATATTCCGAA AAGAAGCAAAAGTTGAGATTTACCCTCTACGACTTCAAATTTGTTTATTT AAAAACTTGGAAAATGAAATTGTTAAAATGATCAGCAAAACAACTACTCT AGGTAATTTTGATTGGGTTTCAGAAAACTTTAACTCAAAATTGATTTCTT TTTACAAAATACTTTTATCACTTTTTCTGCTAAATAAATCTTTAGTTTAC ATAATAAAGTGTCACAGAAAGTTATTAACCCCCATCCTTACTATTATAAT CAATATGGCTTAAAAGTACCTCAGATACATAAGGTTTTTTTATCAAAAAT ATTGTTTGCTGTCTATTTTTCAGATATTGTTGTGAAAATTATGAAAGAAG GTCTAGGTATTCCAGAAGATGAAGAGGTCAGACTATGGAGTAAGTTCATG CAAAATACATATGAACTTCTGCTTATCAACCAGGCAAAACCAACAACTTT GCAAGATCATGGCATCAATAGCGGTCAAGTATGTGAATTACTTGTGGATG ATAATCAATTATTAAATTTTTGATCTACAACACTCTGAATAAGTTAACAC TTTTTGATAAATGTTAGATGAGGTGATTAATTTTTCAAACTCTTTGAAGA AAAAAAGAATTTGAACCTTTTTGCATACTCTTATTGTTGGTGTCTGGTTG CAATGATTTCTTGGGATATAAGTGAATTTGCAAGCTGTGATCGTTTTTTC CAAAATCTGATGTCAATATTCTCAAATCAATCTAAGCACAAGAAAAAGGT AGCTCTGATGAACAGTCGTCATGCTATTGGGCCCTTCCATACCAAAAATA CATGGGGGTAGAGGAAAATAACATTCTTCAAGAGTTGGTCCCCTACATAG AGTCTTGCCCCCTCCCCAGTCCCTGGGCAAAGAATTTCGACCCCAAAACA AACCCCTCAGACAATCAGTTTAACCTCCTAAACGTTTTTCCTGCCCCTTG AAGTTATAAATTTACCTCCTTGACACAGGTAATATATAACATTTTTGCTA CCACAAATATATCCTCCATCCCCATGTGCAAACATTTTCTGGAAGATCCC ACTTTTACAAATGCAAAAATGTACTTTTCTTTATCCTATAAACAAATTTT TTTATCACATCAGTTTAATTATCTTCAGACTTATATTTTCATCCTCAGGC TAAAAACAATAAGTAAAAACAAGTTAAAACCATTGAAATTTCGATTCATG ATTCTAGTATTAATGAACCTCAAACTTTTTTTAACTTTTTCTCCTTTAGA CACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCCTCGACAAACA AGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGAATGTAAGTTT TTCCGTCTTCAGGTACTTAAAGGTAAGTGTGTTTTGGTCAAAATTTGACC AGACTGGAAAACAACTTAAAATTAGTAAAAAAAATTGTCAATTTAAAAAT AAATTGGTGACAAATCAAAGCAAAAGCTTGCTTGAAGATAACCCAATCTA AATTATGAAAGTTCTTGCCACTTCTAGTTTTATTTTTGGTTTTACCAAAT TAAATTTTACCAAATATTATCTTGTTTTTAGGTAACTAATTCGCCCTCAG AATCATCATTTTCTAGGTATGTTTCATCAAGTTATCATGCATAACAGGTC GAATCGAGTATTATACCGTCGTTTTGCATAACATTCCCTTTCCCCCACTA AGATTCTCTTTTCCTGGATTTTCCGCTATTTTTCCTGGGTTAGTCGACAT GAGATTGCCATTAATGCTCAAAAAACTGCCAGGTGCCCTTCCAAATTTTT ACTTTTGACTTTTTTTAGTGCAAGCAACTACTCATCCTATTCATCATATC AACGTCAGCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGAGCAAT CTTGGCAACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGCAATAC TACACCTCTGATGAAGTATTTCCTTGGTGAGTTGCTTTTCCTTTATGTTG TTTCTTTCACAAACTAAGCACTATAGCTATAGGTCCAGTACTTTTGAGGA TAGAGCTTATAATATAAGGTGCTGACTATTAAGTATTAATTATTACCAAA ATTGTTCATTTATTTCACTTTAGCAAATACACACAAGTCTGAATTAAACC CAACCAATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGCTGAT TTGATGCATCAAATGTGGAGTGGAAACCAATCACATGTCTCTCCAAGACA GTTCAAGGTTATTTTCTAAAAGCAGATAAAAACATTTTCTTTGTTTTCGT ATTTTGTAAATGCAAATTGATCTGAATTGATCTGAATAAGCTTTTCTTGA TCTTACTTGAACTTTTTATCCCAAAATAATTGCTGTGGGTTGTTCAATAC TGAATTGATGAAATTGCATGGCTCCGAATGGGGTTCTAGGTCCCCCCAAC AAATTTAAGTCCCCCCTACGATTTAGGTCCCCCCACTTTTCAGTAAGGTT CAGGTCCCAGTTGAAATATAAAGGTTCAGGTCCCTGCAAAAATTGCTTTC AAGGTTCAGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCAGATAAAAACAT TTTCTTTGTTTTCGTATTTTGCAAATGCAAATTGATCTGAATTGATCTGA ATAAGCTTTTCTTGATCTTACTTGAACTTTTTATCCCAAAATAATTGCTG TGGGTTGTTCAATACTGAATTGATGAAATTGATGATGCCAAATATCTGGA TTTTGTTGAGCTGTGAAATTTATCTGATGAGAACATTAATTGTATTTAGA TGACTGTTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAACAGCAAGAT TCCCAAGAACTTCTTGCTTTTTTATTGGATGGTCTCCATGAAGATTTGAA TCGTGTCAAACAAAAGCCATACATTGAAATCCCTGATGATAAAGGCAGAG CAGACGAGGTTTGTGAAAAATATTGCTACTCAAAAGTTCGGACGGCTATG TTTCAAGCTTGAAATTTCTGGACACCCTTTAGATTTTTATTAACTAAATA TTAATATTGTTATGAGCTTTCCTGAGATTTGCCCTCATAACTTCTACAAA TTTTGTCTTGATTCTGAATAATGCACTCCGTCTATGTTTGCTCGTGTAGG TATTAGCACAAGAAGCATGGACCAATCACTCCAAAAGGAACGATTCCGTC ATCACCGACAATTTTCACGGATTGTTCAAATCAACTGTGGAATGTCCAGA ATGTGGAAAGGTATTTTGTGATATTTTGGAAACTTAAGAACAAATTTAGT GAATTAAAAGGTAGTTGAGTGATCTACAACTTTTTAACATATTAATTTAT TTATCCATGACTCTTTCTTTTTCAGCGTTCCATCACCTTCGATCCATTCT GCTACTTATCGTTACCGCTGCCAATCAAACGTGAACGGACGTTGAAAATC ACTTTCGTTCCCATCGATCACTCAAAACGCCCAATACAAGTGAGTGAGGG ATGAATTAACCATTCCATCGTGATAATATTCATTGGACTCTATTCCTAAC GTCCGCTGTTTCATTGAATGGGGTCATTATAAGAAGGGGCGATTGAGAGG GAACTACCAGAAGCGGGATGAAGAGGGTTAGATAGAAATATATGAAAGAA AGAAGTTGAATTCCCCAAAATCCCCCAATTATTTTGTATAACTTAATATG ACCAAATTTAATTAATTTCTGGAGAACGTTATTTTCGAAAGCGTAAACAC GCGTATAGAATATGAGGCCAAAAGATATAAGAGTGTATAAAAAAAAGATG GTTATAGTTCACAAATTTTGAGCATTTTTATTTTTCAGATGGTCCCTTTG TGACTTTCTAACGAAAAATTCTGACGTCAATCATTCAAAATATAATGTGA CGTCGTTGCAAATTTTCGGATTTCAGAAGGCGTGGCACTTTCTAAAAATA ATTACTAAAAATGAGTTCTTTATGTCAACTTCAAATTCGCAAAAGAGAGC AAGACTTTTACCGTTCTTTTCAATTCTTTTCACTGATCATACAGTTAACG CTCTCCAATTTGATGTTTGATGTTTGATGTTTACTGGTTTCAATTTAAAT TGAAATGAACTTCAAACTTCCTAGGCTGATGGCATCCACTAACGGATTCG TGCTCATTTTCGGTTTTGTAGAGGTCTGCAATTCAGACTACAAACTTCCG GAAGATACTAATTCGAATTCCCCTTATAGATAGAATTAGTGACCATTAAC AATACCATCTTTATCATCCTAAGGGCTTCTGATGCGCAAGCTAAACCGAC ATTTGCGACAACGAGAACCGTCTAGTTTACCACTATTCTTTTTTTAGATG AAAGTGACCATTCCCAAGCTAGGACAAACGATCGCCTTATGTGAGGCTGT TTCCAAATTGACTGGTGTTGAGCCAGATAAGGTAATTCTTTTCACGTGAC AGAGAGAGTGGAAAGTTTCTGCTAAAATGTCTTTATAATGAACTAGATTC TACTGATTGATGCTGTGAAACTCCGCCTTTGAAATAGCTAGCTTATGAGA TCAAGACTTTAAGTTATCGGCAATCCTAGAATTAAACTAAATTAGACGTG GCACTTCTGTACATAAATGCTGGTGAAACAGTACCCACAAGATTTGCATG TACAAACTTCCTTTCGATTCTGAATTTCTCATTTAGATGATAATCACAGA CGTCTTCAATTCCAAATTCCACAAGCGATTCACTCGAAATGAAAGCCTCA GTCAAATCACAGATAAAGATGACATTTTTGTGTAAGATTTTTTCTCTTGC TTGACTTTACAATGTAACCAGATGAAGAATTAAATTTGATTAAGTTCTGT AATTGAAAATTGCCATAGTCATAGCCATAGTAAGGTCTTTGTGGCCAAGC AATTCTAATAAGCCTTAATTGGTTATTACTGCGAGATGGACGATACAACG AAGGAGTTTACATTTCATGCCCAGGCTCCATTACTATGATTAGACGTTTT GACATACTACGTTTTTAGCAGTACATCTTTTTCTTTACTTTTAGCTACGA AATACCAGTGCGCATTAAGGAGATCGATGAATCTAATTTAGCTGTCGTTC CAATCTACATGAAAACTGTTGTGTGAGTACCCTAAGCATTGTCGTGCTGC TCCTAAACATGCCTTACCTTACCGCGGTGGACATCTAGCCCGGATGGTTT GGCGATCTTGTTGCTTGAACCCAATGTCAGCTTTAATTTGATCGATATAA AGGTTTTTCGTGACCTTCCTCAGTTTGTCTTCCTTTGTTGTTTGTTATCA TTTGGATACCGTTAAAGCATATCACTGAAGGGGTTCACTTCTGAAGCAGT GTCCGGGAAAGACATATATTAACTTGCCTGACTGTTTTTTTCTCGATACT TCTTCTTTTTTGGTGTTTCTTTTGTCACTATAGCTCTTCTTTTTAGGGCA AGGAGTACGTATTCATCATATCCTAGTACTTCTTTGTTTTGGCGTCCGAT GCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTCTATCATA TTATCATCAAAGCCATGAGGTACACATTTTTTATGCTCTTCCAATCCAAC GAAAGCAAGACTTCTTCTTTGGTTACTGTAAGCAACATAATATACTCACA GGTTTTCAGCATCTGCAGAACGAATCCGTTTGAGACCTGATGATCTCCAA AAATCAATTGCCTTACAAAGACGAACGATAAACGTCCTGGGTAAAGAGTA CTTTGCATTTTCTTGTAATGAACTTGTTTTACTTTTTTTTACCAGACGAT TTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAGTGGAA AGTGACGAAAAAGAAGTCAACCAACACCAAGAAGTTGATGGTGATGGTCC AACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTCTACGT TTTTAATC

Coding sequence (CDS) from alignment at sc0000007:165814..176071-

>TCONS_00001100 ID=TCONS_00001100|Name=TCONS_00001100|organism=Clytia hemisphaerica|type=CDS|length=35445bp|location=Sequence derived from alignment at sc0000007:165814..176071- (Clytia hemisphaerica)
ACGATTTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAG
TGGAAAGTGACGAAAAAGAAGTCAACCAACACCAAGAAGTTGATGGTGAT
GGTCCAACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTC
TACGTTTTTAATCGGCAAGGAGTACGTATTCATCATATCCTAGTACTTCT
TTGTTTTGGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGC
TGACGATGTCTATCATATTATCATCAAAGCCATGAGCTACGAAATACCAG
TGCGCATTAAGGAGATCGATGAATCTAATTTAGCTGTCGTTCCAATCTAC
ATGAAAACTGTTGTATGATAATCACAGACGTCTTCAATTCCAAATTCCAC
AAGCGATTCACTCGAAATGAAAGCCTCAGTCAAATCACAGATAAAGATGA
CATTTTTGTATGAAAGTGACCATTCCCAAGCTAGGACAAACGATCGCCTT
ATGTGAGGCTGTTTCCAAATTGACTGGTGTTGAGCCAGATAAGCGTTCCA
TCACCTTCGATCCATTCTGCTACTTATCGTTACCGCTGCCAATCAAACGT
GAACGGACGTTGAAAATCACTTTCGTTCCCATCGATCACTCAAAACGCCC
AATACAAGTATTAGCACAAGAAGCATGGACCAATCACTCCAAAAGGAACG
ATTCCGTCATCACCGACAATTTTCACGGATTGTTCAAATCAACTGTGGAA
TGTCCAGAATGTGGAAAGATGACTGTTGGGAGATTCGCTCCACGGTTTTC
CGGCTACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATTGGATG
GTCTCCATGAAGATTTGAATCGTGTCAAACAAAAGCCATACATTGAAATC
CCTGATGATAAAGGCAGAGCAGACGAGCAAATACACACAAGTCTGAATTA
AACCCAACCAATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGC
TGATTTGATGCATCAAATGTGGAGTGGAAACCAATCACATGTCTCTCCAA
GACAGTTCAAGTGCAAGCAACTACTCATCCTATTCATCATATCAACGTCA
GCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGAGCAATCTTGGCA
ACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGCAATACTACACCT
CTGATGAAGTATTTCCTTGGTAACTAATTCGCCCTCAGAATCATCATTTT
CTAGACACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCCTCGAC
AAACAAGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGAATATA
TTGTTGTGAAAATTATGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAG
GTCAGACTATGGAGTAAGTTCATGCAAAATACATATGAACTTCTGCTTAT
CAACCAGGCAAAACCAACAACTTTGCAAGATCATGGCATCAATAGCGGTC
AACTTCACAGAATGTTAGAGAACACCTTCTTGAAGGATCAGAATTCAAGT
TGATCAATAAGCGTGGTTGGAAAAGATTACTCACACAGTTTGGTTTGGCT
GAAGGCCAAGAGCCATTACAACGTACTGTGATTGAGCATGGCATATTCCG
AAAAGAAGCAAAAGTTGAGATTTACCCTCTACGACTTCAAATTTGTTTAT
TTAAAAACTTGGAAAATGAAATTGTTAAAATGATCAGCAAAACAACTACT
CTAGGTACATGTTAGATAAACATTGGTACAAACAGTTGAAGAAATATATA
GAAATTGGTGCTGATAATGTAGATCCTGAGAGTGAAAACCCTGGACCTAT
TGATAACACACCATTGTTTGAGACTGATATAATTCAACAAAACCAAATGA
ATGTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAAGAAATAGAAA
TGACAAATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGAAGAAAACATT
CTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCAATGATAAACT
TGTTGTTGGACAGTCATGATGCACAACAAAAAAAGACGATTTGTAAAAGT
TCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAGTGGAAAGTGACGAAA
AAGAAGTCAACCAACACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCT
CTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTAATCGG
CAAGGAGTACGTATTCATCATATCCTAGTACTTCTTTGTTTTGGCGTCCG
ATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTCTATCA
TATTATCATCAAAGCCATGAGCTACGAAATACCAGTGCGCATTAAGGAGA
TCGATGAATCTAATTTAGCTGTCGTTCCAATCTACATGAAAACTGTTGTA
TGATAATCACAGACGTCTTCAATTCCAAATTCCACAAGCGATTCACTCGA
AATGAAAGCCTCAGTCAAATCACAGATAAAGATGACATTTTTGTATGAAA
GTGACCATTCCCAAGCTAGGACAAACGATCGCCTTATGTGAGGCTGTTTC
CAAATTGACTGGTGTTGAGCCAGATAAGCGTTCCATCACCTTCGATCCAT
TCTGCTACTTATCGTTACCGCTGCCAATCAAACGTGAACGGACGTTGAAA
ATCACTTTCGTTCCCATCGATCACTCAAAACGCCCAATACAAGTATTAGC
ACAAGAAGCATGGACCAATCACTCCAAAAGGAACGATTCCGTCATCACCG
ACAATTTTCACGGATTGTTCAAATCAACTGTGGAATGTCCAGAATGTGGA
AAGATGACTGTTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAACAGCA
AGATTCCCAAGAACTTCTTGCTTTTTTATTGGATGGTCTCCATGAAGATT
TGAATCGTGTCAAACAAAAGCCATACATTGAAATCCCTGATGATAAAGGC
AGAGCAGACGAGCAAATACACACAAGTCTGAATTAAACCCAACCAATCCA
CTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGCTGATTTGATGCATCA
AATGTGGAGTGGAAACCAATCACATGTCTCTCCAAGACAGTTCAAGTGCA
AGCAACTACTCATCCTATTCATCATATCAACGTCAGCACAGCACCACTTA
CAAACCTGGCTTATGCGGCTTGAGCAATCTTGGCAACACTTGCTTCATGA
ATTCAGCACTACAATGTTTGAGCAATACTACACCTCTGATGAAGTATTTC
CTTGGTAACTAATTCGCCCTCAGAATCATCATTTTCTAGACACTTGTGCT
AGAGCAAAAGAATGAAGAAAACAAATGGCCTCGACAAACAAGAACAAGAT
CTGTCTCTGGATCCTCGTCTTCTGCGATGAATATATTGTTGTGAAAATTA
TGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAGGTCAGACTATGGAGT
AAGTTCATGCAAAATACATATGAACTTCTGCTTATCAACCAGGCAAAACC
AACAACTTTGCAAGATCATGGCATCAATAGCGGTCAACTTCACAGAATGT
TAGAGAACACCTTCTTGAAGGATCAGAATTCAAGTTGATCAATAAGCGTG
GTTGGAAAAGATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCCA
TTACAACGTACTGTGATTGAGCATGGCATATTCCGAAAAGAAGCAAAAGT
TGAGATTTACCCTCTACGACTTCAAATTTGTTTATTTAAAAACTTGGAAA
ATGAAATTGTTAAAATGATCAGCAAAACAACTACTCTAGGTACATGTTAG
ATAAACATTGGTACAAACAGTTGAAGAAATATATAGAAATTGGTGCTGAT
AATGTAGATCCTGAGAGTGAAAACCCTGGACCTATTGATAACACACCATT
GTTTGAGACTGATATAATTCAACAAAACCAAATGAATGTAGAATGACAAT
CAATACCTCTTCAGTTGACTCTGAAGAAATAGAAATGACAAATGGTGATC
AAGTTGAAGATGAAGAAGCAGAAGAAGAAAACATTCTTTTTGCAAAGCAG
AAAGAACTACTCCATTCTGATGTCAATGATAAACTTGTTGTTGGACAGTC
ATGATGCACAACAAAAAAAGACGATTTGTAAAAGTTCCGAAGGTGGAAGT
GAAGGAGGAGGTGAATGAAGTGGAAAGTGACGAAAAAGAAGTCAACCAAC
ACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCTCTAGAAAAAGACCAG
GATGAAGCTGGTACCTTTTCTACGTTTTTAATCGGCAAGGAGTACGTATT
CATCATATCCTAGTACTTCTTTGTTTTGGCGTCCGATGCTGGTTGTTGTC
CCTAAAAAGGCGGCAAATGCTGACGATGTCTATCATATTATCATCAAAGC
CATGAGCTACGAAATACCAGTGCGCATTAAGGAGATCGATGAATCTAATT
TAGCTGTCGTTCCAATCTACATGAAAACTGTTGTATGATAATCACAGACG
TCTTCAATTCCAAATTCCACAAGCGATTCACTCGAAATGAAAGCCTCAGT
CAAATCACAGATAAAGATGACATTTTTGTATGAAAGTGACCATTCCCAAG
CTAGGACAAACGATCGCCTTATGTGAGGCTGTTTCCAAATTGACTGGTGT
TGAGCCAGATAAGCGTTCCATCACCTTCGATCCATTCTGCTACTTATCGT
TACCGCTGCCAATCAAACGTGAACGGACGTTGAAAATCACTTTCGTTCCC
ATCGATCACTCAAAACGCCCAATACAAGTATTAGCACAAGAAGCATGGAC
CAATCACTCCAAAAGGAACGATTCCGTCATCACCGACAATTTTCACGGAT
TGTTCAAATCAACTGTGGAATGTCCAGAATGTGGAAAGATGACTGTTGGG
AGATTCGCTCCACGGTTTTCCGGCTACCAACAGCAAGATTCCCAAGAACT
TCTTGCTTTTTTATTGGATGGTCTCCATGAAGATTTGAATCGTGTCAAAC
AAAAGCCATACATTGAAATCCCTGATGATAAAGGCAGAGCAGACGAGCAA
ATACACACAAGTCTGAATTAAACCCAACCAATCCACTTGGAATGAATGGG
AAAGTAGCCGAAGGTTACGCTGATTTGATGCATCAAATGTGGAGTGGAAA
CCAATCACATGTCTCTCCAAGACAGTTCAAGTGCAAGCAACTACTCATCC
TATTCATCATATCAACGTCAGCACAGCACCACTTACAAACCTGGCTTATG
CGGCTTGAGCAATCTTGGCAACACTTGCTTCATGAATTCAGCACTACAAT
GTTTGAGCAATACTACACCTCTGATGAAGTATTTCCTTGGTAACTAATTC
GCCCTCAGAATCATCATTTTCTAGACACTTGTGCTAGAGCAAAAGAATGA
AGAAAACAAATGGCCTCGACAAACAAGAACAAGATCTGTCTCTGGATCCT
CGTCTTCTGCGATGAATATATTGTTGTGAAAATTATGAAAGAAGGTCTAG
GTATTCCAGAAGATGAAGAGGTCAGACTATGGAGTAAGTTCATGCAAAAT
ACATATGAACTTCTGCTTATCAACCAGGCAAAACCAACAACTTTGCAAGA
TCATGGCATCAATAGCGGTCAACTTCACAGAATGTTAGAGAACACCTTCT
TGAAGGATCAGAATTCAAGTTGATCAATAAGCGTGGTTGGAAAAGATTAC
TCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCCATTACAACGTACTGTG
ATTGAGCATGGCATATTCCGAAAAGAAGCAAAAGTTGAGATTTACCCTCT
ACGACTTCAAATTTGTTTATTTAAAAACTTGGAAAATGAAATTGTTAAAA
TGATCAGCAAAACAACTACTCTAGGTACATGTTAGATAAACATTGGTACA
AACAGTTGAAGAAATATATAGAAATTGGTGCTGATAATGTAGATCCTGAG
AGTGAAAACCCTGGACCTATTGATAACACACCATTGTTTGAGACTGATAT
AATTCAACAAAACCAAATGAATGTAGAATGACAATCAATACCTCTTCAGT
TGACTCTGAAGAAATAGAAATGACAAATGGTGATCAAGTTGAAGATGAAG
AAGCAGAAGAAGAAAACATTCTTTTTGCAAAGCAGAAAGAACTACTCCAT
TCTGATGTCAATGATAAACTTGTTGTTGGACAGTCATGATGCACAACAAA
AAAAGACGATTTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAA
TGAAGTGGAAAGTGACGAAAAAGAAGTCAACCAACACCAAGAAGTTGATG
GTGATGGTCCAACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACC
TTTTCTACGTTTTTAATCGGCAAGGAGTACGTATTCATCATATCCTAGTA
CTTCTTTGTTTTGGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCA
AATGCTGACGATGTCTATCATATTATCATCAAAGCCATGAGCTACGAAAT
ACCAGTGCGCATTAAGGAGATCGATGAATCTAATTTAGCTGTCGTTCCAA
TCTACATGAAAACTGTTGTATGATAATCACAGACGTCTTCAATTCCAAAT
TCCACAAGCGATTCACTCGAAATGAAAGCCTCAGTCAAATCACAGATAAA
GATGACATTTTTGTATGAAAGTGACCATTCCCAAGCTAGGACAAACGATC
GCCTTATGTGAGGCTGTTTCCAAATTGACTGGTGTTGAGCCAGATAAGCG
TTCCATCACCTTCGATCCATTCTGCTACTTATCGTTACCGCTGCCAATCA
AACGTGAACGGACGTTGAAAATCACTTTCGTTCCCATCGATCACTCAAAA
CGCCCAATACAAGTATTAGCACAAGAAGCATGGACCAATCACTCCAAAAG
GAACGATTCCGTCATCACCGACAATTTTCACGGATTGTTCAAATCAACTG
TGGAATGTCCAGAATGTGGAAAGATGACTGTTGGGAGATTCGCTCCACGG
TTTTCCGGCTACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATT
GGATGGTCTCCATGAAGATTTGAATCGTGTCAAACAAAAGCCATACATTG
AAATCCCTGATGATAAAGGCAGAGCAGACGAGCAAATACACACAAGTCTG
AATTAAACCCAACCAATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGT
TACGCTGATTTGATGCATCAAATGTGGAGTGGAAACCAATCACATGTCTC
TCCAAGACAGTTCAAGTGCAAGCAACTACTCATCCTATTCATCATATCAA
CGTCAGCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGAGCAATCT
TGGCAACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGCAATACTA
CACCTCTGATGAAGTATTTCCTTGGTAACTAATTCGCCCTCAGAATCATC
ATTTTCTAGACACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCC
TCGACAAACAAGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGA
ATATATTGTTGTGAAAATTATGAAAGAAGGTCTAGGTATTCCAGAAGATG
AAGAGGTCAGACTATGGAGTAAGTTCATGCAAAATACATATGAACTTCTG
CTTATCAACCAGGCAAAACCAACAACTTTGCAAGATCATGGCATCAATAG
CGGTCAACTTCACAGAATGTTAGAGAACACCTTCTTGAAGGATCAGAATT
CAAGTTGATCAATAAGCGTGGTTGGAAAAGATTACTCACACAGTTTGGTT
TGGCTGAAGGCCAAGAGCCATTACAACGTACTGTGATTGAGCATGGCATA
TTCCGAAAAGAAGCAAAAGTTGAGATTTACCCTCTACGACTTCAAATTTG
TTTATTTAAAAACTTGGAAAATGAAATTGTTAAAATGATCAGCAAAACAA
CTACTCTAGGTACATGTTAGATAAACATTGGTACAAACAGTTGAAGAAAT
ATATAGAAATTGGTGCTGATAATGTAGATCCTGAGAGTGAAAACCCTGGA
CCTATTGATAACACACCATTGTTTGAGACTGATATAATTCAACAAAACCA
AATGAATGTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAAGAAAT
AGAAATGACAAATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGAAGAAA
ACATTCTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCAATGAT
AAACTTGTTGTTGGACAGTCATGATGCACAACAAAAAAAGACGATTTGTA
AAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAGTGGAAAGTGA
CGAAAAAGAAGTCAACCAACACCAAGAAGTTGATGGTGATGGTCCAACTC
CTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTA
ATCGGCAAGGAGTACGTATTCATCATATCCTAGTACTTCTTTGTTTTGGC
GTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTC
TATCATATTATCATCAAAGCCATGAGCTACGAAATACCAGTGCGCATTAA
GGAGATCGATGAATCTAATTTAGCTGTCGTTCCAATCTACATGAAAACTG
TTGTATGATAATCACAGACGTCTTCAATTCCAAATTCCACAAGCGATTCA
CTCGAAATGAAAGCCTCAGTCAAATCACAGATAAAGATGACATTTTTGTA
TGAAAGTGACCATTCCCAAGCTAGGACAAACGATCGCCTTATGTGAGGCT
GTTTCCAAATTGACTGGTGTTGAGCCAGATAAGCGTTCCATCACCTTCGA
TCCATTCTGCTACTTATCGTTACCGCTGCCAATCAAACGTGAACGGACGT
TGAAAATCACTTTCGTTCCCATCGATCACTCAAAACGCCCAATACAAGTA
TTAGCACAAGAAGCATGGACCAATCACTCCAAAAGGAACGATTCCGTCAT
CACCGACAATTTTCACGGATTGTTCAAATCAACTGTGGAATGTCCAGAAT
GTGGAAAGATGACTGTTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAA
CAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATTGGATGGTCTCCATGA
AGATTTGAATCGTGTCAAACAAAAGCCATACATTGAAATCCCTGATGATA
AAGGCAGAGCAGACGAGCAAATACACACAAGTCTGAATTAAACCCAACCA
ATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGCTGATTTGATG
CATCAAATGTGGAGTGGAAACCAATCACATGTCTCTCCAAGACAGTTCAA
GTGCAAGCAACTACTCATCCTATTCATCATATCAACGTCAGCACAGCACC
ACTTACAAACCTGGCTTATGCGGCTTGAGCAATCTTGGCAACACTTGCTT
CATGAATTCAGCACTACAATGTTTGAGCAATACTACACCTCTGATGAAGT
ATTTCCTTGGTAACTAATTCGCCCTCAGAATCATCATTTTCTAGACACTT
GTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCCTCGACAAACAAGAAC
AAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGAATATATTGTTGTGAA
AATTATGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAGGTCAGACTAT
GGAGTAAGTTCATGCAAAATACATATGAACTTCTGCTTATCAACCAGGCA
AAACCAACAACTTTGCAAGATCATGGCATCAATAGCGGTCAACTTCACAG
AATGTTAGAGAACACCTTCTTGAAGGATCAGAATTCAAGTTGATCAATAA
GCGTGGTTGGAAAAGATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAG
AGCCATTACAACGTACTGTGATTGAGCATGGCATATTCCGAAAAGAAGCA
AAAGTTGAGATTTACCCTCTACGACTTCAAATTTGTTTATTTAAAAACTT
GGAAAATGAAATTGTTAAAATGATCAGCAAAACAACTACTCTAGGTACAT
GTTAGATAAACATTGGTACAAACAGTTGAAGAAATATATAGAAATTGGTG
CTGATAATGTAGATCCTGAGAGTGAAAACCCTGGACCTATTGATAACACA
CCATTGTTTGAGACTGATATAATTCAACAAAACCAAATGAATGTAGAATG
ACAATCAATACCTCTTCAGTTGACTCTGAAGAAATAGAAATGACAAATGG
TGATCAAGTTGAAGATGAAGAAGCAGAAGAAGAAAACATTCTTTTTGCAA
AGCAGAAAGAACTACTCCATTCTGATGTCAATGATAAACTTGTTGTTGGA
CAGTCATGATGCACAACAAAAAAAGACGATTTGTAAAAGTTCCGAAGGTG
GAAGTGAAGGAGGAGGTGAATGAAGTGGAAAGTGACGAAAAAGAAGTCAA
CCAACACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCTCTAGAAAAAG
ACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTAATCGGCAAGGAGTAC
GTATTCATCATATCCTAGTACTTCTTTGTTTTGGCGTCCGATGCTGGTTG
TTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTCTATCATATTATCATC
AAAGCCATGAGCTACGAAATACCAGTGCGCATTAAGGAGATCGATGAATC
TAATTTAGCTGTCGTTCCAATCTACATGAAAACTGTTGTATGATAATCAC
AGACGTCTTCAATTCCAAATTCCACAAGCGATTCACTCGAAATGAAAGCC
TCAGTCAAATCACAGATAAAGATGACATTTTTGTATGAAAGTGACCATTC
CCAAGCTAGGACAAACGATCGCCTTATGTGAGGCTGTTTCCAAATTGACT
GGTGTTGAGCCAGATAAGCGTTCCATCACCTTCGATCCATTCTGCTACTT
ATCGTTACCGCTGCCAATCAAACGTGAACGGACGTTGAAAATCACTTTCG
TTCCCATCGATCACTCAAAACGCCCAATACAAGTATTAGCACAAGAAGCA
TGGACCAATCACTCCAAAAGGAACGATTCCGTCATCACCGACAATTTTCA
CGGATTGTTCAAATCAACTGTGGAATGTCCAGAATGTGGAAAGATGACTG
TTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAACAGCAAGATTCCCAA
GAACTTCTTGCTTTTTTATTGGATGGTCTCCATGAAGATTTGAATCGTGT
CAAACAAAAGCCATACATTGAAATCCCTGATGATAAAGGCAGAGCAGACG
AGCAAATACACACAAGTCTGAATTAAACCCAACCAATCCACTTGGAATGA
ATGGGAAAGTAGCCGAAGGTTACGCTGATTTGATGCATCAAATGTGGAGT
GGAAACCAATCACATGTCTCTCCAAGACAGTTCAAGTGCAAGCAACTACT
CATCCTATTCATCATATCAACGTCAGCACAGCACCACTTACAAACCTGGC
TTATGCGGCTTGAGCAATCTTGGCAACACTTGCTTCATGAATTCAGCACT
ACAATGTTTGAGCAATACTACACCTCTGATGAAGTATTTCCTTGGTAACT
AATTCGCCCTCAGAATCATCATTTTCTAGACACTTGTGCTAGAGCAAAAG
AATGAAGAAAACAAATGGCCTCGACAAACAAGAACAAGATCTGTCTCTGG
ATCCTCGTCTTCTGCGATGAATATATTGTTGTGAAAATTATGAAAGAAGG
TCTAGGTATTCCAGAAGATGAAGAGGTCAGACTATGGAGTAAGTTCATGC
AAAATACATATGAACTTCTGCTTATCAACCAGGCAAAACCAACAACTTTG
CAAGATCATGGCATCAATAGCGGTCAACTTCACAGAATGTTAGAGAACAC
CTTCTTGAAGGATCAGAATTCAAGTTGATCAATAAGCGTGGTTGGAAAAG
ATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCCATTACAACGTA
CTGTGATTGAGCATGGCATATTCCGAAAAGAAGCAAAAGTTGAGATTTAC
CCTCTACGACTTCAAATTTGTTTATTTAAAAACTTGGAAAATGAAATTGT
TAAAATGATCAGCAAAACAACTACTCTAGGTACATGTTAGATAAACATTG
GTACAAACAGTTGAAGAAATATATAGAAATTGGTGCTGATAATGTAGATC
CTGAGAGTGAAAACCCTGGACCTATTGATAACACACCATTGTTTGAGACT
GATATAATTCAACAAAACCAAATGAATGTAGAATGACAATCAATACCTCT
TCAGTTGACTCTGAAGAAATAGAAATGACAAATGGTGATCAAGTTGAAGA
TGAAGAAGCAGAAGAAGAAAACATTCTTTTTGCAAAGCAGAAAGAACTAC
TCCATTCTGATGTCAATGATAAACTTGTTGTTGGACAGTCATGATGCACA
ACAAAAAAAGACGATTTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAG
GTGAATGAAGTGGAAAGTGACGAAAAAGAAGTCAACCAACACCAAGAAGT
TGATGGTGATGGTCCAACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTG
GTACCTTTTCTACGTTTTTAATCGGCAAGGAGTACGTATTCATCATATCC
TAGTACTTCTTTGTTTTGGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGG
CGGCAAATGCTGACGATGTCTATCATATTATCATCAAAGCCATGAGCTAC
GAAATACCAGTGCGCATTAAGGAGATCGATGAATCTAATTTAGCTGTCGT
TCCAATCTACATGAAAACTGTTGTATGATAATCACAGACGTCTTCAATTC
CAAATTCCACAAGCGATTCACTCGAAATGAAAGCCTCAGTCAAATCACAG
ATAAAGATGACATTTTTGTATGAAAGTGACCATTCCCAAGCTAGGACAAA
CGATCGCCTTATGTGAGGCTGTTTCCAAATTGACTGGTGTTGAGCCAGAT
AAGCGTTCCATCACCTTCGATCCATTCTGCTACTTATCGTTACCGCTGCC
AATCAAACGTGAACGGACGTTGAAAATCACTTTCGTTCCCATCGATCACT
CAAAACGCCCAATACAAGTATTAGCACAAGAAGCATGGACCAATCACTCC
AAAAGGAACGATTCCGTCATCACCGACAATTTTCACGGATTGTTCAAATC
AACTGTGGAATGTCCAGAATGTGGAAAGATGACTGTTGGGAGATTCGCTC
CACGGTTTTCCGGCTACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTT
TTATTGGATGGTCTCCATGAAGATTTGAATCGTGTCAAACAAAAGCCATA
CATTGAAATCCCTGATGATAAAGGCAGAGCAGACGAGCAAATACACACAA
GTCTGAATTAAACCCAACCAATCCACTTGGAATGAATGGGAAAGTAGCCG
AAGGTTACGCTGATTTGATGCATCAAATGTGGAGTGGAAACCAATCACAT
GTCTCTCCAAGACAGTTCAAGTGCAAGCAACTACTCATCCTATTCATCAT
ATCAACGTCAGCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGAGC
AATCTTGGCAACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGCAA
TACTACACCTCTGATGAAGTATTTCCTTGGTAACTAATTCGCCCTCAGAA
TCATCATTTTCTAGACACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAA
TGGCCTCGACAAACAAGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGC
GATGAATATATTGTTGTGAAAATTATGAAAGAAGGTCTAGGTATTCCAGA
AGATGAAGAGGTCAGACTATGGAGTAAGTTCATGCAAAATACATATGAAC
TTCTGCTTATCAACCAGGCAAAACCAACAACTTTGCAAGATCATGGCATC
AATAGCGGTCAACTTCACAGAATGTTAGAGAACACCTTCTTGAAGGATCA
GAATTCAAGTTGATCAATAAGCGTGGTTGGAAAAGATTACTCACACAGTT
TGGTTTGGCTGAAGGCCAAGAGCCATTACAACGTACTGTGATTGAGCATG
GCATATTCCGAAAAGAAGCAAAAGTTGAGATTTACCCTCTACGACTTCAA
ATTTGTTTATTTAAAAACTTGGAAAATGAAATTGTTAAAATGATCAGCAA
AACAACTACTCTAGGTACATGTTAGATAAACATTGGTACAAACAGTTGAA
GAAATATATAGAAATTGGTGCTGATAATGTAGATCCTGAGAGTGAAAACC
CTGGACCTATTGATAACACACCATTGTTTGAGACTGATATAATTCAACAA
AACCAAATGAATGTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAA
GAAATAGAAATGACAAATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGA
AGAAAACATTCTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCA
ATGATAAACTTGTTGTTGGACAGTCATGATGCACAACAAAAAAAGACGAT
TTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAGTGGAA
AGTGACGAAAAAGAAGTCAACCAACACCAAGAAGTTGATGGTGATGGTCC
AACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTCTACGT
TTTTAATCGGCAAGGAGTACGTATTCATCATATCCTAGTACTTCTTTGTT
TTGGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACG
ATGTCTATCATATTATCATCAAAGCCATGAGCTACGAAATACCAGTGCGC
ATTAAGGAGATCGATGAATCTAATTTAGCTGTCGTTCCAATCTACATGAA
AACTGTTGTATGATAATCACAGACGTCTTCAATTCCAAATTCCACAAGCG
ATTCACTCGAAATGAAAGCCTCAGTCAAATCACAGATAAAGATGACATTT
TTGTATGAAAGTGACCATTCCCAAGCTAGGACAAACGATCGCCTTATGTG
AGGCTGTTTCCAAATTGACTGGTGTTGAGCCAGATAAGCGTTCCATCACC
TTCGATCCATTCTGCTACTTATCGTTACCGCTGCCAATCAAACGTGAACG
GACGTTGAAAATCACTTTCGTTCCCATCGATCACTCAAAACGCCCAATAC
AAGTATTAGCACAAGAAGCATGGACCAATCACTCCAAAAGGAACGATTCC
GTCATCACCGACAATTTTCACGGATTGTTCAAATCAACTGTGGAATGTCC
AGAATGTGGAAAGATGACTGTTGGGAGATTCGCTCCACGGTTTTCCGGCT
ACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATTGGATGGTCTC
CATGAAGATTTGAATCGTGTCAAACAAAAGCCATACATTGAAATCCCTGA
TGATAAAGGCAGAGCAGACGAGCAAATACACACAAGTCTGAATTAAACCC
AACCAATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGCTGATT
TGATGCATCAAATGTGGAGTGGAAACCAATCACATGTCTCTCCAAGACAG
TTCAAGTGCAAGCAACTACTCATCCTATTCATCATATCAACGTCAGCACA
GCACCACTTACAAACCTGGCTTATGCGGCTTGAGCAATCTTGGCAACACT
TGCTTCATGAATTCAGCACTACAATGTTTGAGCAATACTACACCTCTGAT
GAAGTATTTCCTTGGTAACTAATTCGCCCTCAGAATCATCATTTTCTAGA
CACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCCTCGACAAACA
AGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGAATATATTGTT
GTGAAAATTATGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAGGTCAG
ACTATGGAGTAAGTTCATGCAAAATACATATGAACTTCTGCTTATCAACC
AGGCAAAACCAACAACTTTGCAAGATCATGGCATCAATAGCGGTCAACTT
CACAGAATGTTAGAGAACACCTTCTTGAAGGATCAGAATTCAAGTTGATC
AATAAGCGTGGTTGGAAAAGATTACTCACACAGTTTGGTTTGGCTGAAGG
CCAAGAGCCATTACAACGTACTGTGATTGAGCATGGCATATTCCGAAAAG
AAGCAAAAGTTGAGATTTACCCTCTACGACTTCAAATTTGTTTATTTAAA
AACTTGGAAAATGAAATTGTTAAAATGATCAGCAAAACAACTACTCTAGG
TACATGTTAGATAAACATTGGTACAAACAGTTGAAGAAATATATAGAAAT
TGGTGCTGATAATGTAGATCCTGAGAGTGAAAACCCTGGACCTATTGATA
ACACACCATTGTTTGAGACTGATATAATTCAACAAAACCAAATGAATGTA
GAATGACAATCAATACCTCTTCAGTTGACTCTGAAGAAATAGAAATGACA
AATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGAAGAAAACATTCTTTT
TGCAAAGCAGAAAGAACTACTCCATTCTGATGTCAATGATAAACTTGTTG
TTGGACAGTCATGATGCACAACAAAAAAAGACGATTTGTAAAAGTTCCGA
AGGTGGAAGTGAAGGAGGAGGTGAATGAAGTGGAAAGTGACGAAAAAGAA
GTCAACCAACACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCTCTAGA
AAAAGACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTAATCGGCAAGG
AGTACGTATTCATCATATCCTAGTACTTCTTTGTTTTGGCGTCCGATGCT
GGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTCTATCATATTA
TCATCAAAGCCATGAGCTACGAAATACCAGTGCGCATTAAGGAGATCGAT
GAATCTAATTTAGCTGTCGTTCCAATCTACATGAAAACTGTTGTATGATA
ATCACAGACGTCTTCAATTCCAAATTCCACAAGCGATTCACTCGAAATGA
AAGCCTCAGTCAAATCACAGATAAAGATGACATTTTTGTATGAAAGTGAC
CATTCCCAAGCTAGGACAAACGATCGCCTTATGTGAGGCTGTTTCCAAAT
TGACTGGTGTTGAGCCAGATAAGCGTTCCATCACCTTCGATCCATTCTGC
TACTTATCGTTACCGCTGCCAATCAAACGTGAACGGACGTTGAAAATCAC
TTTCGTTCCCATCGATCACTCAAAACGCCCAATACAAGTATTAGCACAAG
AAGCATGGACCAATCACTCCAAAAGGAACGATTCCGTCATCACCGACAAT
TTTCACGGATTGTTCAAATCAACTGTGGAATGTCCAGAATGTGGAAAGAT
GACTGTTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAACAGCAAGATT
CCCAAGAACTTCTTGCTTTTTTATTGGATGGTCTCCATGAAGATTTGAAT
CGTGTCAAACAAAAGCCATACATTGAAATCCCTGATGATAAAGGCAGAGC
AGACGAGCAAATACACACAAGTCTGAATTAAACCCAACCAATCCACTTGG
AATGAATGGGAAAGTAGCCGAAGGTTACGCTGATTTGATGCATCAAATGT
GGAGTGGAAACCAATCACATGTCTCTCCAAGACAGTTCAAGTGCAAGCAA
CTACTCATCCTATTCATCATATCAACGTCAGCACAGCACCACTTACAAAC
CTGGCTTATGCGGCTTGAGCAATCTTGGCAACACTTGCTTCATGAATTCA
GCACTACAATGTTTGAGCAATACTACACCTCTGATGAAGTATTTCCTTGG
TAACTAATTCGCCCTCAGAATCATCATTTTCTAGACACTTGTGCTAGAGC
AAAAGAATGAAGAAAACAAATGGCCTCGACAAACAAGAACAAGATCTGTC
TCTGGATCCTCGTCTTCTGCGATGAATATATTGTTGTGAAAATTATGAAA
GAAGGTCTAGGTATTCCAGAAGATGAAGAGGTCAGACTATGGAGTAAGTT
CATGCAAAATACATATGAACTTCTGCTTATCAACCAGGCAAAACCAACAA
CTTTGCAAGATCATGGCATCAATAGCGGTCAACTTCACAGAATGTTAGAG
AACACCTTCTTGAAGGATCAGAATTCAAGTTGATCAATAAGCGTGGTTGG
AAAAGATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCCATTACA
ACGTACTGTGATTGAGCATGGCATATTCCGAAAAGAAGCAAAAGTTGAGA
TTTACCCTCTACGACTTCAAATTTGTTTATTTAAAAACTTGGAAAATGAA
ATTGTTAAAATGATCAGCAAAACAACTACTCTAGGTACATGTTAGATAAA
CATTGGTACAAACAGTTGAAGAAATATATAGAAATTGGTGCTGATAATGT
AGATCCTGAGAGTGAAAACCCTGGACCTATTGATAACACACCATTGTTTG
AGACTGATATAATTCAACAAAACCAAATGAATGTAGAATGACAATCAATA
CCTCTTCAGTTGACTCTGAAGAAATAGAAATGACAAATGGTGATCAAGTT
GAAGATGAAGAAGCAGAAGAAGAAAACATTCTTTTTGCAAAGCAGAAAGA
ACTACTCCATTCTGATGTCAATGATAAACTTGTTGTTGGACAGTCATGAT
