Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001082 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001082
Unique NameTCONS_00001082
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1772

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001082 ID=TCONS_00001082|Name=TCONS_00001082|organism=Clytia hemisphaerica|type=transcript|length=1772bp
GATCTGTTTCTTTCTCGACTGAACAACACAGCAAGACTCTCACGATGTGT
TCCGAAGCACCCTCAAACTACCGAAGACGTCGTTTTCAAATGTGCTTCTG
CTTAGTAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCCA
CCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGGA
CCAGATATTCTCACTGAGcgacgaaaaagtctgaaaggAATGACGAGACC
TGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGATA
GTACCTTTCGTTTTGCCGAAGAATTTGAGTCTATACGGGATGTCGGGAAA
TTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACCG
ATACGTCAACGTCTTACCATACGATTATACGCGAGTGAAACTATCGAGTA
TAGACGACGAACCTGGTTCGGACTATATCAACGCTAATTATATTCACGGT
TACAAGCAACCACGAGCATACATAGCCACACAAGGACCCCTCCCAAGTAC
CACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCATTG
TCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAATGTCATCAATAT
TGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGAAGTAACGCTTAA
GCACGAAACAATATATCCAGAATGGACCGAACGGGAATTTCTAATGACAT
TCGAGggCGAATCTCGATTACTCAGACATTTTCAATACACAGCATGGCCT
GACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGAC
CGTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGCT
CgGCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATATTCTGGTC
AATAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTAGTGTGTTT
AATGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGACCAATACATCT
TCATTCACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCAA
CAAATCTTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAG
TGAATCCAATCCTGTCGAACCTGCGGCTGAAGCATTattgaaagaagaag
aaaaagaagacgaGGAAGATGAAAATCTggataatgatgatgatgaaacg
AAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAAC
ACCTCCTGTATAATACGCATACTACCTCTTCATATTTgtagacttttttt
tgactttatgtTGTGTAGAAAGAAAATGGATGCCCTTTTATCGGGTAGGA
TTTCATCTTAACAAGTGATGATCAAATATCACTCACCATGCATCTCCCTC
ATACTTCGttctttaaaacatttttattgtaatttctttttaaatggaAA
TTGTAAATAGGTACactagaaatttaatttttattttgaaattttatata
aaTAGCGAGAGATAATATTAGTCTACTTTATTGTTATATTCTTCTTGGTT
TACTTTCGTTGAATTCTTTCAAGATACCGATTGGCATAAGAAGAAGCTTT
CTTTTTTGGGGGCTAAAGAAAACAAGATGATAATATAATAATTTTGTGTT
CTTATTTATTATTGTAAATAATATTCTTCACATTGAAAGTGAGGTAAAGA
AATAtcttaaaacaaacaaaag
Run BLAST on NCBI

transcript from alignment at sc0000007:60040..66337-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001082 ID=TCONS_00001082|Name=TCONS_00001082|organism=Clytia hemisphaerica|type=transcript|length=6298bp|location=Sequence derived from alignment at sc0000007:60040..66337- (Clytia hemisphaerica)
