Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001081 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001081
Unique NameTCONS_00001081
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1723

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001081 ID=TCONS_00001081|Name=TCONS_00001081|organism=Clytia hemisphaerica|type=transcript|length=1723bp
TTCCGAAGCACCCTCAAACTACCGAAGACGTCGTTTTCAAATGTGCTTCT
GCTTAGTAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCC
ACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGG
ACCAGATATTCTCACTGAGcgacgaaaaagtctgaaaggAATGACGAGAC
CTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGAT
AGTACCTTTCGTTTTGCCGAAGAATTTGAGTCTATACGGGATGTCGGGAA
ATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACC
GATACGTCAACGTCTTACCATACGATTATACGCGAGTGAAACTATCGAGT
ATAGACGACGAACCTGGTTCGGACTATATCAACGCTAATTATATTCACGG
TTACAAGCAACCACGAGCATACATAGCCACACAAGGACCCCTCCCAAGTA
CCACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCATT
GTCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAATGTCATCAATA
TTGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGAAGTAACGCTTA
AGCACGAAACAATATATCCAGAATGGACCGAACGGGAATTTCTAATGACA
TTCGAGggCGAATCTCGATTACTCAGACATTTTCAATACACAGCATGGCC
TGACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGA
CCGTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGC
TCgGCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATATTCTGGT
CAATAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTAGTGTGTT
TAATGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGACCAATACATC
TTCATTCACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCA
ACAAATCTTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAA
GTGAATCCAATCCTGTCGAACCTGCGGCTGAAGCATTattgaaagaagaa
gaaaaagaagacgaGGAAGATGAAAATCTggataatgatgatgatgaaac
gAAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAA
CACCTCCTGTATAATACGCATACTACCTCTTCATATTTgtagactttttt
ttgactttatgtTGTGTAGAAAGAAAATGGATGCCCTTTTATCGGGTAGG
ATTTCATCTTAACAAGTGATGATCAAATATCACTCACCATGCATCTCCCT
CATACTTCGttctttaaaacatttttattgtaatttctttttaaatggaA
ATTGTAAATAGGTACactagaaatttaatttttattttgaaattttatat
aaaTAGCGAGAGATAATATTAGTCTACTTTATTGTTATATTCTTCTTGGT
TTACTTTCGTTGAATTCTTTCAAGATACCGATTGGCATAAGAAGAAGCTT
TCTTTTTTGGGGGCTAAAGAAAACAAGATGATAATATAATAATTTTGTGT
TCTTATTTATTATTGTAAATAATATTCTTCACATTGAAAGTGAGGTAAAG
AAATAtcttaaaacaaacaaaag
Run BLAST on NCBI

transcript from alignment at sc0000007:60040..66288-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001081 ID=TCONS_00001081|Name=TCONS_00001081|organism=Clytia hemisphaerica|type=transcript|length=6249bp|location=Sequence derived from alignment at sc0000007:60040..66288- (Clytia hemisphaerica)