GCACAACAAAAAAAGACGATTTGTAAAAGTTCCGAAGGTGGAAGTGAAGG
AGGAGGTGAATGAAGTGGAAAGTGACGAAAAAGAAGTCAACCAACACCAA
GAAGTTGATGGTGATGGTCCAACTCCTCCTCTAGAAAAAGACCAGGATGA
AGCTGGTACCTTTTCTACGTTTTTAATCGGCAAGGAGTACGTATTCATCA
TATCCTAGTACTTCTTTGTTTTGGCGTCCGATGCTGGTTGTTGTCCCTAA
AAAGGCGGCAAATGCTGACGATGTCTATCATATTATCATCAAAGCCATGA
GCTACGAAATACCAGTGCGCATTAAGGAGATCGATGAATCTAATTTAGCT
GTCGTTCCAATCTACATGAAAACTGTTGTATGATAATCACAGACGTCTTC
AATTCCAAATTCCACAAGCGATTCACTCGAAATGAAAGCCTCAGTCAAAT
CACAGATAAAGATGACATTTTTGTATGAAAGTGACCATTCCCAAGCTAGG
ACAAACGATCGCCTTATGTGAGGCTGTTTCCAAATTGACTGGTGTTGAGC
CAGATAAGCGTTCCATCACCTTCGATCCATTCTGCTACTTATCGTTACCG
CTGCCAATCAAACGTGAACGGACGTTGAAAATCACTTTCGTTCCCATCGA
TCACTCAAAACGCCCAATACAAGTATTAGCACAAGAAGCATGGACCAATC
ACTCCAAAAGGAACGATTCCGTCATCACCGACAATTTTCACGGATTGTTC
AAATCAACTGTGGAATGTCCAGAATGTGGAAAGATGACTGTTGGGAGATT
CGCTCCACGGTTTTCCGGCTACCAACAGCAAGATTCCCAAGAACTTCTTG
CTTTTTTATTGGATGGTCTCCATGAAGATTTGAATCGTGTCAAACAAAAG
CCATACATTGAAATCCCTGATGATAAAGGCAGAGCAGACGAGCAAATACA
CACAAGTCTGAATTAAACCCAACCAATCCACTTGGAATGAATGGGAAAGT
AGCCGAAGGTTACGCTGATTTGATGCATCAAATGTGGAGTGGAAACCAAT
CACATGTCTCTCCAAGACAGTTCAAGTGCAAGCAACTACTCATCCTATTC
ATCATATCAACGTCAGCACAGCACCACTTACAAACCTGGCTTATGCGGCT
TGAGCAATCTTGGCAACACTTGCTTCATGAATTCAGCACTACAATGTTTG
AGCAATACTACACCTCTGATGAAGTATTTCCTTGGTAACTAATTCGCCCT
CAGAATCATCATTTTCTAGACACTTGTGCTAGAGCAAAAGAATGAAGAAA
ACAAATGGCCTCGACAAACAAGAACAAGATCTGTCTCTGGATCCTCGTCT
TCTGCGATGAATATATTGTTGTGAAAATTATGAAAGAAGGTCTAGGTATT
CCAGAAGATGAAGAGGTCAGACTATGGAGTAAGTTCATGCAAAATACATA
TGAACTTCTGCTTATCAACCAGGCAAAACCAACAACTTTGCAAGATCATG
GCATCAATAGCGGTCAACTTCACAGAATGTTAGAGAACACCTTCTTGAAG
GATCAGAATTCAAGTTGATCAATAAGCGTGGTTGGAAAAGATTACTCACA
CAGTTTGGTTTGGCTGAAGGCCAAGAGCCATTACAACGTACTGTGATTGA
GCATGGCATATTCCGAAAAGAAGCAAAAGTTGAGATTTACCCTCTACGAC
TTCAAATTTGTTTATTTAAAAACTTGGAAAATGAAATTGTTAAAATGATC
AGCAAAACAACTACTCTAGGTACATGTTAGATAAACATTGGTACAAACAG
TTGAAGAAATATATAGAAATTGGTGCTGATAATGTAGATCCTGAGAGTGA
AAACCCTGGACCTATTGATAACACACCATTGTTTGAGACTGATATAATTC
AACAAAACCAAATGAATGTAGAATGACAATCAATACCTCTTCAGTTGACT
CTGAAGAAATAGAAATGACAAATGGTGATCAAGTTGAAGATGAAGAAGCA
GAAGAAGAAAACATTCTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGA
TGTCAATGATAAACTTGTTGTTGGACAGTCATGATGCACAACAAAAAAAG
ACGATTTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAG
TGGAAAGTGACGAAAAAGAAGTCAACCAACACCAAGAAGTTGATGGTGAT
GGTCCAACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTC
TACGTTTTTAATCGGCAAGGAGTACGTATTCATCATATCCTAGTACTTCT
TTGTTTTGGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGC
TGACGATGTCTATCATATTATCATCAAAGCCATGAGCTACGAAATACCAG
TGCGCATTAAGGAGATCGATGAATCTAATTTAGCTGTCGTTCCAATCTAC
ATGAAAACTGTTGTATGATAATCACAGACGTCTTCAATTCCAAATTCCAC
AAGCGATTCACTCGAAATGAAAGCCTCAGTCAAATCACAGATAAAGATGA
CATTTTTGTATGAAAGTGACCATTCCCAAGCTAGGACAAACGATCGCCTT
ATGTGAGGCTGTTTCCAAATTGACTGGTGTTGAGCCAGATAAGCGTTCCA
TCACCTTCGATCCATTCTGCTACTTATCGTTACCGCTGCCAATCAAACGT
GAACGGACGTTGAAAATCACTTTCGTTCCCATCGATCACTCAAAACGCCC
AATACAAGTATTAGCACAAGAAGCATGGACCAATCACTCCAAAAGGAACG
ATTCCGTCATCACCGACAATTTTCACGGATTGTTCAAATCAACTGTGGAA
TGTCCAGAATGTGGAAAGATGACTGTTGGGAGATTCGCTCCACGGTTTTC
CGGCTACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATTGGATG
GTCTCCATGAAGATTTGAATCGTGTCAAACAAAAGCCATACATTGAAATC
CCTGATGATAAAGGCAGAGCAGACGAGCAAATACACACAAGTCTGAATTA
AACCCAACCAATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGC
TGATTTGATGCATCAAATGTGGAGTGGAAACCAATCACATGTCTCTCCAA
GACAGTTCAAGTGCAAGCAACTACTCATCCTATTCATCATATCAACGTCA
GCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGAGCAATCTTGGCA
ACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGCAATACTACACCT
CTGATGAAGTATTTCCTTGGTAACTAATTCGCCCTCAGAATCATCATTTT
CTAGACACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCCTCGAC
AAACAAGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGAATATA
TTGTTGTGAAAATTATGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAG
GTCAGACTATGGAGTAAGTTCATGCAAAATACATATGAACTTCTGCTTAT
CAACCAGGCAAAACCAACAACTTTGCAAGATCATGGCATCAATAGCGGTC
AACTTCACAGAATGTTAGAGAACACCTTCTTGAAGGATCAGAATTCAAGT
TGATCAATAAGCGTGGTTGGAAAAGATTACTCACACAGTTTGGTTTGGCT
GAAGGCCAAGAGCCATTACAACGTACTGTGATTGAGCATGGCATATTCCG
AAAAGAAGCAAAAGTTGAGATTTACCCTCTACGACTTCAAATTTGTTTAT
TTAAAAACTTGGAAAATGAAATTGTTAAAATGATCAGCAAAACAACTACT
CTAGGTACATGTTAGATAAACATTGGTACAAACAGTTGAAGAAATATATA
GAAATTGGTGCTGATAATGTAGATCCTGAGAGTGAAAACCCTGGACCTAT
TGATAACACACCATTGTTTGAGACTGATATAATTCAACAAAACCAAATGA
ATGTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAAGAAATAGAAA
TGACAAATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGAAGAAAACATT
CTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCAATGATAAACT
TGTTGTTGGACAGTCATGATGCACAACAAAAAAAGACGATTTGTAAAAGT
TCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAGTGGAAAGTGACGAAA
AAGAAGTCAACCAACACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCT
CTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTAATCGG
CAAGGAGTACGTATTCATCATATCCTAGTACTTCTTTGTTTTGGCGTCCG
ATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTCTATCA
TATTATCATCAAAGCCATGAGCTACGAAATACCAGTGCGCATTAAGGAGA
TCGATGAATCTAATTTAGCTGTCGTTCCAATCTACATGAAAACTGTTGTA
TGATAATCACAGACGTCTTCAATTCCAAATTCCACAAGCGATTCACTCGA
AATGAAAGCCTCAGTCAAATCACAGATAAAGATGACATTTTTGTATGAAA
GTGACCATTCCCAAGCTAGGACAAACGATCGCCTTATGTGAGGCTGTTTC
CAAATTGACTGGTGTTGAGCCAGATAAGCGTTCCATCACCTTCGATCCAT
TCTGCTACTTATCGTTACCGCTGCCAATCAAACGTGAACGGACGTTGAAA
ATCACTTTCGTTCCCATCGATCACTCAAAACGCCCAATACAAGTATTAGC
ACAAGAAGCATGGACCAATCACTCCAAAAGGAACGATTCCGTCATCACCG
ACAATTTTCACGGATTGTTCAAATCAACTGTGGAATGTCCAGAATGTGGA
AAGATGACTGTTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAACAGCA
AGATTCCCAAGAACTTCTTGCTTTTTTATTGGATGGTCTCCATGAAGATT
TGAATCGTGTCAAACAAAAGCCATACATTGAAATCCCTGATGATAAAGGC
AGAGCAGACGAGCAAATACACACAAGTCTGAATTAAACCCAACCAATCCA
CTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGCTGATTTGATGCATCA
AATGTGGAGTGGAAACCAATCACATGTCTCTCCAAGACAGTTCAAGTGCA
AGCAACTACTCATCCTATTCATCATATCAACGTCAGCACAGCACCACTTA
CAAACCTGGCTTATGCGGCTTGAGCAATCTTGGCAACACTTGCTTCATGA
ATTCAGCACTACAATGTTTGAGCAATACTACACCTCTGATGAAGTATTTC
CTTGGTAACTAATTCGCCCTCAGAATCATCATTTTCTAGACACTTGTGCT
AGAGCAAAAGAATGAAGAAAACAAATGGCCTCGACAAACAAGAACAAGAT
CTGTCTCTGGATCCTCGTCTTCTGCGATGAATATATTGTTGTGAAAATTA
TGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAGGTCAGACTATGGAGT
AAGTTCATGCAAAATACATATGAACTTCTGCTTATCAACCAGGCAAAACC
AACAACTTTGCAAGATCATGGCATCAATAGCGGTCAACTTCACAGAATGT
TAGAGAACACCTTCTTGAAGGATCAGAATTCAAGTTGATCAATAAGCGTG
GTTGGAAAAGATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCCA
TTACAACGTACTGTGATTGAGCATGGCATATTCCGAAAAGAAGCAAAAGT
TGAGATTTACCCTCTACGACTTCAAATTTGTTTATTTAAAAACTTGGAAA
ATGAAATTGTTAAAATGATCAGCAAAACAACTACTCTAGGTACATGTTAG
ATAAACATTGGTACAAACAGTTGAAGAAATATATAGAAATTGGTGCTGAT
AATGTAGATCCTGAGAGTGAAAACCCTGGACCTATTGATAACACACCATT
GTTTGAGACTGATATAATTCAACAAAACCAAATGAATGTAGAATGACAAT
CAATACCTCTTCAGTTGACTCTGAAGAAATAGAAATGACAAATGGTGATC
AAGTTGAAGATGAAGAAGCAGAAGAAGAAAACATTCTTTTTGCAAAGCAG
AAAGAACTACTCCATTCTGATGTCAATGATAAACTTGTTGTTGGACAGTC