GATCTGTTTCTTTCTCGACTGAACAACACAGCAAGACTCTCACGATGTGT TCCGAAGCACCCTCAAACTACCGAAGACGTCGTTTTCAAATGTGCTTCTG CTTAGTGTAAGTCTTTACTTCCCTTTTCAACCTTTTTTTCCTTTCTTTCT GTTTTCATGCAGGGCTTTAGAGGTGGTGAATTTCCTCTGTTTTCATCGCG GAAATCTAGTTTCTTTTTCTGATTTTGAACACCCAAAAGATAATGGAGGA AGGGTGATTTCCACCATCGGTACTTTCCGACTGATGTTGTTGTGTGGGCT TCTCTTGAGTTCAGTGGGTAGTTCATCCTATGGAAAGCAATAGGAACAAA ATACAACAAGTCAATGATAGAAATTTTAATTGACTTATTCACATGGTTAG GTGAACTTTCTTTTTGTGATGAGTACTTTTATAAAAAGAGAAAGTCGAAG CTTTATTAAACTGTCTTGATCCTGTATTATAATGTTTATTTTGAACATGA GACAAAGAGAAGTGTATGAATCATGCGAGAAGTTAGTGACATCTCTTCAA TTATAAATAACATTCTTACTTCAAAGCATTCACACCACACTTCTATCGAA ATTCATACACTGTATTTAAAACAAGTTGAATGTTGCATTCTGTAACTTCG CAATGAAGAAGAAAATTTGCTGTTGATTTTCCTTTTATGGTGTTTGTATG TGTTGAATGATTGGTTTCTGCTTTGACGTGCTTCCATCTCTGACTGAGAA TCAATGTCTCATTTCATTCAAATGACATACTTTGCACTCACACAAGTCTT CTAACTGCTTTTACTGTGTATTATATTTATTAGTTGCAAAAAATTAAAAA CAAAGGGATCATTTTTGAAGATATGCGGATGTACGACTTGGTGGACGAGA ACAATGTGTTGTTTGACAAGCAAACCATCAAACGACACAATAGTCGTGAA CTGAACAACAATGAACCCGCTCTTCTCCGAAGAACTGTTTCTTTTTCCAA CACCATAAGGTGTAAATGTTCAAAACTCTTAACTTTAACACCCCATCTTC ACCGTAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCC ACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGG ACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGGT AAGTGTTTTCTCTTTTTTCTAATTTTTAGATCATGGCCGTTTGTTTATTT TTTCGAGTTTGAGCGAAACTGTTTTGTCTGAACGAGATATGTCACACTCT GAAGGGTTTCCGTCAATAGTCAATAGACTGACGGGTTTTCGGGACTTTTA AAATAATGATATTTTCCAAACAATCAGCCTGCATTAACTATATATGATGA TGTCATCATTAGGTAATGTTAAAATGCATAATTTATTACCGACGGCCCGA ACTGAGTGATAGGAAGATAATAAACGCAATAACAAATATAGAAATCGTTT TATCTTTACATCGAACATGCAATTTCACAAACATTCTTCTGATAAGAGAG GTAGCAAGCCATGTTTCAAGATAAGGCCTTTTGTTTCGCATTTTTAATAA GCATTTGAACACCCCTCGACGTGATGTATCGCTTGATTAATGATACCGTT GTAAATATAAAAGCCTGTCAAAGTGTCATTCTTCATAATATGTTGTTTTC ATAATGTATTTTCGTTTGTTTGTCAGACCTGTCTTCATCCGAGATTTTCG TGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAG AATTTGAGGTATGATGTTACCCTTTCACCACCACTTTCACAAGTTTGTGT CAAAAATGACAAACGTGAACTTTTGGAAATTAACCTTTACTTATATCTTC CCTTTCATTAATATTTGTAATAACCAAACAAGTTGACCATTTACACGCCA TAATTTCTGTACAACATTTTTTTGGATGTTATTCAAAATGGGACGGAACG TCTAATTAATGATCATTAAGTCTTTTTAAGCCATCCTTAATATTACACAA TTTCTTCTAATTATAACTTTCTTAATGTTTATCTTTCAGTCTATACGGGA TGTCGGGAANATGTTTCAATCTTTAAAGCATTAAAAGCTTTATAAATCTT TAAAGCATTAAAAGCTTTATAAGTGCATGTCATGACCTTTCAGTGGGGGC ATTTAGTGAAAGCTATGACTAGTTTAGATTTTAGATCATGGCCGTTTGTT TATTTTTTCGAGTTTGAGCGAAACTGTTTTGTCTGAACGAGATATGTCAC ATTCATTCTGAAGGGTTTCCGTCAATAGTCAATAGACTGACGGGTTTGCG GGACTTTTAAAATAATGATATTTTCCAAACAATCAGCCTGTATTAACTAT ATATGATGATGTCATCATTAGGTAATGTTAAAATGCATAATTTATTACCG ACGGCCCGAAACTGAGTGATAGGAAGATAATAAACGCAATAACAAATATA GGCATCGTTTTATCTTTACATCGAACATGCAATTTCACAAACATTCTTCT GATAAGAGAGGTAGCAAGCCATGTTTCAAGATAAGGCCTTTTGTTTCGCA TTTTTAATAAGCATTTGAACACCCCTCGACGTGTGTATCGCTTGATTAAT GATACCGTTGTAAATATAAAAGCCTGTCAAAGTGTCATTCTTCATATGCT CTTATTTTCATAATGTATTTTCGTTTGTTTGTCAGACCTGTCTTCATCCG AGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTT TTGCCGAAGAATTTGAGGTATGATGTTACCCTTTCACCACCACTTTCACA AGTTTGTGTCAAAAATGACAAACGTGAACTTTTGGAAATTAACCTTTACT TATATCTTCCCTTTCATTAATATTTGTAATAACCAAACAAGTTGACCATT TACACGCCATAATTTCTGTACAACATTTTTTTGGATGTTATTCAAAATGG