Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001078 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001078
Unique NameTCONS_00001078
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5928

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001078 ID=TCONS_00001078|Name=TCONS_00001078|organism=Clytia hemisphaerica|type=transcript|length=5928bp
taAAGGTGACAAAAATCTATATGATAATAAAAAGTTAGGTGGTAATGTTT
CACAGAGGTCAACGTAGAATAACAACTGTTTTACTTGGCTGGGCAGGAAT
CTCTATAATTGGAATCAGCTCTTTTGTGTTTGCTAAGAAAACAATTGATA
AACGAAGACTGGCCATTATCAAAGAGAAAGCTGCAAACAGAAGATTGAAA
GATAAGGAAAACAAGACCACCTGATAATTTTGGTTTGatATATAGACAAA
AATGTTAACGTGTGGTGTCTGGGTCAAAAGAGGAATTGCAAAAGAAGTCC
CTGATAAGATTACATTGACTGAAGAAGATCTAAAAGAGCTCATTGATGGT
ACAGAAGGAAAGTTAAGGGATGTGTTAGGGGACGATGAAGATCTTGGTTT
AGATACTGACCTTCCAACTACATCCAAAGATGATCCTGATGAAGATGATG
GCGCCGAAGAAAATGTTCAATCTACTGGTGGAAAAAATGATGAAGACGCT
GATATCATGATGGAATATGGTCTTGAGGACTATGATAATGAAGGTTCACT
GATGACAGGAGCAGGGATGTCTNTCATTTGCATGCTGGCATTGCAAGTTT
CATCTTTTTGAATTAGCTCTAACTTGGCAAATTAATTCTTGCATCAGGGA
CATGCCTTTTTGCATTGTGTAAAGACTTTATTTGCTCTACTAGTTTTCGT
TGATTTTTATGAactattttttaccaaaagtgagacttattttttgcttt
gttttggtttgttgtttttatgaTGATTCCACGACATTCCATGATGATGC
GATGgttgattgcaataaaaaacatattttcctgtTGGGCTTGGAGAAAG
TTATGGATGGATTATTGTATGAAGTATCCTAACGTATACATTTCCTATGT
AAATGTaatgaagaaagaagaagagagaagtaattttcaccaaattacGG
CGGCTTTANGGATTTGAAAGCAGttgatgatgaagaaaaagatGATGAAA
TTATAAAGAAAGACGATAATCTGTATGTTATTGGAAAAATGGAGGAAGAG
TTGAGTTGTTTGGAAGTATATGTATACAACGAAGAAGAAGACAGTCTCTA
TGTTCATCATGATATTTTGTTGGAATCCTTCCCTCTTTGTTTGGAATGGC
TCAGTTTTGATCCCTCCTTGAATGGAAAGTCAGGAAATTACGTTGCGCTT
GGAACAATGGAGCCAGAAATTCAGATTTGGGATTTGGATATTGTCAACAC
GATTGAACCTGCGTATACTTTGGCTggtcataaaaagaaaaagaaaaaga
agGGAGCATCGTCGTCCAATGCGAACCAATCAGGTCATTCAGATGCCGTT
TTGTGTCTCTCCTGGAACCCAAACGCTGTAAATGTACTTGCGAGTGGATC
TGCAGACAAGACCATCTGTTTATGGGATCTTTCAAAAGTAACCACAGTCC
ATCGGTTAACTCACCACACTGACAAGgTCCAATCAATCAAATGGCATCCT
CAAGAACCTCAATCTCTTTTGACAGGATCTTTTGATAGTACTGCTGTTGT
TCTTGACTGTCGAAGCCCGAAGgcatTCAAAGCATGGAAACTTACTGGGG
AATGTGAGCAAGTTCTATGGAACCATTTTTCACCGTACAACTTCTTTGCA
AGTTCAGATGATGGTGTAGTGAGATATTTCGACGTTCGAAGCGATGAACC
AGTATTCACATTGCACGCTCATGACCAAGCAACTACAGGGATCTCCTTAA
