Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001099 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001099
Unique NameTCONS_00001099
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2934

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001099 ID=TCONS_00001099|Name=TCONS_00001099|organism=Clytia hemisphaerica|type=transcript|length=2934bp
GCGACTACGAACGAGTCTACTTTTCAGTGACTGATGTTGTGAAATCTAAA
TTAGTGGAATAAAAAAGAGAGTCGGTGGTCAATTAATCTTTGATCTTtga
caggaaaaagaagaacaCCCGACGTATCGTGAAGTTCCATTGATCAAGAA
GAATTCCATCCAACTTGAAGACTGCTTAGAATTATTCTTACAACGAGAAA
AACTAGGAGAACAAGACCCATGGTATTGTCCCGAATGTAAAGAACACAGA
CAAGCATTCAAGAAATTCGACTTATGGTCTTTACCGAAGGTCTTAGTCAT
CCATCTCAAACGGTTCTCCTACAATAAataTTGGAGAGATAAATTAGACG
CATTAGTACATTTTCCTGTAAAGGGTCTAGAATTAACAAATTACGTCATC
GATAAAAAACATCCTCGATCTGTTTACGACCTGCACGCTGTATCGaatCA
TTACGGTGGCATGGGTGGTGGACATTATACGGCGTATGGAATAAATTGTT
ACGACGGACAGTGGCATTACTTCGATGATAGTTCAGTATCCCTAGCTGAC
GAGCATTCACCTGTTTCAAAGGCGgcatatttattattttacacACGTCG
TGATGACCCTGACAGTGAGATGATGAACACAAGCGACCTCTTGACTGAAG
ATAATACTTTCATGGACGACTAACGTATGGTGTGTTAAGTAGTTTTTATT
GTCACTCGTTGACCGGTGGTTTAAACCaacaacttttaattttttgcatt
aTATTCAAAGATTCTAGTTTTATACACAATGAGTTTTTTGATGTTACGTA
TCATAGTCATTGCAAGGTTTAGTATCATAGTCATTGCAAGGTTTAGTATC
AGAGCTGAGTTAATCTTAATCTtacatgaagaaaaaaaataactagCTTA
TTGTTTGGGTTTACCAATAGTCGTGGTAGTATTTTCCGATGTTGAAAAAT
TCGTACACGAAGTATACCTGTTGATTAGAATTCTGATTGATAAATAAACT
ATTTTGAACCTGCTAATACTTCTCTTTGCATATCGTCTGTTCAACGAAAC
GGCCGAATTATCATTTTTGtagttaaactttttgttattttttgatgTTA
TACGGTTATACTAAATGTGACATGTTGCATGTTGTTAGCTCTTGAattat
ccccatttgaaattagATAGCGGTAGCCTTCACCACTTTTTAGTCTCGAG
TAGCTTTAAAACATCTCGTCTTCTAAACGAATTCTTTTCCAGAGGGTGGC
TTTCGAACGGGTCGGATTGAGTTTAACGTTAAaacgttttatttttgttt
cattttttcacgTTATGTCACTAGTAAAAACGCGTTGAATTACAAATTAG
GTTTAAATCAATTTATACTGTCGTAATATAAAATCTGTAAAAGGTTCTTT
CTTTAGTAAAGATACATTAGTATGTAACATAACAAATCGCCCTGTAATAT
TCCTTTTTATATCCCAAAATATTGTCATGACATTGGTTCAAAGATGTTTT
ACGACTGGACCTTGTTAATTTCGAACCGTATTTTACGGCTTCTACTAGAG
TTCTACTTAAGTTGCTTACTGTGGTTAtcctttaaaaaatttctaatcGT
CAAGTGCTGTACAATTGTATTAAAATGTGTGTCATTGTTATNAAAAATTG
GCTTTGTTCGAAAGGAAAGAATGTCGACGAAGAAATACTTTCGTGGTTAt
cctttaaaaaatttctaatcGCCAAGTGCTATACAATTGTATTAAAATGT
GtgtcatttttataaaaaatttacaatagtTATCCCCTATACTAAATTCC
AAATATTTCAGCTATTTATTTCCCtgtcaatcaaaagattttgtttgacg
ATCCTTGTTCATTCAATATTTTGCCGAGCTCACTGGATCTTTCGGTGGCA
GCATTCACAGCGTCGATGACAGCAGAGCGCATGCGCCCTTTCTCTAATGC
ATGGATACCTCGAATGGTACTGCCACCTGCTGAACAAACATCATCTTTTA
ACTTGCCTGGATGGTCTCCAGTCTCCTCAACCATACGGGCGGCACCGAGA
ACGGATTTAGCCGCCATTTTCATTGCCTCTTCTCGCGTCATTCCTCCTAA
AACAGCCGCGTCTGCGATGGCTTCGATGAAACAGTAGGCATAAGCGGGTC
CGCCACCTGCAAACCCGGTCACCACATCCAATAAGTTCTCTTTCACTTCA
GTGCAATAACCAACCGTGCTCATCAAGTCTTGTATCAGTTTTCGATCCGC
TTCGCGACAGTGAGGACCAAGGGCGAAACTCGAAACGCCCTCACGAAATT
GCGTGGGTGTGTTGGTCATCAGACGGGCTATTCGAGTCTTTGGTGGAAGC