GACGGAACGTCTAATTAATGATCATTAAGTCTTTTTAAGCCATCCTTAAT ATTACACAATTTCTTCTAATTATAACTTTCTTAATGTTTATCTTTCAGTC TATACGGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAG AAAATAACGGCAAAAACCGATACGTCAACGTCTTACCATGTAAGTCAAGT TTCGTTTTAGGAAAATTTTTGGCTCTGAATTGAATTTATGATTCTTTCCT TAAAGAGAGATTTTTAGAAATGTAGAAATTTTTTCTTGGTATTTCCTGTG ATGTGACCACCATGCAGTCTTTATAGAATTTCTCCTTATTAATCATCTGT ATTTTGGTTTACCAGACGATTATACGCGAGTGAAACTATCGAGTATAGAC GACGAACCTGGTTCGGACTATATCAACGCTAATTATATTCACGTGAGTTG TTGTGCATTCATCAATTTTAGCTTTTTGGATTATTATTTTTTCAAGATAA TTTTTTAACTTGCCATACCGGATCTGTTTTACAGCGGAAACAAATCAGAC TTTAATACGGTTAGAATTTCGTCTTTGTAGGGTTACAAGCAACCACGAGC ATACATAGCCACACAAGGACCCCTCCCAAGTACCACAGACCACTTCTGGC AGATGGTCTGGGAACAAAAATCTCGAATCATTGTCATGGTTACGCAATGC AATGAGAAGAATCGTGTAAAATGTCATCAATATTGGCCTGCATCAGGTTC GACGCGATACGGAGAAATCGAAGTAACGCTTAAGCACGAAACAATATATC CAGAATGGACCGAACGGGAATTTCTAATGACATTCGAGGTGAGGAAAACT TCCCACGTTTTCTTGAACAGTTGATATTGGGTTGTCTGGTTCTCACTCTT TTAACGACGTTTATGGAGAAATATTCGTCTCCTATTAATAACATGAATAA AAACAATATCTTTTATTATTTTAAAGGGCGAATCTCGATTACTCAGACAT TTTCAATACACAGCATGGCCTGACCACGGCGTACCTCGCTCATCTAAAGA AATGTTACAGTTCGTGACGACCGTTCGGTTTCATCAACGGCCCGATGACG GCCCTGTCATCTGTCATTGCTCGTAAGTTCTCTCCTCTTCACTTGCAGTA AATGACGTCATTTGTTTTCTTTCGGTTTTTAGAACAGCTCGGTAACGTAA AGGGTGAAGGGGTTGTATTTTTAGATTGGGAAATTAAACTTATTAAAAGA AGTTCTTAAAAATTTATCTTGTTCGTGCCTCCTTAACTTTTCATGCCAAC CTATCTTAATTCGGAGCAATTTTCCTTAATGATAATTTCCTACACTTTTC TTGAATAGTTTCCTCATTAAATTTAATCAGAAAATTCATGACAATCGGTT AAACCAGCTTAACGCAACCCATTAGATAAATTGCACAATTTCGTGGTGGT GAATAACCAAGGGTAGCCATTCTTTCACACAACCAATATTTACTGCGACG CTGTTAAACGCTTTTTTTCGTAATTTCTACACACACCAAACCTCAAAAAA CCCCTGACATACTTAACTTTATACTAGTTCTTTTACGGTCTGTAAGTGTT CAAAATCTCATTAATCAAGCCTTGTTGTAAACGATTGTAGGGACATAAGA TGCCATAACTTACTGCATCCTGTTATGACATAATATTAAGTAACAATTAA TTATTTTGTTTGTGTTTTAGGGCGGGAGTTGGGCGCACAGGAACTTACTT GTGTGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAATGTAGATG TTTATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCAG ACTGAGGTAATGAAATACAGACCACATTTTTAAGCATCTTCAAAACCTAA TCTTTATTCAACATTTTTACAAACCTACTGTTTTCTAGAATTGTACTCTA TACTAAAATATAGGATTGCTTTTACTTTCAGGACCAATACATCTTCATTC ACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCAACAAATC TTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAATC CAATCCTGTCGAACCTGCGGCTGAAGGTACGTTTCAAGTTTGTTTTGATA AGTAATCCTCAAGAACTGTCTTCTCAGAACGCAAAAACCGTAGATCAAGA ATAAACATAACGAATTCGAGAAAGAAACAAATCGTTTTTTGTTGGAACTT GATCAGACTTGTTTCATAATTCTGTCTTCTCAGAATGTAAAAACCATAGA CCTCATCAGATTTGATATAAAAAAATCAATCAACAAATAAACAATTTTCT AAGAAATCATAACGAACTCGTGAAAGAAACAAATCATTTTTGTTGGCACT TGATCAAATTTGTTTCATAATCTGTATGTTATCATATACAATCAGGTTTT TTACTCAATTAAGTTCGCATTACAGATCGTCTGATCTTTCGGTGAATTAC CGTGACGTCATAATAGATCACGCTGGTCTTTGATGGGAATCAGTATTAGG AAATCGCAGTTTACAAATTTATCAAGAAATTAAGAAAAGCAATTCGATTA TAAAATCTGTGATATCTTATCCCCCTGATTTCTCCATATAAATGCAACAT TGTTTGGTGAGAATTCAGCCTTTGTTCATCCCTTAATTATTTTTTCTCTC ATCTTCAGCATTATTGAAAGAAGAAGAAAAAGAAGACGAGGAAGATGAAA