ATGATGCACAACAAAAAAAGACGATTTGTAAAAGTTCCGAAGGTGGAAGT
GAAGGAGGAGGTGAATGAAGTGGAAAGTGACGAAAAAGAAGTCAACCAAC
ACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCTCTAGAAAAAGACCAG
GATGAAGCTGGTACCTTTTCTACGTTTTTAATCGGCAAGGAGTACGTATT
CATCATATCCTAGTACTTCTTTGTTTTGGCGTCCGATGCTGGTTGTTGTC
CCTAAAAAGGCGGCAAATGCTGACGATGTCTATCATATTATCATCAAAGC
CATGAGCTACGAAATACCAGTGCGCATTAAGGAGATCGATGAATCTAATT
TAGCTGTCGTTCCAATCTACATGAAAACTGTTGTATGATAATCACAGACG
TCTTCAATTCCAAATTCCACAAGCGATTCACTCGAAATGAAAGCCTCAGT
CAAATCACAGATAAAGATGACATTTTTGTATGAAAGTGACCATTCCCAAG
CTAGGACAAACGATCGCCTTATGTGAGGCTGTTTCCAAATTGACTGGTGT
TGAGCCAGATAAGCGTTCCATCACCTTCGATCCATTCTGCTACTTATCGT
TACCGCTGCCAATCAAACGTGAACGGACGTTGAAAATCACTTTCGTTCCC
ATCGATCACTCAAAACGCCCAATACAAGTATTAGCACAAGAAGCATGGAC
CAATCACTCCAAAAGGAACGATTCCGTCATCACCGACAATTTTCACGGAT
TGTTCAAATCAACTGTGGAATGTCCAGAATGTGGAAAGATGACTGTTGGG
AGATTCGCTCCACGGTTTTCCGGCTACCAACAGCAAGATTCCCAAGAACT
TCTTGCTTTTTTATTGGATGGTCTCCATGAAGATTTGAATCGTGTCAAAC
AAAAGCCATACATTGAAATCCCTGATGATAAAGGCAGAGCAGACGAGCAA
ATACACACAAGTCTGAATTAAACCCAACCAATCCACTTGGAATGAATGGG
AAAGTAGCCGAAGGTTACGCTGATTTGATGCATCAAATGTGGAGTGGAAA
CCAATCACATGTCTCTCCAAGACAGTTCAAGTGCAAGCAACTACTCATCC
TATTCATCATATCAACGTCAGCACAGCACCACTTACAAACCTGGCTTATG
CGGCTTGAGCAATCTTGGCAACACTTGCTTCATGAATTCAGCACTACAAT
GTTTGAGCAATACTACACCTCTGATGAAGTATTTCCTTGGTAACTAATTC
GCCCTCAGAATCATCATTTTCTAGACACTTGTGCTAGAGCAAAAGAATGA
AGAAAACAAATGGCCTCGACAAACAAGAACAAGATCTGTCTCTGGATCCT
CGTCTTCTGCGATGAATATATTGTTGTGAAAATTATGAAAGAAGGTCTAG
GTATTCCAGAAGATGAAGAGGTCAGACTATGGAGTAAGTTCATGCAAAAT
ACATATGAACTTCTGCTTATCAACCAGGCAAAACCAACAACTTTGCAAGA
TCATGGCATCAATAGCGGTCAACTTCACAGAATGTTAGAGAACACCTTCT
TGAAGGATCAGAATTCAAGTTGATCAATAAGCGTGGTTGGAAAAGATTAC
TCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCCATTACAACGTACTGTG
ATTGAGCATGGCATATTCCGAAAAGAAGCAAAAGTTGAGATTTACCCTCT
ACGACTTCAAATTTGTTTATTTAAAAACTTGGAAAATGAAATTGTTAAAA
TGATCAGCAAAACAACTACTCTAGGTACATGTTAGATAAACATTGGTACA
AACAGTTGAAGAAATATATAGAAATTGGTGCTGATAATGTAGATCCTGAG
AGTGAAAACCCTGGACCTATTGATAACACACCATTGTTTGAGACTGATAT
AATTCAACAAAACCAAATGAATGTAGAATGACAATCAATACCTCTTCAGT
TGACTCTGAAGAAATAGAAATGACAAATGGTGATCAAGTTGAAGATGAAG
AAGCAGAAGAAGAAAACATTCTTTTTGCAAAGCAGAAAGAACTACTCCAT
TCTGATGTCAATGATAAACTTGTTGTTGGACAGTCATGATGCACAACAAA
AAAAGACGATTTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAA
TGAAGTGGAAAGTGACGAAAAAGAAGTCAACCAACACCAAGAAGTTGATG
GTGATGGTCCAACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACC
TTTTCTACGTTTTTAATCGGCAAGGAGTACGTATTCATCATATCCTAGTA
CTTCTTTGTTTTGGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCA
AATGCTGACGATGTCTATCATATTATCATCAAAGCCATGAGCTACGAAAT
ACCAGTGCGCATTAAGGAGATCGATGAATCTAATTTAGCTGTCGTTCCAA
TCTACATGAAAACTGTTGTATGATAATCACAGACGTCTTCAATTCCAAAT
TCCACAAGCGATTCACTCGAAATGAAAGCCTCAGTCAAATCACAGATAAA
GATGACATTTTTGTATGAAAGTGACCATTCCCAAGCTAGGACAAACGATC
GCCTTATGTGAGGCTGTTTCCAAATTGACTGGTGTTGAGCCAGATAAGCG
TTCCATCACCTTCGATCCATTCTGCTACTTATCGTTACCGCTGCCAATCA
AACGTGAACGGACGTTGAAAATCACTTTCGTTCCCATCGATCACTCAAAA
CGCCCAATACAAGTATTAGCACAAGAAGCATGGACCAATCACTCCAAAAG
GAACGATTCCGTCATCACCGACAATTTTCACGGATTGTTCAAATCAACTG
TGGAATGTCCAGAATGTGGAAAGATGACTGTTGGGAGATTCGCTCCACGG
TTTTCCGGCTACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATT
GGATGGTCTCCATGAAGATTTGAATCGTGTCAAACAAAAGCCATACATTG
AAATCCCTGATGATAAAGGCAGAGCAGACGAGCAAATACACACAAGTCTG
AATTAAACCCAACCAATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGT
TACGCTGATTTGATGCATCAAATGTGGAGTGGAAACCAATCACATGTCTC
TCCAAGACAGTTCAAGTGCAAGCAACTACTCATCCTATTCATCATATCAA
CGTCAGCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGAGCAATCT
TGGCAACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGCAATACTA
CACCTCTGATGAAGTATTTCCTTGGTAACTAATTCGCCCTCAGAATCATC
ATTTTCTAGACACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCC
TCGACAAACAAGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGA
ATATATTGTTGTGAAAATTATGAAAGAAGGTCTAGGTATTCCAGAAGATG
AAGAGGTCAGACTATGGAGTAAGTTCATGCAAAATACATATGAACTTCTG
CTTATCAACCAGGCAAAACCAACAACTTTGCAAGATCATGGCATCAATAG
CGGTCAACTTCACAGAATGTTAGAGAACACCTTCTTGAAGGATCAGAATT
CAAGTTGATCAATAAGCGTGGTTGGAAAAGATTACTCACACAGTTTGGTT
TGGCTGAAGGCCAAGAGCCATTACAACGTACTGTGATTGAGCATGGCATA
TTCCGAAAAGAAGCAAAAGTTGAGATTTACCCTCTACGACTTCAAATTTG
TTTATTTAAAAACTTGGAAAATGAAATTGTTAAAATGATCAGCAAAACAA
CTACTCTAGGTACATGTTAGATAAACATTGGTACAAACAGTTGAAGAAAT
ATATAGAAATTGGTGCTGATAATGTAGATCCTGAGAGTGAAAACCCTGGA
CCTATTGATAACACACCATTGTTTGAGACTGATATAATTCAACAAAACCA
AATGAATGTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAAGAAAT
AGAAATGACAAATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGAAGAAA
ACATTCTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCAATGAT
AAACTTGTTGTTGGACAGTCATGATGCACAACAAAAAAAGACGATTTGTA
AAAGTTCCGAAGGTGGAAGTGAAGGAGGAGGTGAATGAAGTGGAAAGTGA
CGAAAAAGAAGTCAACCAACACCAAGAAGTTGATGGTGATGGTCCAACTC
CTCCTCTAGAAAAAGACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTA
ATCGGCAAGGAGTACGTATTCATCATATCCTAGTACTTCTTTGTTTTGGC
GTCCGATGCTGGTTGTTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTC
TATCATATTATCATCAAAGCCATGAGCTACGAAATACCAGTGCGCATTAA
GGAGATCGATGAATCTAATTTAGCTGTCGTTCCAATCTACATGAAAACTG
TTGTATGATAATCACAGACGTCTTCAATTCCAAATTCCACAAGCGATTCA
CTCGAAATGAAAGCCTCAGTCAAATCACAGATAAAGATGACATTTTTGTA
TGAAAGTGACCATTCCCAAGCTAGGACAAACGATCGCCTTATGTGAGGCT
GTTTCCAAATTGACTGGTGTTGAGCCAGATAAGCGTTCCATCACCTTCGA
TCCATTCTGCTACTTATCGTTACCGCTGCCAATCAAACGTGAACGGACGT
TGAAAATCACTTTCGTTCCCATCGATCACTCAAAACGCCCAATACAAGTA
TTAGCACAAGAAGCATGGACCAATCACTCCAAAAGGAACGATTCCGTCAT
CACCGACAATTTTCACGGATTGTTCAAATCAACTGTGGAATGTCCAGAAT
GTGGAAAGATGACTGTTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAA
CAGCAAGATTCCCAAGAACTTCTTGCTTTTTTATTGGATGGTCTCCATGA
AGATTTGAATCGTGTCAAACAAAAGCCATACATTGAAATCCCTGATGATA
AAGGCAGAGCAGACGAGCAAATACACACAAGTCTGAATTAAACCCAACCA
ATCCACTTGGAATGAATGGGAAAGTAGCCGAAGGTTACGCTGATTTGATG
CATCAAATGTGGAGTGGAAACCAATCACATGTCTCTCCAAGACAGTTCAA
GTGCAAGCAACTACTCATCCTATTCATCATATCAACGTCAGCACAGCACC
ACTTACAAACCTGGCTTATGCGGCTTGAGCAATCTTGGCAACACTTGCTT
CATGAATTCAGCACTACAATGTTTGAGCAATACTACACCTCTGATGAAGT
ATTTCCTTGGTAACTAATTCGCCCTCAGAATCATCATTTTCTAGACACTT
GTGCTAGAGCAAAAGAATGAAGAAAACAAATGGCCTCGACAAACAAGAAC
AAGATCTGTCTCTGGATCCTCGTCTTCTGCGATGAATATATTGTTGTGAA
AATTATGAAAGAAGGTCTAGGTATTCCAGAAGATGAAGAGGTCAGACTAT
GGAGTAAGTTCATGCAAAATACATATGAACTTCTGCTTATCAACCAGGCA
AAACCAACAACTTTGCAAGATCATGGCATCAATAGCGGTCAACTTCACAG
AATGTTAGAGAACACCTTCTTGAAGGATCAGAATTCAAGTTGATCAATAA
GCGTGGTTGGAAAAGATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAG
AGCCATTACAACGTACTGTGATTGAGCATGGCATATTCCGAAAAGAAGCA
AAAGTTGAGATTTACCCTCTACGACTTCAAATTTGTTTATTTAAAAACTT
GGAAAATGAAATTGTTAAAATGATCAGCAAAACAACTACTCTAGGTACAT
GTTAGATAAACATTGGTACAAACAGTTGAAGAAATATATAGAAATTGGTG
CTGATAATGTAGATCCTGAGAGTGAAAACCCTGGACCTATTGATAACACA
CCATTGTTTGAGACTGATATAATTCAACAAAACCAAATGAATGTAGAATG
ACAATCAATACCTCTTCAGTTGACTCTGAAGAAATAGAAATGACAAATGG
TGATCAAGTTGAAGATGAAGAAGCAGAAGAAGAAAACATTCTTTTTGCAA
AGCAGAAAGAACTACTCCATTCTGATGTCAATGATAAACTTGTTGTTGGA
CAGTCATGATGCACAACAAAAAAAGACGATTTGTAAAAGTTCCGAAGGTG