GCACAGAAATGAAGGGTTGTTTAACGACTGTCTCCTCTGATAAAACCATG
AAAGTGTGGGATTTCAGCACTGGAAAGCCTGCTAACATTTTATCACGTGA
CATGAAAATGGGAACGATGAGTTTTATCAATAACTGTCCAGATGCTTCAC
TCTTGTACGCAATGGGAGGTGAAAAGGAGGGTCTTAAAATGTTGAACTTA
ATGGAAACTACTCAAGGGAAGAAATATATTTCGAATATGACATCAACGAA
CAATGAAAATCAACAGGGTAATGAAGCGAGCGGAGGAAATCCCTCAACTG
ACGACGTAGCAATGGAAGCCCTGTCTACACTTTCTCTAAAAACTGATCCA
GCGAAAGAAAACAAAGAGATTGTAAAACgtaaaaagaataagaaaaagaa
gaaatgagCGCCATGGTCGTATGTATTTTTCGTTCTTTGGAAGTGGAGCA
AAAGTTTGGTCATGGCTACTTGGCTTTACAAGAACGGTGTTGAGTGAGTT
GTGAATAAATTACATCGGGAGCGAAATTTGATATTGCATTTGAGAATCCC
gaattcgaaaacatttttatatTACCCTAGCAATTACCAAATGCCAAGTC
ATAGATCTTAGACAACCTTACAACCTTATAGTTACAATATAACTCTTTAA
GGTTGCTCCCTCCTTTTGACACTCCCAAGAGtgactttcattttcaactC
GAGTTGCTTCTCATACCAAGCTTTTTTCCTAGTcctcattgttttaaatt
tttatatttttatagagatttttcatttataaatttttttttcaggctaC
GTAGAAGAGGGCTATTTATGAAAGTAGTAAGAAACATTTTGAGGATTGGT
ATTTTGACCGACATCAAATTGTTTCCAAAAATAATCGGTAATCTAAGATC
TAAGAATatatacaaatttacaaaagcgaaaatgaaaaaaagcctCCTTA
TTTAATGTTACCCAATTGTTTCCTTAGTTTAGTAATACgtgattttttcc
attttttgttcGAAACGTGAGAGCGTTTCTTTTTGTCGTCGCAGTTTTTG
TCAAGGATTAATTTCCCTTTGACTTTAGTCATGATGGGTTGACATTCgct
ttgtttttgttctttCAACATAGTTTGTAGATCATTAATTTGTTTATTCA
ATTGTTTCgtttctttttcactttctttgttttcattgttTACTAAGTTA
ATTTCATGCACCAGCACTACTGGTGTCGGTGAAGAAGGCGATTTCGTGTT
CTTGTAATATGAAGTCAGCGCTTTCTGTAAGATGGCAATTTGTTTGATAA
TTTTTGCTTTATCCTTTTCGTTTTTAGGTTTGAGAAGGTCTTCATCGGAA
GTGATCATGAGCTCGCCGCAACCACCACCCATAACTTTTTCACTTGATGA
TGATTTGCAATCTTCCtttgaagaaatattttcttcctCCTTCGAATGTT
CTTTCCTTTCAATCTTTTTATCCTCCTTCTCATCGTCCTGTAGTTTTGCC
ATCAAAGAGTCCTGCGTTTTTCCTTCCTCTTCAAAAACCTGATCTTCCTT
CTTTTTCTCCTGCCCTTTTCGTTCTTCATTTTTCTGCTTATCTTTACCCA
AGATATCCACACTTTGAGAATCCGCGTCCTGTTCCACGGGCTGGTCCATT
TTATCTTTCTCCTTCAAATGTTCAACTTTCAAATGTTGGTCGGGTTTGTC
GTTGGCTTGGTGCTTGAACTCTTCGTACTCTTTCTCCGCTTCCTGCTCTT
GTTTTTCCTTATCATAAGCGACCGGGCGTGTCGGTGTTCCAGCGGGTTTT
TCAATGGGTTTCCCGGTGACTTTGGTGACGGATTCTGTTGGTTTGGATTC
TTTCTCCGATGACTTGGATAAGGAAGGTGCTGGTTTTTCCTCCCCGTCTT
CAGTATTTGCTTTCAAACATTGCTTCATCTTGTCAACAGATTGTGCTTGA
CCACACCCAttcatttcttttggaaaaatcaaatCGTCAGGGTTCTCTTC
ATCCTTTTGTGCTGGAGTTTCTTTTGACGAGGATGAGGAAGTTGTTTTTC
CTTTGCGTGGTGACTTGGTAGTCTTTTCTTTGTTCAGTTCACTCTTGAAG
ATGTCCAATTCATGCTCATATTCTGATTGTAGTTGATccaatttttgttt