ATCTGGATAATGATGATGATGAAACGAAATCTGACGATTTTCTTTCCGAA GAATTCGAGAACAGCGATTTAGAAACACCTCCTGTATAATACGCATACTA CCTCTTCATATTTGTAGACTTTTTTTTGACTTTATGTTGTGTAGAAAGAA AATGGATGCCCTTTTATCGGGTAGGATTTCATCTTAACAAGTGATGATCA AATATCACTCACCATGCATCTCCCTCATACTTCGTTCTTTAAAACATTTT TATTGTAATTTCTTTTTAAATGGAAATTGTAAATAGGTACACTAGAAATT TAATTTTTATTTTGAAATTTTATATAAATAGCGAGAGATAATATTAGTCT ACTTTATTGTTATATTCTTCTTGGTTTACTTTCGTTGAATTCTTTCAAGA TACCGATTGGCATAAGAAGAAGCTTTCTTTTTTGGGGGCTAAAGAAAACA AGATGATAATATAATAATTTTGTGTTCTTATTTATTATTGTAAATAATAT TCTTCACATTGAAAGTGAGGTAAAGAAATATCTTAAAACAAACAAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000611XLOC_000611Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001082-exon-sc0000007-1575043694:66232..66337TCONS_00001082-exon-sc0000007-1575043694:66232..66337Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:65140..65280TCONS_00001082-exon-sc0000007-1575043694:65140..65280Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:63521..63602TCONS_00001082-exon-sc0000007-1575043694:63521..63602Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:63149..63239TCONS_00001082-exon-sc0000007-1575043694:63149..63239Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:62896..62972TCONS_00001082-exon-sc0000007-1575043694:62896..62972Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:62500..62757TCONS_00001082-exon-sc0000007-1575043694:62500..62757Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:62216..62361TCONS_00001082-exon-sc0000007-1575043694:62216..62361Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:61482..61617TCONS_00001082-exon-sc0000007-1575043694:61482..61617Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:61212..61356TCONS_00001082-exon-sc0000007-1575043694:61212..61356Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1575043694:60040..60629TCONS_00001082-exon-sc0000007-1575043694:60040..60629Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:66232..66337TCONS_00001082-exon-sc0000007-1510915933:66232..66337Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:65140..65280TCONS_00001082-exon-sc0000007-1510915933:65140..65280Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:63521..63602TCONS_00001082-exon-sc0000007-1510915933:63521..63602Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:63149..63239TCONS_00001082-exon-sc0000007-1510915933:63149..63239Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:62896..62972TCONS_00001082-exon-sc0000007-1510915933:62896..62972Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:62500..62757TCONS_00001082-exon-sc0000007-1510915933:62500..62757Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:62216..62361TCONS_00001082-exon-sc0000007-1510915933:62216..62361Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:61482..61617TCONS_00001082-exon-sc0000007-1510915933:61482..61617Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:61212..61356TCONS_00001082-exon-sc0000007-1510915933:61