GAAGTGAAGGAGGAGGTGAATGAAGTGGAAAGTGACGAAAAAGAAGTCAA
CCAACACCAAGAAGTTGATGGTGATGGTCCAACTCCTCCTCTAGAAAAAG
ACCAGGATGAAGCTGGTACCTTTTCTACGTTTTTAATCGGCAAGGAGTAC
GTATTCATCATATCCTAGTACTTCTTTGTTTTGGCGTCCGATGCTGGTTG
TTGTCCCTAAAAAGGCGGCAAATGCTGACGATGTCTATCATATTATCATC
AAAGCCATGAGCTACGAAATACCAGTGCGCATTAAGGAGATCGATGAATC
TAATTTAGCTGTCGTTCCAATCTACATGAAAACTGTTGTATGATAATCAC
AGACGTCTTCAATTCCAAATTCCACAAGCGATTCACTCGAAATGAAAGCC
TCAGTCAAATCACAGATAAAGATGACATTTTTGTATGAAAGTGACCATTC
CCAAGCTAGGACAAACGATCGCCTTATGTGAGGCTGTTTCCAAATTGACT
GGTGTTGAGCCAGATAAGCGTTCCATCACCTTCGATCCATTCTGCTACTT
ATCGTTACCGCTGCCAATCAAACGTGAACGGACGTTGAAAATCACTTTCG
TTCCCATCGATCACTCAAAACGCCCAATACAAGTATTAGCACAAGAAGCA
TGGACCAATCACTCCAAAAGGAACGATTCCGTCATCACCGACAATTTTCA
CGGATTGTTCAAATCAACTGTGGAATGTCCAGAATGTGGAAAGATGACTG
TTGGGAGATTCGCTCCACGGTTTTCCGGCTACCAACAGCAAGATTCCCAA
GAACTTCTTGCTTTTTTATTGGATGGTCTCCATGAAGATTTGAATCGTGT
CAAACAAAAGCCATACATTGAAATCCCTGATGATAAAGGCAGAGCAGACG
AGCAAATACACACAAGTCTGAATTAAACCCAACCAATCCACTTGGAATGA
ATGGGAAAGTAGCCGAAGGTTACGCTGATTTGATGCATCAAATGTGGAGT
GGAAACCAATCACATGTCTCTCCAAGACAGTTCAAGTGCAAGCAACTACT
CATCCTATTCATCATATCAACGTCAGCACAGCACCACTTACAAACCTGGC
TTATGCGGCTTGAGCAATCTTGGCAACACTTGCTTCATGAATTCAGCACT
ACAATGTTTGAGCAATACTACACCTCTGATGAAGTATTTCCTTGGTAACT
AATTCGCCCTCAGAATCATCATTTTCTAGACACTTGTGCTAGAGCAAAAG
AATGAAGAAAACAAATGGCCTCGACAAACAAGAACAAGATCTGTCTCTGG
ATCCTCGTCTTCTGCGATGAATATATTGTTGTGAAAATTATGAAAGAAGG
TCTAGGTATTCCAGAAGATGAAGAGGTCAGACTATGGAGTAAGTTCATGC
AAAATACATATGAACTTCTGCTTATCAACCAGGCAAAACCAACAACTTTG
CAAGATCATGGCATCAATAGCGGTCAACTTCACAGAATGTTAGAGAACAC
CTTCTTGAAGGATCAGAATTCAAGTTGATCAATAAGCGTGGTTGGAAAAG
ATTACTCACACAGTTTGGTTTGGCTGAAGGCCAAGAGCCATTACAACGTA
CTGTGATTGAGCATGGCATATTCCGAAAAGAAGCAAAAGTTGAGATTTAC
CCTCTACGACTTCAAATTTGTTTATTTAAAAACTTGGAAAATGAAATTGT
TAAAATGATCAGCAAAACAACTACTCTAGGTACATGTTAGATAAACATTG
GTACAAACAGTTGAAGAAATATATAGAAATTGGTGCTGATAATGTAGATC
CTGAGAGTGAAAACCCTGGACCTATTGATAACACACCATTGTTTGAGACT
GATATAATTCAACAAAACCAAATGAATGTAGAATGACAATCAATACCTCT
TCAGTTGACTCTGAAGAAATAGAAATGACAAATGGTGATCAAGTTGAAGA
TGAAGAAGCAGAAGAAGAAAACATTCTTTTTGCAAAGCAGAAAGAACTAC
TCCATTCTGATGTCAATGATAAACTTGTTGTTGGACAGTCATGATGCACA
ACAAAAAAAGACGATTTGTAAAAGTTCCGAAGGTGGAAGTGAAGGAGGAG
GTGAATGAAGTGGAAAGTGACGAAAAAGAAGTCAACCAACACCAAGAAGT
TGATGGTGATGGTCCAACTCCTCCTCTAGAAAAAGACCAGGATGAAGCTG
GTACCTTTTCTACGTTTTTAATCGGCAAGGAGTACGTATTCATCATATCC
TAGTACTTCTTTGTTTTGGCGTCCGATGCTGGTTGTTGTCCCTAAAAAGG
CGGCAAATGCTGACGATGTCTATCATATTATCATCAAAGCCATGAGCTAC
GAAATACCAGTGCGCATTAAGGAGATCGATGAATCTAATTTAGCTGTCGT
TCCAATCTACATGAAAACTGTTGTATGATAATCACAGACGTCTTCAATTC
CAAATTCCACAAGCGATTCACTCGAAATGAAAGCCTCAGTCAAATCACAG
ATAAAGATGACATTTTTGTATGAAAGTGACCATTCCCAAGCTAGGACAAA
CGATCGCCTTATGTGAGGCTGTTTCCAAATTGACTGGTGTTGAGCCAGAT
AAGCGTTCCATCACCTTCGATCCATTCTGCTACTTATCGTTACCGCTGCC
AATCAAACGTGAACGGACGTTGAAAATCACTTTCGTTCCCATCGATCACT
CAAAACGCCCAATACAAGTATTAGCACAAGAAGCATGGACCAATCACTCC
AAAAGGAACGATTCCGTCATCACCGACAATTTTCACGGATTGTTCAAATC
AACTGTGGAATGTCCAGAATGTGGAAAGATGACTGTTGGGAGATTCGCTC
CACGGTTTTCCGGCTACCAACAGCAAGATTCCCAAGAACTTCTTGCTTTT
TTATTGGATGGTCTCCATGAAGATTTGAATCGTGTCAAACAAAAGCCATA
CATTGAAATCCCTGATGATAAAGGCAGAGCAGACGAGCAAATACACACAA
GTCTGAATTAAACCCAACCAATCCACTTGGAATGAATGGGAAAGTAGCCG
AAGGTTACGCTGATTTGATGCATCAAATGTGGAGTGGAAACCAATCACAT
GTCTCTCCAAGACAGTTCAAGTGCAAGCAACTACTCATCCTATTCATCAT
ATCAACGTCAGCACAGCACCACTTACAAACCTGGCTTATGCGGCTTGAGC
AATCTTGGCAACACTTGCTTCATGAATTCAGCACTACAATGTTTGAGCAA
TACTACACCTCTGATGAAGTATTTCCTTGGTAACTAATTCGCCCTCAGAA
TCATCATTTTCTAGACACTTGTGCTAGAGCAAAAGAATGAAGAAAACAAA
TGGCCTCGACAAACAAGAACAAGATCTGTCTCTGGATCCTCGTCTTCTGC
GATGAATATATTGTTGTGAAAATTATGAAAGAAGGTCTAGGTATTCCAGA
AGATGAAGAGGTCAGACTATGGAGTAAGTTCATGCAAAATACATATGAAC
TTCTGCTTATCAACCAGGCAAAACCAACAACTTTGCAAGATCATGGCATC
AATAGCGGTCAACTTCACAGAATGTTAGAGAACACCTTCTTGAAGGATCA
GAATTCAAGTTGATCAATAAGCGTGGTTGGAAAAGATTACTCACACAGTT
TGGTTTGGCTGAAGGCCAAGAGCCATTACAACGTACTGTGATTGAGCATG
GCATATTCCGAAAAGAAGCAAAAGTTGAGATTTACCCTCTACGACTTCAA
ATTTGTTTATTTAAAAACTTGGAAAATGAAATTGTTAAAATGATCAGCAA
AACAACTACTCTAGGTACATGTTAGATAAACATTGGTACAAACAGTTGAA
GAAATATATAGAAATTGGTGCTGATAATGTAGATCCTGAGAGTGAAAACC
CTGGACCTATTGATAACACACCATTGTTTGAGACTGATATAATTCAACAA
AACCAAATGAATGTAGAATGACAATCAATACCTCTTCAGTTGACTCTGAA
GAAATAGAAATGACAAATGGTGATCAAGTTGAAGATGAAGAAGCAGAAGA
AGAAAACATTCTTTTTGCAAAGCAGAAAGAACTACTCCATTCTGATGTCA
ATGATAAACTTGTTGTTGGACAGTCATGATGCACAACAAAAAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000618XLOC_000618Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001100-proteinTCONS_00001100-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001100-exon-sc0000007-1575043694:175948..176071TCONS_00001100-exon-sc0000007-1575043694:175948..176071Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:172796..172987TCONS_00001100-exon-sc0000007-1575043694:172796..172987Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:172451..172572TCONS_00001100-exon-sc0000007-1575043694:172451..172572Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:171720..171971TCONS_00001100-exon-sc0000007-1575043694:171720..171971Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:171344..171498TCONS_00001100-exon-sc0000007-1575043694:171344..171498Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:170480..170572TCONS_00001100-exon-sc0000007-1575043694:170480..170572Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:170206..170240TCONS_00001100-exon-sc0000007-1575043694:170206..170240Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:169846..170003TCONS_00001100-exon-sc0000007-1575043694:169846..170003Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:169565..169698TCONS_00001100-exon-sc0000007-1575043694:169565..169698Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:168814..168972TCONS_00001100-exon-sc0000007-1575043694:168814..168972Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:168512..168622TCONS_00001100-exon-sc0000007-1575043694:168512..168622Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:168283..168396TCONS_00001100-exon-sc0000007-1575043694:168283..168396Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:167341..167424TCONS_00001100-exon-sc0000007-1575043694:167341..167424Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:166991..167085TCONS_00001100-exon-sc0000007-1575043694:166991..167085Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:166650..166727TCONS_00001100-exon-sc0000007-1575043694:166650..166727Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:166203..166325TCONS_00001100-exon-sc0000007-1575043694:166203..166325Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1575043694:165814..165976TCONS_00001100-exon-sc0000007-1575043694:165814..165976Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:175948..176071TCONS_00001100-exon-sc0000007-1510915933:175948..176071Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:172796..172987TCONS_00001100-exon-sc0000007-1510915933:172796..172987Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