tctctcCAATAACTTTCGAAGTTTCTCTTGCTCCTCATCAACGCTTGGAA
GATCTTCGATGGGTTGATCAGGTGCGGGTTGTGTTTCAGGTGCATGACAG
GGTGCTGGACATGATGGAGGAGGAGGGGGCGGTGGAGGTGGAGGTGGAGG
TGGAGGTGGAGGTGGAGGTGGAGGCATCTCTACAAGGATTTCCTGTGCTT
GTGGAGCAGTGTGATGCATAGTAGCTGCGTGTGTTCCACAACAAGTTTCT
TGTTTCTTGTGAGCACTTGTAGGTTTATTCATGACGTGATTGTTCAGGAT
GCTCTCATCACCTTTCTCTACCACAACATCATTCGGTAGATCAAGGTCAC
CTGATTTGGTGGTGAATTTATTGATGATTCGTTGCGCTACTCGCTCCACG
TCCTTGTCTTTGGTAAACGAACTTTGATTTTTCTTGGTATCCCCTAGATC
ACCCAAATCATAGTCATTGATCTGAGGTTGTTTGTCTCGATACGTATAAT
CGATTGTCAACTTGCCTTCTTTCTTACTCGCCTCTTTTGTCTTAGCTTTT
GACTGCTGTATATATTTCTTCAGCATGTTGATTATTCTTGATTGCTCAAC
TGGCTTAGATTTGAGCTTTTCGTTTTCTTTGGGGTTTTCTTGCTCTTTTT
CATCACTTTTATTACTGGATTTTGTTTGCTCTGTAGAATCATCTTGTGTT
TGTGAATGAGGTGATTGCATCTTGGTACCCTCTTTATCATTTTGATTGAG
CTGACCGAAATGGGAAAGATTTTTGCTGTTATTTTGCTGTTCTGCACTTT
TTTCTTCATGGCTTTCCTTGGTGTCATCCTTTAGTTCACCAAACTTGGAG
AGGTTTTTCGATTTGGTGtctttttcttctgtttctTCTTTGCTCCCTTT
CTTTTCCTTCAGTTTTTCTGTCAATGCTTTCGCATCATGCACCAGCTCTT
TGAAAACGTTTGGTAGGTTCCCTTCATCCAGTTTCTTGTTTGATTTTCCA
AGAAGGAATACATAATTATCTGCTTTCCCCTTCTcttctttgactttttc
tccTTTCGCTTCTTCTCCCTCCTCCTCTTTCGTTTTTGTCTTTTCATCTG
ATTCAGCTTCTAAGAAATGAGATTAAATGTGCCGGTcaattttcaaagtc
tctctcTTCCATTTACtgacaaaaaaactcaaaaaatcaatttgttaATG
AGCGAATAAGATACAGTTGACCCCCATCTAAAAACACTAGAAGTACATCA
CATTCATACCTTGTTTATTATGATAAGGGTTTTTCTCTTCTTCACTGAAT
TCCACTTTCTTCGATTCTCCATTGCTCGCATAAGAACCATAATGTTTtaa
cttcttcttcttcttcttttggtCCTCCGTCACATCTCCACTACCCTCCT
CCACATCTTGAGGTGCTGCATGATGCTCCCCATGGTGTCCCTCTTCCTCA
TGGCCGTGTTCGTGGTGCTCCTCCTCATGGTGCTCTCCATGTTCTTCGTG
ACCGTGTCCGCCATGATGCTCTTCTTCGTGGTGCCCTTCGTCGTGGTGAC
CTTCATGGTGATGCCCCTCTTCGTGACCATGCCCTCCATGATGACCTTGA
TGATGTCCTCCACCATGGTGGCCCTCATCTTCATGTAAATCACCATGGTG
ATATTCATAAACATTGTGGTAACCAGCAGGGGTATCTTCGTGATGGTACG
TTCGTTCTTCGTGGTGTGGTTGAAATCCTCGCTCTACGTAAAAAGAGAAT
AGAGAGAGAGAAGGTAAAACGACGGGCAAACTTGATTGatcttcaatact
gattgaGATTTTGATTATTTCACGAGAGTGGTTTACTTTTTAAATGTTAT
AATGGCAAATAAAAGTCGTCCTTACCATCGTGTGTGACTTCATCTTCATG
AATAGAATGCAATTTCAAACCAGAATCTTGCAATTCTTGGATGGTTTTCA
CGAAAGCCTCGTCACCTCGTGTGATtcctccttcttcttcttcgtcgTAC
GAATGATGGTGGGGAGGGTGGAACGGCG
Run BLAST on NCBI