AAATATTGCATGTTACGGATCTTCATCCCTGAAATAGACAAAAGGAAATa
gattttacacttttttactAGAACAGATTTTCATAATTCGGTTTGGTTAA
GCTAAGGTTTGCAGCCTTAAATCTACAGAGTCTTGATAAAACTAGAATAT
TTGTTTACCTGCAGCAAAAGATAGAAGTAGATGGTCTGGTGTGATGTGCG
GTGAAATTTCTCTTAAAACTTTGGGAAGCACTTGAGGCTTTACGGAGAGC
GCTACAAGTTTGTTTTCCTTCACTAATTTAACGTTGTCGGTGGTTGTTTT
GCATCCGAGTTTCATGACGTGAGTATCCGAAGGTGCACTCGCCCATATTT
GGTTGATTTGCAAAGCCCCAGCTGCAATGAATCCTTTAGTCAAAGTCTCA
GCTAATGTTCCTGCTCCCAGAAAAGCCAATTGTGGTATTCGAAAAGTCCT
ATACATGCTCCCCTCTTTGATGGTCAAAGTTTCAGAGGTTTTCTTCCAGA
AAATTGAGAGacaaaatcataacaaactTTTACAgtatttatcttttttc
cacGTGGGATTGGTTATGTTGTTAAGAGTGTCTT
Run BLAST on NCBI

transcript from alignment at sc0000007:159708..164646-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001099 ID=TCONS_00001099|Name=TCONS_00001099|organism=Clytia hemisphaerica|type=transcript|length=4939bp|location=Sequence derived from alignment at sc0000007:159708..164646- (Clytia hemisphaerica)
GCGACTACGAACGAGTCTACTTTTCAGTGACTGATGTTGTGAAATCTAAA TTAGTGGAATAAAAAAGAGAGTCGGTGGTCAATTAATCTTTGATCTTTGA CAGGAAAAAGAAGAACACCCGACGTATCGTGAAGTTCCATTGATCAAGAA GAATTCCATCCAACTTGAAGACTGCTTAGAATTATTCTTACAACGAGAAA AACTAGGAGAACAAGACCCATGGTAAGACATCTCAATCTTTGGGATGAGC TGGAGTTTTTACAAGATACTTCACTAATTGGTCATTTGAAGTGATAGAGA TGACGCGTTCTCTAGAAAAAGTAACAAAATTGTTTTATTACTGGTTAACG ACCAACCAAATCAAATAAGAGCTTGTAAAAACTCCAGCTTGTCCCCAATC TTTCTCATGTTTTTCAACAAATTATCAACAAGCACTCATCCCAATCAAAC ATACGATAACCTATTTTTCTTCTTAGGTATTGTCCCGAATGTAAAGAACA CAGACAAGCATTCAAGAAATTCGACTTATGGTCTTTACCGAAGGTCTTAG TCATCCATCTCAAACGGTTCTCCTACAATAAGTGAGTTTCCCTTTCCTTT CATTTTCTTCTGTTTCTAAAGAAGACGTGCTCAATGGTAATAATGGCTGA TCAACAATACATTGACCCTTCTTCTTCTATTTCTTCATTTACGCCCCCCC CCAGCGGTTTGCGTGAATGCGTAAATGGGCTTTTTTGGTTGCATAGATGC GTGAAAATTGGGAAAAAAATGCGTCAATGCGTGAACTTTCTCTTTTTCCG TTGATTATGTGATTATTTCCTGATTTTCAAATGTCTTCCCGAGTTTTCCC GAAAATTTTTCGGCTTTTCTGAAAAATCGGGTTTGCGTGAAACTCGATAA AAAGTTGCGTGTATGTGTGATTGCGTGAATTGAGGGTTCACTGGGGGGCG GGGGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGGGGGCTTGATAAAATC TTGCTTCCTTGCTTATTAGGGGGTTATCCAGGGCCAATTTTTTGTCATTT GCACGTTCGACGCACAAGTATCTTAATTGTTCTTTATTTTTTAGATATTG GAGAGATAAATTAGACGCATTAGTACATTTTCCTGTAAAGTAAGTCTGAA AACTACTATTATCCTTATATTAGGGTCACAATATATTTGACTTGATTTAA CATTGAAATTCAAACTTCTTACAATACGATCAAAATTCAGAATCAATTTT TGTGGTTTTTTTAACTAAAAATTATCTTGTTTTAGGGGTCTAGAATTAAC AAATTACGTCATCGATAAAAAACATCCTCGATCTGTTTACGACCTGCACG CTGTATCGGTAAGTGTCACGTTTATAAAATGCATCTCACTTTCTTTGATC GGTTGTTGCTGTCAAATAGTAACATTTTCATAAGATTCTCTCACTGTGGA AATTCTAAAGGAGAAGGCATATTTAATAAAGGTTTTGTTTTTAAATAAGA GTATGATACCGTTTGCTTAATCATCAATTTTAATGTACAAGCTTTTTCAC ATTGAATTGACACGGATGTGGAGCAAGATTGTTCAGAAAGAGGAAAATAA ATTTTTTGTTTATTCAGCACGAAATCGAACACAATTATAACAATAGAAGA CACCGACCTGGCATAAAATGGTGTGTCTGATATGAAACGGGAACACTTGT GTAAAACTAGAATCTTCAACCCCTCAGAAACCAGACAGCACAAAATGATT TTTACGTATTAGCCGTATTGTATAAGGGTTGCGAAGCGATCCAGACTCCA