TTCCGAAGCACCCTCAAACTACCGAAGACGTCGTTTTCAAATGTGCTTCT GCTTAGTGTAAGTCTTTACTTCCCTTTTCAACCTTTTTTTCCTTTCTTTC TGTTTTCATGCAGGGCTTTAGAGGTGGTGAATTTCCTCTGTTTTCATCGC GGAAATCTAGTTTCTTTTTCTGATTTTGAACACCCAAAAGATAATGGAGG AAGGGTGATTTCCACCATCGGTACTTTCCGACTGATGTTGTTGTGTGGGC TTCTCTTGAGTTCAGTGGGTAGTTCATCCTATGGAAAGCAATAGGAACAA AATACAACAAGTCAATGATAGAAATTTTAATTGACTTATTCACATGGTTA GGTGAACTTTCTTTTTGTGATGAGTACTTTTATAAAAAGAGAAAGTCGAA GCTTTATTAAACTGTCTTGATCCTGTATTATAATGTTTATTTTGAACATG AGACAAAGAGAAGTGTATGAATCATGCGAGAAGTTAGTGACATCTCTTCA ATTATAAATAACATTCTTACTTCAAAGCATTCACACCACACTTCTATCGA AATTCATACACTGTATTTAAAACAAGTTGAATGTTGCATTCTGTAACTTC GCAATGAAGAAGAAAATTTGCTGTTGATTTTCCTTTTATGGTGTTTGTAT GTGTTGAATGATTGGTTTCTGCTTTGACGTGCTTCCATCTCTGACTGAGA ATCAATGTCTCATTTCATTCAAATGACATACTTTGCACTCACACAAGTCT TCTAACTGCTTTTACTGTGTATTATATTTATTAGTTGCAAAAAATTAAAA ACAAAGGGATCATTTTTGAAGATATGCGGATGTACGACTTGGTGGACGAG AACAATGTGTTGTTTGACAAGCAAACCATCAAACGACACAATAGTCGTGA ACTGAACAACAATGAACCCGCTCTTCTCCGAAGAACTGTTTCTTTTTCCA ACACCATAAGGTGTAAATGTTCAAAACTCTTAACTTTAACACCCCATCTT CACCGTAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTC CACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAG GACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGG TAAGTGTTTTCTCTTTTTTCTAATTTTTAGATCATGGCCGTTTGTTTATT TTTTCGAGTTTGAGCGAAACTGTTTTGTCTGAACGAGATATGTCACACTC TGAAGGGTTTCCGTCAATAGTCAATAGACTGACGGGTTTTCGGGACTTTT AAAATAATGATATTTTCCAAACAATCAGCCTGCATTAACTATATATGATG ATGTCATCATTAGGTAATGTTAAAATGCATAATTTATTACCGACGGCCCG AACTGAGTGATAGGAAGATAATAAACGCAATAACAAATATAGAAATCGTT TTATCTTTACATCGAACATGCAATTTCACAAACATTCTTCTGATAAGAGA GGTAGCAAGCCATGTTTCAAGATAAGGCCTTTTGTTTCGCATTTTTAATA AGCATTTGAACACCCCTCGACGTGATGTATCGCTTGATTAATGATACCGT TGTAAATATAAAAGCCTGTCAAAGTGTCATTCTTCATAATATGTTGTTTT CATAATGTATTTTCGTTTGTTTGTCAGACCTGTCTTCATCCGAGATTTTC GTGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAA GAATTTGAGGTATGATGTTACCCTTTCACCACCACTTTCACAAGTTTGTG TCAAAAATGACAAACGTGAACTTTTGGAAATTAACCTTTACTTATATCTT CCCTTTCATTAATATTTGTAATAACCAAACAAGTTGACCATTTACACGCC ATAATTTCTGTACAACATTTTTTTGGATGTTATTCAAAATGGGACGGAAC GTCTAATTAATGATCATTAAGTCTTTTTAAGCCATCCTTAATATTACACA ATTTCTTCTAATTATAACTTTCTTAATGTTTATCTTTCAGTCTATACGGG ATGTCGGGAANATGTTTCAATCTTTAAAGCATTAAAAGCTTTATAAATCT TTAAAGCATTAAAAGCTTTATAAGTGCATGTCATGACCTTTCAGTGGGGG CATTTAGTGAAAGCTATGACTAGTTTAGATTTTAGATCATGGCCGTTTGT TTATTTTTTCGAGTTTGAGCGAAACTGTTTTGTCTGAACGAGATATGTCA CATTCATTCTGAAGGGTTTCCGTCAATAGTCAATAGACTGACGGGTTTGC GGGACTTTTAAAATAATGATATTTTCCAAACAATCAGCCTGTATTAACTA TATATGATGATGTCATCATTAGGTAATGTTAAAATGCATAATTTATTACC GACGGCCCGAAACTGAGTGATAGGAAGATAATAAACGCAATAACAAATAT AGGCATCGTTTTATCTTTACATCGAACATGCAATTTCACAAACATTCTTC TGATAAGAGAGGTAGCAAGCCATGTTTCAAGATAAGGCCTTTTGTTTCGC ATTTTTAATAAGCATTTGAACACCCCTCGACGTGTGTATCGCTTGATTAA TGATACCGTTGTAAATATAAAAGCCTGTCAAAGTGTCATTCTTCATATGC TCTTATTTTCATAATGTATTTTCGTTTGTTTGTCAGACCTGTCTTCATCC GAGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGT TTTGCCGAAGAATTTGAGGTATGATGTTACCCTTTCACCACCACTTTCAC AAGTTTGTGTCAAAAATGACAAACGTGAACTTTTGGAAATTAACCTTTAC TTATATCTTCCCTTTCATTAATATTTGTAATAACCAAACAAGTTGACCAT TTACACGCCATAATTTCTGTACAACATTTTTTTGGATGTTATTCAAAATG GGACGGAACGTCTAATTAATGATCATTAAGTCTTTTTAAGCCATCCTTAA