transcript from alignment at sc0000007:38255..51038-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001078 ID=TCONS_00001078|Name=TCONS_00001078|organism=Clytia hemisphaerica|type=transcript|length=12784bp|location=Sequence derived from alignment at sc0000007:38255..51038- (Clytia hemisphaerica)
TAAAGGTGACAAAAATCTATATGATAATAAAAAGTTAGGTGGTAATGTTT CACAGAGGTCAACGTAGAATAACAACTGTTTTACTTGGCTGGGCAGGAAT CTCTATAATTGGAATCAGCTCTTTTGTGTTTGCTAAGAAAACAATTGATA AACGAAGACTGGCCATTATCAAAGAGAAAGCTGCAAACAGAAGATTGAAA GATAAGGAAAACAAGACCACCTGATAATTTTGGTTTGGTAATCAAATTAA ATTATTCTTGCTAGCTGTTTATAAAAAAATGATTGACTAAAGGAAATTTT TTAAATGAACTAAGATTGTAAATAATTGATAATGATAGTAAAATTGTTTA ATTTTGTGTGAAATAGATAATGTTCTTTTAGAAACATTAATTTTTATGTT TTCTGAATTGTGTAGCGAATCTTAACATTAAACATTTTCAATCTTAAATA GTATCCTGTTATAAGTAGAGAAGATAGAAAGTTAAATGTTGGTCATTCTT CTGCTTCTCAATCAACTCACTTGAAAATCAATTCAAAATATATTTTAGAT ATATAGACAAAAATGTTAACGTGTGGTGTCTGGGTCAAAAGAGGAATTGC AAAAGAAGTCCCTGATAAGGTACTGACAATATTTGATAGTATTTACTCCA GAGTTATTCTATTTATTGTACTCTTTTACAAGTATAACAAAGTGACTTTC TAATTTTGTTTGTACTTTCAGATTACATTGACTGAAGAAGATCTAAAAGA GCTCATTGATGGTACAGAAGGAAAGTTAAGGTTTGCAAAATTTTGAAAAT AAAAATGTTTATAAAGCAGGAACATAATTTTAATTCATTTTTCACTACTG TACATTTTGTTCCCTTCAATAATGACACTGCTTGTTTACTCAGGGATGTG TTAGGGGACGATGAAGATCTTGGTTTAGATACTGACCTTCCAACTACATC CAAAGATGATCCTGATGAAGATGATGGCGCCGAAGAAAATGTTCAATCTA CTGGTGGAAAAAATGATGAAGACGCTGATATCATGATGGAATATGGTCTT GAGGACTATGATAATGAAGGTAATCAATAATTTTTTCAAAATGTTAAATT CTTCATCCTCTATACATTCTAATTTCCTGTCCTTCTTTTTACCCTTAAAC AAATTGTTTTTGTGGATGTGTTAAATATTTTAGATATTTCTAATCTAAAA TATTTTATACTTGTATCACATTTCAAAATTGTTTTTCATGTTTCCACTAG GTTCACTGATGACAGGAGCAGGGATGTCTNTCATTTGCATGCTGGCATTG CAAGTTTCATCTTTTTGAATTAGCTCTAACTTGGCAAATTAATTCTTGCA TCAGGGACATGCCTTTTTGCATTGTGTAAAGACTTTATTTGCTCTACTAG TTTTCGTTGATTTTTATGAACTATTTTTTACCAAAAGTGAGACTTATTTT TTGCTTTGTTTTGGTTTGTTGTTTTTATGATGATTCCACGACATTCCATG ATGATGCGATGGTTGATTGCAATAAAAAACATATTTTCCTGTTGGGCTTG GAGAAAGTTATGGATGGATTATTGTATGAAGTATCCTAACGTATACATTT CCTATGTAAATGTAATGAAGAAAGAAGAAGAGAGAAGTAATTTTCACCAA ATTACGGCGGCTTTANGGATTTGAAAGCAGTTGATGATGAAGAAAAAGAT GATGAAATTATAAAGAAAGACGATAATCTGTATGTTATTGGAAAAATGGA GGAAGAGTTGAGTTGTTTGGAAGTATATGGTAAATAGTGCTTGATCCATA GTCATTATAGAAAACCCCGGTCTTGCAATATATTGTTTTAGCTTTTTGTT CAATTTTCTTTTGTTACAAGCAAAATATAAGCCGCAATTTGCATACTTTT