CCTCAATTCGTACGATTACATCCTTTCTAAAAAATATTTTTTTTTTTTGT AGAATCATTACGGTGGCATGGGTGGTGGACATTGTAAGAATTATACTTAG TTTTTGTCAGATTTTTTTGAGAAAAAAAATTTATGAGAATTGTTAAAAGG ACCATTCTGCCTCGCAATGAATTAAAAAATATTAACTTGGCTTCAAAGCT AGAATTTTTAGTTTTCACAACAGTGAACCTTTCTGTAACGAGAATAATGT TTGCGTTTAGATACGGCGTATGGAATAAATTGTTACGACGGACAGTGGCA TTACTTCGATGATAGTTCAGTATCCCTAGCTGACGAGCATTCACCTGTTG TAAGTATTTTAATATGTTTTCTCACGAGGGAAACATTCCTCCAAATCAGC TTTCACTTTGAGAAAGATATAACAGTTCGGTTTTTTTATAAATTACGTTA CAAAAAAAACACTATCTCGTCTTGAGTCAATGCAACTGTGTATCACTTGT GACCTATAATCATTCTTCAATGAAGGACATATTCGTTAATGAAAAGAGTA TACCTCTACAAATTTGGAATATTGATCGTCAACTATTCACCTTTTTGCTC GACGATACCATAACTTGTAAGTAAATCCATTGCATATTATCTTATGCTAT GTTTTATTTTCCCTTTTCAGTCAAAGGCGGCATATTTATTATTTTACACA CGTCGTGATGACCCTGACAGTGAGATGATGAACACAAGCGACCTCTTGAC TGAAGATAATACTTTCATGGACGACTAACGTATGGTGTGTTAAGTAGTTT TTATTGTCACTCGTTGACCGGTGGTTTAAACCAACAACTTTTAATTTTTT GCATTATATTCAAAGATTCTAGTTTTATACACAATGAGTTTTTTGATGTT ACGTATCATAGTCATTGCAAGGTTTAGTATCATAGTCATTGCAAGGTTTA GTATCAGAGCTGAGTTAATCTTAATCTTACATGAAGAAAAAAAATAACTA GCTTATTGTTTGGGTTTACCAATAGTCGTGGTAGTATTTTCCGATGTTGA AAAATTCGTACACGAAGTATACCTGTTGATTAGAATTCTGATTGATAAAT AAACTATTTTGAACCTGCTAATACTTCTCTTTGCATATCGTCTGTTCAAC GAAACGGCCGAATTATCATTTTTGTAGTTAAACTTTTTGTTATTTTTTGA TGTTATACGGTTATACTAAATGTGACATGTTGCATGTTGTTAGCTCTTGA ATTATCCCCATTTGAAATTAGATAGCGGTAGCCTTCACCACTTTTTAGTC TCGAGTAGCTTTAAAACATCTCGTCTTCTAAACGAATTCTTTTCCAGAGG GTGGCTTTCGAACGGGTCGGATTGAGTTTAACGTTAAAACGTTTTATTTT TGTTTCATTTTTTCACGTTATGTCACTAGTAAAAACGCGTTGAATTACAA ATTAGGTTTAAATCAATTTATACTGTCGTAATATAAAATCTGTAAAAGGT TCTTTCTTTAGTAAAGATACATTAGTATGTAACATAACAAATCGCCCTGT AATATTCCTTTTTATATCCCAAAATATTGTCATGACATTGGTTCAAAGAT GTTTTACGACTGGACCTTGTTAATTTCGAACCGTATTTTACGGCTTCTAC TAGAGTTCTACTTAAGTTGCTTACTGTGGTTATCCTTTAAAAAATTTCTA ATCGTCAAGTGCTGTACAATTGTATTAAAATGTGTGTCATTGTTATNAAA AATTGGCTTTGTTCGAAAGGAAAGAATGTCGACGAAGAAATACTTTCGTG GTTATCCTTTAAAAAATTTCTAATCGCCAAGTGCTATACAATTGTATTAA AATGTGTGTCATTTTTATAAAAAATTTACAATAGTTATCCCCTATACTAA ATTCCAAATATTTCAGCTATTTATTTCCCTGTCAATCAAAAGATTTTGTT TGACGATCCTTGTTCATTCAATATTTTGCCGAGCTCACTGGATCTTTCGG TGGCAGCATTCACAGCGTCGATGACAGCAGAGCGCATGCGCCCTTTCTCT AATGCATGGATACCTCGAATGGTACTGCCACCTGCTGAACAAACATCATC TTTTAACTTGCCTGGATGGTCTCCAGTCTCCTCAACCATACGGGCGGCAC CGAGAACGGATTTAGCCGCCATTTTCATTGCCTCTTCTCGCGTCATTCCT CCTAAAACAGCCGCGTCTGCGATGGCTTCGATGAAACAGTAGGCATAAGC GGGTCCGCCACCTGCAAACCCGGTCACCACATCCAATAAGTTCTCTTTCA CTTCAGTGCAATAACCAACCGTGCTCATCAAGTCTTGTATCAGTTTTCGA TCCGCTTCGCGACAGTGAGGACCAAGGGCGAAACTCGAAACGCCCTCACG AAATTGCGTGGGTGTGTTGGTCATCAGACGGGCTATTCGAGTCTTTGGTG GAAGCAAATATTGCATGTTACGGATCTTCATCCCTGAAATAGACAAAAGG AAATAGATTTTACACTTTTTTACTAGAACAGATTTTCATAATTCGGTTTG GTTAAGCTAAGGTTTGCAGCCTTAAATCTACAGAGTCTTGATAAAACTAG AATATTTGTTTACCTGCAGCAAAAGATAGAAGTAGATGGTCTGGTGTGAT GTGCGGTGAAATTTCTCTTAAAACTTTGGGAAGCACTTGAGGCTTTACGG