TATTACACAATTTCTTCTAATTATAACTTTCTTAATGTTTATCTTTCAGT CTATACGGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCA GAAAATAACGGCAAAAACCGATACGTCAACGTCTTACCATGTAAGTCAAG TTTCGTTTTAGGAAAATTTTTGGCTCTGAATTGAATTTATGATTCTTTCC TTAAAGAGAGATTTTTAGAAATGTAGAAATTTTTTCTTGGTATTTCCTGT GATGTGACCACCATGCAGTCTTTATAGAATTTCTCCTTATTAATCATCTG TATTTTGGTTTACCAGACGATTATACGCGAGTGAAACTATCGAGTATAGA CGACGAACCTGGTTCGGACTATATCAACGCTAATTATATTCACGTGAGTT GTTGTGCATTCATCAATTTTAGCTTTTTGGATTATTATTTTTTCAAGATA ATTTTTTAACTTGCCATACCGGATCTGTTTTACAGCGGAAACAAATCAGA CTTTAATACGGTTAGAATTTCGTCTTTGTAGGGTTACAAGCAACCACGAG CATACATAGCCACACAAGGACCCCTCCCAAGTACCACAGACCACTTCTGG CAGATGGTCTGGGAACAAAAATCTCGAATCATTGTCATGGTTACGCAATG CAATGAGAAGAATCGTGTAAAATGTCATCAATATTGGCCTGCATCAGGTT CGACGCGATACGGAGAAATCGAAGTAACGCTTAAGCACGAAACAATATAT CCAGAATGGACCGAACGGGAATTTCTAATGACATTCGAGGTGAGGAAAAC TTCCCACGTTTTCTTGAACAGTTGATATTGGGTTGTCTGGTTCTCACTCT TTTAACGACGTTTATGGAGAAATATTCGTCTCCTATTAATAACATGAATA AAAACAATATCTTTTATTATTTTAAAGGGCGAATCTCGATTACTCAGACA TTTTCAATACACAGCATGGCCTGACCACGGCGTACCTCGCTCATCTAAAG AAATGTTACAGTTCGTGACGACCGTTCGGTTTCATCAACGGCCCGATGAC GGCCCTGTCATCTGTCATTGCTCGTAAGTTCTCTCCTCTTCACTTGCAGT AAATGACGTCATTTGTTTTCTTTCGGTTTTTAGAACAGCTCGGTAACGTA AAGGGTGAAGGGGTTGTATTTTTAGATTGGGAAATTAAACTTATTAAAAG AAGTTCTTAAAAATTTATCTTGTTCGTGCCTCCTTAACTTTTCATGCCAA CCTATCTTAATTCGGAGCAATTTTCCTTAATGATAATTTCCTACACTTTT CTTGAATAGTTTCCTCATTAAATTTAATCAGAAAATTCATGACAATCGGT TAAACCAGCTTAACGCAACCCATTAGATAAATTGCACAATTTCGTGGTGG TGAATAACCAAGGGTAGCCATTCTTTCACACAACCAATATTTACTGCGAC GCTGTTAAACGCTTTTTTTCGTAATTTCTACACACACCAAACCTCAAAAA ACCCCTGACATACTTAACTTTATACTAGTTCTTTTACGGTCTGTAAGTGT TCAAAATCTCATTAATCAAGCCTTGTTGTAAACGATTGTAGGGACATAAG ATGCCATAACTTACTGCATCCTGTTATGACATAATATTAAGTAACAATTA ATTATTTTGTTTGTGTTTTAGGGCGGGAGTTGGGCGCACAGGAACTTACT TGTGTGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAATGTAGAT GTTTATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCA GACTGAGGTAATGAAATACAGACCACATTTTTAAGCATCTTCAAAACCTA ATCTTTATTCAACATTTTTACAAACCTACTGTTTTCTAGAATTGTACTCT ATACTAAAATATAGGATTGCTTTTACTTTCAGGACCAATACATCTTCATT CACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCAACAAAT CTTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAAT CCAATCCTGTCGAACCTGCGGCTGAAGGTACGTTTCAAGTTTGTTTTGAT AAGTAATCCTCAAGAACTGTCTTCTCAGAACGCAAAAACCGTAGATCAAG AATAAACATAACGAATTCGAGAAAGAAACAAATCGTTTTTTGTTGGAACT TGATCAGACTTGTTTCATAATTCTGTCTTCTCAGAATGTAAAAACCATAG ACCTCATCAGATTTGATATAAAAAAATCAATCAACAAATAAACAATTTTC TAAGAAATCATAACGAACTCGTGAAAGAAACAAATCATTTTTGTTGGCAC TTGATCAAATTTGTTTCATAATCTGTATGTTATCATATACAATCAGGTTT TTTACTCAATTAAGTTCGCATTACAGATCGTCTGATCTTTCGGTGAATTA CCGTGACGTCATAATAGATCACGCTGGTCTTTGATGGGAATCAGTATTAG GAAATCGCAGTTTACAAATTTATCAAGAAATTAAGAAAAGCAATTCGATT ATAAAATCTGTGATATCTTATCCCCCTGATTTCTCCATATAAATGCAACA TTGTTTGGTGAGAATTCAGCCTTTGTTCATCCCTTAATTATTTTTTCTCT CATCTTCAGCATTATTGAAAGAAGAAGAAAAAGAAGACGAGGAAGATGAA AATCTGGATAATGATGATGATGAAACGAAATCTGACGATTTTCTTTCCGA