TGATCACGCTACCAAAATCTCCTCTTGGGATTTGTCTATTTTCTAATGAC ATAATCAAAAAGTTTGCAAAATAAATCGATTTTGGTACGTAAGGTCCATC TTTTAACAATAAAAAGAGACAAAAGCCTTCCAGATCAGTGTTTTTGCGCC CGTCAAGGGCGCCTTAATGAGGAGTACCTAGGGAAAATCTCACGATTCAG TTTTCCGGCTCGATTATTCATGTTTGTTCTCGATTATNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTGATTAAGTAAGACCAAAGTATTTTTCAACAA ATTATGGACAAAAATCCAGACGTTGCGATTATTAATTATTGTGATTGCGA TTGATTGATGCATGAGTTGGACGGCAATCGAAAATATGTTCCGTTCGCGT CAAAAATCTTCTTAAAATTATGTCGGTCGGTCGGTCGGTAGTAAATTTAG TCGGGTTTTTTGGAAAATGGTTTCAAAGTATATAGTTTTTAATATTTATT CGTTCGCTTGATGAAAAATTCTGGCAATTTTCTGACTTGTCTAACTAGGA ATTTTTGTCTGCCAAGTTGGTCAGTCGGCTGACGCGAGCGGAACATATTT TTGATTGTCGCCTTGGAGTTTTTCACCAAACTGCGATTTGATATTGAAGA CGATGGATGATTTGATGAACTTTTGGATCATTTATTATGATNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTAAAGTGTTACTGGAATTTGATTAAGTAAGA CCAAAGTATTTTTCAACAAATTATGGACAAAATCCAGTTCTTGTGGTTAT TAATTGCGATTGCGATTGATACATGGGTTTGAGTTTTCACCACTGCGATT TGCTATTGAAGACAATGGGTGGTTTGATGAACTTTTAGATAATTTATTAT GATAAAGTGTTACTGGAATTTGATTTAAGTAAGACCAAAGTATTTTTCAA CATATTATGGGCAAAAATCCAGATGGTGCGATTATTGATTATNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NACTCATTTAACATGTCATTGAAATGGTTTACAGAAACTGTAATTATTTG GGCCTCCTGCTTTTTGTTTCCTTGGTTATCACTAACCGACGTCAGTTTCC CAGAAAAAACATTGCAACGGGCGCATCATAGCCTTGGCTATTAGCTAGTT ATAATGACTATGCTTGATCATAATACTGAATAGGGTGTACAGATATTTGA TTGTGATATTATGTTAATAACAATGATTTTGTGTTCTTGCTCATGATTTG AATTCTTTTTTGCAGTATACAACGAAGAAGAAGACAGTCTCTATGTTCAT CATGATATTTTGTTGGAATCCTTCCCTCTTTGTTTGGAATGGCTCAGTTT TGATCCCTCCTTGAATGGAAAGTCAGGTAATCTACGAGAAGGTAGTATTT TTGATAGTTTTTCTCTTTTGTGACTTGATCTTATTTTTTTGGCTGTACAT TTTCTGTAACCCAAACTATAACTATAAATGCTAAAGTANGATCTTATTTT TTGCCTGTGTATTTTCTGTAACCCAAACTATAACTATAAACTCTGAAGAG TTTAACATTGTCGTTTTTCTTCAGGAAATTACGTTGCGCTTGGAACAATG GAGCCAGAAATTCAGATTTGGGATTTGGATATTGTCAACACGATTGAACC TGCGTATACTTTGGCTGGTCATAAAAAGAAAAAGAAAAAGAAGGTCTGAA AGTTTAGTACAGCTAAATAGATGAGAAAGGTTTTACCTTAAGAATCAATC TGGTTCAGGTGGTGACGTAATTTTAAGTTTAATGAAATTTACTACAACCA AACCCCACCCTTTACTCAGATAAATCCTGACTATTTTCTCCGGTATACTA TTAAAGTTATGACAATAACCTCTACACAACATCTTATGTCAAATCGTTTA TTTCTGCAGGGAGCATCGTCGTCCAATGCGAACCAATCAGGTCATTCAGA TGCCGTTTTGTGTCTCTCCTGGAACCCAAACGCTGTGTAAGATGACAAAT