AGAGCGCTACAAGTTTGTTTTCCTTCACTAATTTAACGTTGTCGGTGGTT GTTTTGCATCCGAGTTTCATGACGTGAGTATCCGAAGGTGCACTCGCCCA TATTTGGTTGATTTGCAAAGCCCCAGCTGCAATGAATCCTTTAGTCAAAG TCTCAGCTAATGTTCCTGCTCCCAGAAAAGCCAATTGTGGTATTCGAAAA GTCCTATACATGCTCCCCTCTTTGATGGTCAAAGTTTCAGAGGTTTTCTT CCAGAAAATTGAGAGACAAAATCATAACAAACTTTTACAGTATTTATCTT TTTTCCACGTGGGATTGGTTATGTTGTTAAGAGTGTCTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000617XLOC_000617Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001099-exon-sc0000007-1575043694:164425..164646TCONS_00001099-exon-sc0000007-1575043694:164425..164646Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1575043694:164066..164170TCONS_00001099-exon-sc0000007-1575043694:164066..164170Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1575043694:163408..163452TCONS_00001099-exon-sc0000007-1575043694:163408..163452Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1575043694:163189..163261TCONS_00001099-exon-sc0000007-1575043694:163189..163261Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1575043694:162664..162694TCONS_00001099-exon-sc0000007-1575043694:162664..162694Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1575043694:162398..162486TCONS_00001099-exon-sc0000007-1575043694:162398..162486Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1575043694:159708..162076TCONS_00001099-exon-sc0000007-1575043694:159708..162076Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1510915933:164425..164646TCONS_00001099-exon-sc0000007-1510915933:164425..164646Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1510915933:164066..164170TCONS_00001099-exon-sc0000007-1510915933:164066..164170Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1510915933:163408..163452TCONS_00001099-exon-sc0000007-1510915933:163408..163452Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1510915933:163189..163261TCONS_00001099-exon-sc0000007-1510915933:163189..163261Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1510915933:162664..162694TCONS_00001099-exon-sc0000007-1510915933:162664..162694Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1510915933:162398..162486TCONS_00001099-exon-sc0000007-1510915933:162398..162486Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1510915933:159708..162076TCONS_00001099-exon-sc0000007-1510915933:159708..162076Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1491911889:164425..164646TCONS_00001099-exon-sc0000007-1491911889:164425..164646Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1491911889:164066..164170TCONS_00001099-exon-sc0000007-1491911889:164066..164170Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1491911889:163408..163452TCONS_00001099-exon-sc0000007-1491911889:163408..163452Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1491911889:163189..163261TCONS_00001099-exon-sc0000007-1491911889:163189..163261Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1491911889:162664..162694TCONS_00001099-exon-sc0000007-1491911889:162664..162694Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1491911889:162398..162486TCONS_00001099-exon-sc0000007-1491911889:162398..162486Clytia hemisphaericaexon