AGAATTCGAGAACAGCGATTTAGAAACACCTCCTGTATAATACGCATACT ACCTCTTCATATTTGTAGACTTTTTTTTGACTTTATGTTGTGTAGAAAGA AAATGGATGCCCTTTTATCGGGTAGGATTTCATCTTAACAAGTGATGATC AAATATCACTCACCATGCATCTCCCTCATACTTCGTTCTTTAAAACATTT TTATTGTAATTTCTTTTTAAATGGAAATTGTAAATAGGTACACTAGAAAT TTAATTTTTATTTTGAAATTTTATATAAATAGCGAGAGATAATATTAGTC TACTTTATTGTTATATTCTTCTTGGTTTACTTTCGTTGAATTCTTTCAAG ATACCGATTGGCATAAGAAGAAGCTTTCTTTTTTGGGGGCTAAAGAAAAC AAGATGATAATATAATAATTTTGTGTTCTTATTTATTATTGTAAATAATA TTCTTCACATTGAAAGTGAGGTAAAGAAATATCTTAAAACAAACAAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000611XLOC_000611Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001081-exon-sc0000007-1575043694:66232..66288TCONS_00001081-exon-sc0000007-1575043694:66232..66288Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:65140..65280TCONS_00001081-exon-sc0000007-1575043694:65140..65280Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:64530..64611TCONS_00001081-exon-sc0000007-1575043694:64530..64611Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:63149..63239TCONS_00001081-exon-sc0000007-1575043694:63149..63239Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:62896..62972TCONS_00001081-exon-sc0000007-1575043694:62896..62972Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:62500..62757TCONS_00001081-exon-sc0000007-1575043694:62500..62757Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:62216..62361TCONS_00001081-exon-sc0000007-1575043694:62216..62361Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:61482..61617TCONS_00001081-exon-sc0000007-1575043694:61482..61617Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:61212..61356TCONS_00001081-exon-sc0000007-1575043694:61212..61356Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1575043694:60040..60629TCONS_00001081-exon-sc0000007-1575043694:60040..60629Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:66232..66288TCONS_00001081-exon-sc0000007-1510915933:66232..66288Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:65140..65280TCONS_00001081-exon-sc0000007-1510915933:65140..65280Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:64530..64611TCONS_00001081-exon-sc0000007-1510915933:64530..64611Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:63149..63239TCONS_00001081-exon-sc0000007-1510915933:63149..63239Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:62896..62972TCONS_00001081-exon-sc0000007-1510915933:62896..62972Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:62500..62757TCONS_00001081-exon-sc0000007-1510915933:62500..62757Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:62216..62361TCONS_00001081-exon-sc0000007-1510915933:62216..62361Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:61482..61617TCONS_00001081-exon-sc0000007-1510915933:61482..61617Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:61212..61356TCONS_00001081-exon-sc0000007-1510915933:61212..61356Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1510915933:60040..60629TCONS_00001081-exon-sc0000007-1510915933:60040..60629Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:66232..66288TCONS_00001081-exon-sc0000007-1491911889:66232..66288Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:65140..65280TCONS_00001081-exon-sc0000007-1491911889:65140..65280Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:64530..64611TCONS_00001081-exon-sc0000007-1491911889:64530..64611Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:63149..63239TCONS_00001081-exon-sc0000007-1491911889:63149..63239Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:62896..62972TCONS_00001081-exon-sc0000007-1491911889:62896..62972Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:62500..62757TCONS_00001081-exon-sc0000007-1491911889:62500..62757Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:62216..62361TCONS_00001081-exon-sc0000007-1491911889:62216..62361Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:61482..61617TCONS_00001081-exon-sc0000007-1491911889:61482..61617Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:61212..61356TCONS_00001081-exon-sc0000007-1491911889:61212..61356Clytia hemisphaericaexon
TCONS_00001081-exon-sc0000007-1491911889:60040..60629TCONS_00001081-exon-sc0000007-1491911889:60040..60629Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:60040..66288 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.03839 1.21742 0 0 4.93891e-09 0 7.84795e-09 5.107e-05 2.49751 2.28237 1.15383e-09 7.0506 0.995736 2.22001 23.3833 26.3261 2.40866e-05 0.510141 9.20766 12.9851 6.02562 3.7843 11.3871 4.60285 0 0.00170639 20.5716 16.1737 19.6486 21.0835
Blast
BLAST of TCONS_00001081 vs. Swiss-Prot (Human)
Match: PTPRB (Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens GN=PTPRB PE=1 SV=3)

HSP 1 Score: 303.908 bits (777), Expect = 5.245e-89
Identity = 142/286 (49.65%), Postives = 197/286 (68.88%), Query Frame = 2
Query:  200 PVFIRDFRAWVERSASDSTFRFAEEFESIRDVGKFERHEVADMAENNGKNRYVNVLPYDYTRVKLSSIDDEPGSDYINANYIHGYKQPRAYIATQGPLPSTTDHFWQMVWEQKSRIIVMVTQCNEKNRVKCHQYWPAS-GSTRYGEIEVTLKHETIYPEWTEREFLMTFEGE---SRLLRHFQYTAWPDHGVPRSSKEMLQFVTTVR--FHQRPDDGPVICHCSAGVGRTGTYLCVDILVNKLQTENNVDVYGVVCLMRTQRCSMVQTEDQYIFIHRVILDYLKQR 1039
            P+ I  F     +  +DS +  ++E+E ++DVG+ +  ++A + EN GKNRY N+LPYD TRVKLS++DD+P SDYINA+YI G    R YI TQGPLP T D FW+MVWEQ    IVMVTQC EK RVKC  YWPA   S  YG++ + +  E++ PEWT REF +  E +    RL+RHF YT WPDHGVP +++ ++QFV TVR   ++ P  GP + HCSAGVGRTGT++ +D ++ +L ++++VD+YG V  +R  R  MVQTE QY+++H+ + D L+ R
Sbjct: 1682 PIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRAR 1967          
The following BLAST results are available for this feature:
BLAST of TCONS_00001081 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PTPRB5.245e-8949.65Receptor-type tyrosine-protein phosphatase beta OS... [more]
back to top