CAATTTTCCATCAGCATTTTGAAAGACAACTTTATCATTCATCATGAACC TGACTTATAAAACCTATTTCTCTAGAAATGTACTTGCGAGTGGATCTGCA GACAAGACCATCTGTTTATGGGATCTTTCAAAAGTAACCACAGTCCATCG GTTAACTCACCACACTGACAAGGTAAGCAGAAATCTGATTGATGTTTTGA CTTTCCATACTTTTTTGGTACAATGAAATTTATAATATAAAAACACATCA AGCAGAATTAAAGATTTGTTTTAAAAATTTATTTTCTTAGGTCCAATCAA TCAAATGGCATCCTCAAGAACCTCAATCTCTTTTGACAGGATCTTTTGAT AGGTAATTTAGCTTTGTTGACTTTATCAGAATTGAAATTTTGCACATCTT ATTAGTGTCTTGACACGGAATTAGTAGTGGTTTACTTGTCATATTTTTAA GAAGATATTTTGAAATTGAGATTAGATAGACTCGATTATAATATTGCACT ATTATGGGACTGTTATCCTCAACCAAGTACGTCTGTTCTCATGAAAAAGA AGAATATTGCTAACTTGATGAAATGCAATCTACATATGAAGATGTATCAT AATTTTGGGTATCTAAAGCTTTCATTATTGTGAGGATATTTTCTCATTTT AGTACTGCTGTTGTTCTTGACTGTCGAAGCCCGAAGGTATGTTTATTATG AATATGAATCGCTTTTTTTGCATACTGCCTTGTAACTTCAGGTAAAGACA CTTCATTGAGCGACGTTTTAACAACCTTTTTTTAATTTTTCAGGCATTCA AAGCATGGAAACTTACTGGGGAATGTGAGCAAGTTCTATGGAACCATTTT TCACCGTACAACTTCTTTGTAAGTCTATAAAGTAACTGTTCATTTGAAGA AAATGTCATCTCCTAATTACAGATTTTTCGCCAAGTATTGTCTTCTTTAC CGTAGCTTACATCAACATGGGAATGATCTGAAAACGAACCAACTATATTA CTTTTGTAGGCAAGTTCAGATGATGGTGTAGTGAGATATTTCGACGTTCG AAGCGATGAACCAGTATTCACATTGCACGCTCATGACCAAGCAACTACAG GTAGAACATCTTTTGCTCAATTGTTGGCCTTCGAAAAAACTAAAACAATC TTATACTTATTAAGGTATTCTCAAATTGCAACTTTGTTATCGGCTCTCTT ATGTTTATCATTCGTATTTTTCAGGGATCTCCTTAAGCACAGAAATGAAG GGTTGTTTAACGACTGTCTCCTCTGATAAAACCATGAAAGTGTGGGATTT CAGCACTGGAAAGCCTGCTAACATTTTATCACGTGACATGAAAATGGTAA GCTTTCACTTTGAATAGGAAGTTGAAGATCCAATTGTATGACTACAAATA CCTTTCCATAGATGTCATCAGTCTACAAGGGGATGCAATTATCCTTTGAA TACTTAATTTCCGCCGCTACTTGTTGAATATAAAATTGGAAACAACTTTC AGAAATTTTCCAACCATGTTGAATGTATCTTAAAGGAAGTAATATTCGCG GACCCAAATACCCACAAACTTATCCACACTTAAAGTCATGAAATTGGTAA ATACCGCCAAATATACAAAATGCACACTGGATGTCCAGGTACTCCCCTCT TTACCATGCTGATTAATTAATTATTTTTAGGGAACGATGAGTTTTATCAA TAACTGTCCAGATGCTTCACTCTTGTACGCAATGGGAGGTGAAAAGGAGG GTCTTAAAATGTTGAACTTAATGGAAACTACTCAAGGTAATCTAAACCGT AGCTGTACATACAATCCTCTTCAGTTGAAGAGAAAAACATAATAAATTGT TTTAGCCACTGCCTCTGTCACAAACATCCTAAAAGGCTTAAACTCTCCCA ACAAAATAAGATAATCCCATTGATTTTAAGATTTAGGGATTGAAAAAATG TGTAAGAATATCTGATAAATTGATTTTTATAAGTTATTGCTTTATTTTTG CTCCTATGGTTGGAATACTTATTTTGACTATGGTAAAAGTTTTTGGTCAA CGAACCCAGGAACATGTTGTTTCAAGATTATTATTCATTTTTTATTATTC AGGGAAGAAATATATTTCGAATATGACATCAACGAACAATGAAAATCAAC