212..61356Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1510915933:60040..60629TCONS_00001082-exon-sc0000007-1510915933:60040..60629Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:66232..66337TCONS_00001082-exon-sc0000007-1491911889:66232..66337Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:65140..65280TCONS_00001082-exon-sc0000007-1491911889:65140..65280Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:63521..63602TCONS_00001082-exon-sc0000007-1491911889:63521..63602Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:63149..63239TCONS_00001082-exon-sc0000007-1491911889:63149..63239Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:62896..62972TCONS_00001082-exon-sc0000007-1491911889:62896..62972Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:62500..62757TCONS_00001082-exon-sc0000007-1491911889:62500..62757Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:62216..62361TCONS_00001082-exon-sc0000007-1491911889:62216..62361Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:61482..61617TCONS_00001082-exon-sc0000007-1491911889:61482..61617Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:61212..61356TCONS_00001082-exon-sc0000007-1491911889:61212..61356Clytia hemisphaericaexon
TCONS_00001082-exon-sc0000007-1491911889:60040..60629TCONS_00001082-exon-sc0000007-1491911889:60040..60629Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:60040..66337 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
6.44692e-06 2.93593e-09 0 0.411787 13.1682 10.7033 38.0938 32.5553 12.3977 9.64303 10.7488 5.78055 19.7809 18.0464 29.5618 31.3972 18.9292 20.8701 25.4417 21.7596 8.21348 15.5855 3.17027 9.70036 11.4544 10.4579 24.2566 20.3338 8.02107 6.46408
Blast
BLAST of TCONS_00001082 vs. Swiss-Prot (Human)
Match: PTPRB (Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens GN=PTPRB PE=1 SV=3)

HSP 1 Score: 305.064 bits (780), Expect = 3.486e-89
Identity = 142/286 (49.65%), Postives = 197/286 (68.88%), Query Frame = 3
Query:  249 PVFIRDFRAWVERSASDSTFRFAEEFESIRDVGKFERHEVADMAENNGKNRYVNVLPYDYTRVKLSSIDDEPGSDYINANYIHGYKQPRAYIATQGPLPSTTDHFWQMVWEQKSRIIVMVTQCNEKNRVKCHQYWPAS-GSTRYGEIEVTLKHETIYPEWTEREFLMTFEGE---SRLLRHFQYTAWPDHGVPRSSKEMLQFVTTVR--FHQRPDDGPVICHCSAGVGRTGTYLCVDILVNKLQTENNVDVYGVVCLMRTQRCSMVQTEDQYIFIHRVILDYLKQR 1088
            P+ I  F     +  +DS +  ++E+E ++DVG+ +  ++A + EN GKNRY N+LPYD TRVKLS++DD+P SDYINA+YI G    R YI TQGPLP T D FW+MVWEQ    IVMVTQC EK RVKC  YWPA   S  YG++ + +  E++ PEWT REF +  E +    RL+RHF YT WPDHGVP +++ ++QFV TVR   ++ P  GP + HCSAGVGRTGT++ +D ++ +L ++++VD+YG V  +R  R  MVQTE QY+++H+ + D L+ R
Sbjct: 1682 PIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRAR 1967          
The following BLAST results are available for this feature:
BLAST of TCONS_00001082 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PTPRB3.486e-8949.65Receptor-type tyrosine-protein phosphatase beta OS... [more]
back to top