:172451..172572TCONS_00001100-exon-sc0000007-1510915933:172451..172572Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:171720..171971TCONS_00001100-exon-sc0000007-1510915933:171720..171971Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:171344..171498TCONS_00001100-exon-sc0000007-1510915933:171344..171498Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:170480..170572TCONS_00001100-exon-sc0000007-1510915933:170480..170572Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:170206..170240TCONS_00001100-exon-sc0000007-1510915933:170206..170240Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:169846..170003TCONS_00001100-exon-sc0000007-1510915933:169846..170003Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:169565..169698TCONS_00001100-exon-sc0000007-1510915933:169565..169698Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:168814..168972TCONS_00001100-exon-sc0000007-1510915933:168814..168972Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:168512..168622TCONS_00001100-exon-sc0000007-1510915933:168512..168622Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:168283..168396TCONS_00001100-exon-sc0000007-1510915933:168283..168396Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:167341..167424TCONS_00001100-exon-sc0000007-1510915933:167341..167424Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:166991..167085TCONS_00001100-exon-sc0000007-1510915933:166991..167085Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:166650..166727TCONS_00001100-exon-sc0000007-1510915933:166650..166727Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:166203..166325TCONS_00001100-exon-sc0000007-1510915933:166203..166325Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1510915933:165814..165976TCONS_00001100-exon-sc0000007-1510915933:165814..165976Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:175948..176071TCONS_00001100-exon-sc0000007-1491911889:175948..176071Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:172796..172987TCONS_00001100-exon-sc0000007-1491911889:172796..172987Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:172451..172572TCONS_00001100-exon-sc0000007-1491911889:172451..172572Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:171720..171971TCONS_00001100-exon-sc0000007-1491911889:171720..171971Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:171344..171498TCONS_00001100-exon-sc0000007-1491911889:171344..171498Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:170480..170572TCONS_00001100-exon-sc0000007-1491911889:170480..170572Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:170206..170240TCONS_00001100-exon-sc0000007-1491911889:170206..170240Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:169846..170003TCONS_00001100-exon-sc0000007-1491911889:169846..170003Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:169565..169698TCONS_00001100-exon-sc0000007-1491911889:169565..169698Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:168814..168972TCONS_00001100-exon-sc0000007-1491911889:168814..168972Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:168512..168622TCONS_00001100-exon-sc0000007-1491911889:168512..168622Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:168283..168396TCONS_00001100-exon-sc0000007-1491911889:168283..168396Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:167341..167424TCONS_00001100-exon-sc0000007-1491911889:167341..167424Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:166991..167085TCONS_00001100-exon-sc0000007-1491911889:166991..167085Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:166650..166727TCONS_00001100-exon-sc0000007-1491911889:166650..166727Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:166203..166325TCONS_00001100-exon-sc0000007-1491911889:166203..166325Clytia hemisphaericaexon
TCONS_00001100-exon-sc0000007-1491911889:165814..165976TCONS_00001100-exon-sc0000007-1491911889:165814..165976Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:165814..176071 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
30.2178 31.1071 11.6681 9.09662 62.537 51.2097 69.6949 77.7803 50.4756 60.1132 41.3634 37.7714 46.4763 41.6552 51.537 61.7394 69.6783 65.6913 44.7505 65.834 43.8504 45.0048 45.8475 52.4429 83.2122 75.2763 41.0421 33.0931 46.4468 40.4229
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006615Pept_C19_DUSP
IPR028135Ub_USP-typ
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
Vocabulary: Biological Process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016579 protein deubiquitination
biological_process GO:0006511 ubiquitin-dependent protein catabolic process
molecular_function GO:0004843 thiol-dependent ubiquitin-specific protease activity
molecular_function GO:0036459 thiol-dependent ubiquitinyl hydrolase activity
Blast
BLAST of TCONS_00001100 vs. Swiss-Prot (Human)
Match: UBP15 (Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 278/600 (46.33%), Postives = 404/600 (67.33%), Query Frame = 3
Query:  306 GQSWYMLDKHWYKQLKKYIEIGADNVDP-----ESENPGPIDNTPLFETA-SQNVREHLLEGSEFKLINKRGWKRLLTQFGLAEGQEPLQRTVIEHGIFRKEAKVEIYPLRLQICLFKNLENEIVKMISKTTTLDIVVKIMKEGLGIPEDEEVRLWSKFMQNTYELLLINQAKP-TTLQDHGINSGQTLVLEQKNEENKWPRQTRTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRQHSTTY----------------KPGLCGLSNLGNTCFMNSALQCLSNTTPLMKYFLANTHKSELNPTNPLGMNGKVAEGYADLMHQMWSGNQSHVSPRQFKMTVGRFAPRFSGYQQQDSQELLAFLLDGLHEDLNRVKQKPYIEIPDDKGRADEVLAQEAWTNHSKRNDSVITDNFHGLFKSTVECPECGKRSITFDPFCYLSLPLPIKRERTLKITFVPIDHSKRPIQMKVTIPKLGQTIALCEAVSKLTGVEPDKMIITDVFNSKFHKRFTRNESLSQITDKDDIFVYEIPVRIKEIDESNLAVVPIYMKTVVARSTYSSYPSTSLFWRPMLVVVPKKAANADDVYHIIIKAMRRF 2036
            G +WY++D  W+KQ KKY+  G D+ D      ++  PGPIDN+ L +   +Q+++EHL++  ++ L+   GW +L++ + L EGQEP+ R V+E G+F K  KVE+Y   L++C   N+ N + +  SK  T+D + K +++   IP+++E RLW+K+M NT+E L     KP +T+QD G+  GQ LV+EQKNE+  WPR   T    G+S+ +     SPS  S +  +  +           +Y                +PGLCGLSNLGNTCFMNSA+QCLSNT PL +YFL + ++ ELN  NPLGM G++A+ YA+L+ QMWSG  S+V+PR FK  VGRFAP+FSGYQQQD QELLAFLLDGLHEDLNR+++KPYI++ D  GR D+V+A+EAW NH KRNDS+I D FHGLFKST+ CPEC K S+TFDPFCYL+LPLP+K+ERTL++  V +D   +P+Q KV +PK+G  + LC A+S L+G+  DKMI+TD++N +FH+ F  +E+LS I ++DDI+V+EI   I   +++   ++P+ ++     S+Y+ +  +SLF +P L+ VP+     D +Y++++  M R+
Sbjct:   27 GDTWYLVDSRWFKQWKKYV--GFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPL----NKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPMQYKVVVPKIGNILDLCTALSALSGIPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEI--NINRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTE-DKLYNLLLLRMCRY 617          
The following BLAST results are available for this feature:
BLAST of TCONS_00001100 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
UBP150.000e+046.33Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo s... [more]
back to top