AGGTAACGTTGCGATATATTATGTTTTCGTTCCCTCTGTACGTAAGGGAT ATTTTTAATCAACGGAGATTAAAATTAGTATGGACATAAACGGGGCTGTT GCTTAATGAAAATCTTGTAGACTTTCATTACTTTTCATTTTGATTAAAAA ATTTCTTATTTTTACAATTCAGGGTAATGAAGCGAGCGGAGGAAATCCCT CAACTGACGACGTAGCAATGGAAGCCCTGTCTACACTTTCTCTAAAAACT GATCCAGCGAAAGAAAACAAAGAGATTGTAAAACGTAAAAAGAATAAGAA AAAGAAGAAATGAGCGCCATGGTCGTATGTATTTTTCGTTCTTTGGAAGT GGAGCAAAAGTTTGGTCATGGCTACTTGGCTTTACAAGAACGGTGTTGAG TGAGTTGTGAATAAATTACATCGGGAGCGAAATTTGATATTGCATTTGAG AATCCCGAATTCGAAAACATTTTTATATTACCCTAGCAATTACCAAATGC CAAGTCATAGATCTTAGACAACCTTACAACCTTATAGTTACAATATAACT CTTTAAGGTTGCTCCCTCCTTTTGACACTCCCAAGAGTGACTTTCATTTT CAACTCGAGTTGCTTCTCATACCAAGCTTTTTTCCTAGTCCTCATTGTTT TAAATTTTTATATTTTTATAGAGATTTTTCATTTATAAATTTTTTTTTCA GGCTACGTAGAAGAGGGCTATTTATGAAAGTAGTAAGAAACATTTTGAGG ATTGGTATTTTGACCGACATCAAATTGTTTCCAAAAATAATCGGTAATCT AAGATCTAAGAATATATACAAATTTACAAAAGCGAAAATGAAAAAAAGCC TCCTTATTTAATGTTACCCAATTGTTTCCTTAGTTTAGTAATACGTGATT TTTTCCATTTTTTGTTCGAAACGTGAGAGCGTTTCTTTTTGTCGTCGCAG TTTTTGTCAAGGATTAATTTCCCTTTGACTTTAGTCATGATGGGTTGACA TTCGCTTTGTTTTTGTTCTTTCAACATAGTTTGTAGATCATTAATTTGTT TATTCAATTGTTTCGTTTCTTTTTCACTTTCTTTGTTTTCATTGTTTACT AAGTTAATTTCATGCACCAGCACTACTGGTGTCGGTGAAGAAGGCGATTT CGTGTTCTTGTAATATGAAGTCAGCGCTTTCTGTAAGATGGCAATTTGTT TGATAATTTTTGCTTTATCCTTTTCGTTTTTAGGTTTGAGAAGGTCTTCA TCGGAAGTGATCATGAGCTCGCCGCAACCACCACCCATAACTTTTTCACT TGATGATGATTTGCAATCTTCCTTTGAAGAAATATTTTCTTCCTCCTTCG AATGTTCTTTCCTTTCAATCTTTTTATCCTCCTTCTCATCGTCCTGTAGT TTTGCCATCAAAGAGTCCTGCGTTTTTCCTTCCTCTTCAAAAACCTGATC TTCCTTCTTTTTCTCCTGCCCTTTTCGTTCTTCATTTTTCTGCTTATCTT TACCCAAGATATCCACACTTTGAGAATCCGCGTCCTGTTCCACGGGCTGG TCCATTTTATCTTTCTCCTTCAAATGTTCAACTTTCAAATGTTGGTCGGG TTTGTCGTTGGCTTGGTGCTTGAACTCTTCGTACTCTTTCTCCGCTTCCT GCTCTTGTTTTTCCTTATCATAAGCGACCGGGCGTGTCGGTGTTCCAGCG GGTTTTTCAATGGGTTTCCCGGTGACTTTGGTGACGGATTCTGTTGGTTT GGATTCTTTCTCCGATGACTTGGATAAGGAAGGTGCTGGTTTTTCCTCCC CGTCTTCAGTATTTGCTTTCAAACATTGCTTCATCTTGTCAACAGATTGT GCTTGACCACACCCATTCATTTCTTTTGGAAAAATCAAATCGTCAGGGTT CTCTTCATCCTTTTGTGCTGGAGTTTCTTTTGACGAGGATGAGGAAGTTG TTTTTCCTTTGCGTGGTGACTTGGTAGTCTTTTCTTTGTTCAGTTCACTC TTGAAGATGTCCAATTCATGCTCATATTCTGATTGTAGTTGATCCAATTT TTGTTTTCTCTCCAATAACTTTCGAAGTTTCTCTTGCTCCTCATCAACGC