TCONS_00001099-exon-sc0000007-1491911889:159708..162076TCONS_00001099-exon-sc0000007-1491911889:159708..162076Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:159708..164646 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
31.8937 33.1987 9.39006 9.32327 54.0414 42.4734 61.2311 63.6961 41.7503 50.2518 30.7052 27.895 25.6069 25.0104 29.7569 38.3322 32.9461 28.4739 16.2546 18.0243 24.2347 25.4222 43.5483 39.7646 28.3456 26.4405 34.3032 29.1122 27.5184 28.3284
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029036P5CR_dimer
IPR000304Pyrroline-COOH_reductase
IPR0089276-PGluconate_DH_C-like
Vocabulary: Molecular Function
TermDefinition
GO:0004735pyrroline-5-carboxylate reductase activity
Vocabulary: Biological Process
TermDefinition
GO:0006561proline biosynthetic process
GO:0055114oxidation-reduction process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0006561 proline biosynthetic process
molecular_function GO:0004735 pyrroline-5-carboxylate reductase activity
Blast
BLAST of TCONS_00001099 vs. Swiss-Prot (Human)
Match: P5CR3 (Pyrroline-5-carboxylate reductase 3 OS=Homo sapiens GN=PYCR3 PE=1 SV=3)

HSP 1 Score: 150.599 bits (379), Expect = 2.282e-54
Identity = 74/178 (41.57%), Postives = 114/178 (64.04%), Query Frame = -1
Query: 1870 YFLLSIS-GMKIRNMQYLLPPKTRIARLMTNTPTQFREGVSSFALGPHCREADRKLIQDLMSTVGYCTEVKENLLDVVTGFAGGGPAYAYCFIEAIADAAVLGGMTREEAMKMAAKSVLGAARMVEETGDHPGKLKDDVCSAGGSTIRGIHALEKGRMRSAVIDAVNAATERSSELGK 2400
            + L+S++ G+ +  ++ LLPP TR+ R++ N P   +EG    A G H   ++ KL+Q L+   G C EV E  +D+ TG +G G A+   F EA+A+ AV  GM    A ++AA+++LG A+M+   G HP +L+ DVC+ GG+TI G+HALE+G +R+A + AV AAT R+ EL +
Sbjct:   96 HILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSR 273          

HSP 2 Score: 82.4185 bits (202), Expect = 2.282e-54
Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = -3
Query: 2507 QLAFLGAGTLAETLTKGFIAAGALQINQIWASAPSD---THVMKLGCKTTTDNVKLVKENKLVALSVKPQVLPKVLREISPHITPDHLLLSFAAG 2782
            ++ F+GAG +A  + +G I AG ++   I ASAP+D    H   LGC+TT  N ++++   LV  + KP VLP VL E++P +T +H+L+S AAG
Sbjct:   10 RVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAG 104          
The following BLAST results are available for this feature:
BLAST of TCONS_00001099 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
P5CR32.282e-5441.57Pyrroline-5-carboxylate reductase 3 OS=Homo sapien... [more]
back to top