TTGGAAGATCTTCGATGGGTTGATCAGGTGCGGGTTGTGTTTCAGGTGCA TGACAGGGTGCTGGACATGATGGAGGAGGAGGGGGCGGTGGAGGTGGAGG TGGAGGTGGAGGTGGAGGTGGAGGTGGAGGCATCTCTACAAGGATTTCCT GTGCTTGTGGAGCAGTGTGATGCATAGTAGCTGCGTGTGTTCCACAACAA GTTTCTTGTTTCTTGTGAGCACTTGTAGGTTTATTCATGACGTGATTGTT CAGGATGCTCTCATCACCTTTCTCTACCACAACATCATTCGGTAGATCAA GGTCACCTGATTTGGTGGTGAATTTATTGATGATTCGTTGCGCTACTCGC TCCACGTCCTTGTCTTTGGTAAACGAACTTTGATTTTTCTTGGTATCCCC TAGATCACCCAAATCATAGTCATTGATCTGAGGTTGTTTGTCTCGATACG TATAATCGATTGTCAACTTGCCTTCTTTCTTACTCGCCTCTTTTGTCTTA GCTTTTGACTGCTGTATATATTTCTTCAGCATGTTGATTATTCTTGATTG CTCAACTGGCTTAGATTTGAGCTTTTCGTTTTCTTTGGGGTTTTCTTGCT CTTTTTCATCACTTTTATTACTGGATTTTGTTTGCTCTGTAGAATCATCT TGTGTTTGTGAATGAGGTGATTGCATCTTGGTACCCTCTTTATCATTTTG ATTGAGCTGACCGAAATGGGAAAGATTTTTGCTGTTATTTTGCTGTTCTG CACTTTTTTCTTCATGGCTTTCCTTGGTGTCATCCTTTAGTTCACCAAAC TTGGAGAGGTTTTTCGATTTGGTGTCTTTTTCTTCTGTTTCTTCTTTGCT CCCTTTCTTTTCCTTCAGTTTTTCTGTCAATGCTTTCGCATCATGCACCA GCTCTTTGAAAACGTTTGGTAGGTTCCCTTCATCCAGTTTCTTGTTTGAT TTTCCAAGAAGGAATACATAATTATCTGCTTTCCCCTTCTCTTCTTTGAC TTTTTCTCCTTTCGCTTCTTCTCCCTCCTCCTCTTTCGTTTTTGTCTTTT CATCTGATTCAGCTTCTAAGAAATGAGATTAAATGTGCCGGTCAATTTTC AAAGTCTCTCTCTTCCATTTACTGACAAAAAAACTCAAAAAATCAATTTG TTAATGAGCGAATAAGATACAGTTGACCCCCATCTAAAAACACTAGAAGT ACATCACATTCATACCTTGTTTATTATGATAAGGGTTTTTCTCTTCTTCA CTGAATTCCACTTTCTTCGATTCTCCATTGCTCGCATAAGAACCATAATG TTTTAACTTCTTCTTCTTCTTCTTTTGGTCCTCCGTCACATCTCCACTAC CCTCCTCCACATCTTGAGGTGCTGCATGATGCTCCCCATGGTGTCCCTCT TCCTCATGGCCGTGTTCGTGGTGCTCCTCCTCATGGTGCTCTCCATGTTC TTCGTGACCGTGTCCGCCATGATGCTCTTCTTCGTGGTGCCCTTCGTCGT GGTGACCTTCATGGTGATGCCCCTCTTCGTGACCATGCCCTCCATGATGA CCTTGATGATGTCCTCCACCATGGTGGCCCTCATCTTCATGTAAATCACC ATGGTGATATTCATAAACATTGTGGTAACCAGCAGGGGTATCTTCGTGAT GGTACGTTCGTTCTTCGTGGTGTGGTTGAAATCCTCGCTCTACGTAAAAA GAGAATAGAGAGAGAGAAGGTAAAACGACGGGCAAACTTGATTGATCTTC AATACTGATTGAGATTTTGATTATTTCACGAGAGTGGTTTACTTTTTAAA TGTTATAATGGCAAATAAAAGTCGTCCTTACCATCGTGTGTGACTTCATC TTCATGAATAGAATGCAATTTCAAACCAGAATCTTGCAATTCTTGGATGG TTTTCACGAAAGCCTCGTCACCTCGTGTGATTCCTCCTTCTTCTTCTTCG TCGTACGAATGATGGTGGGGAGGGTGGAACGGCG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000610XLOC_000610Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001078-exon-sc0000007-1575043694:50802..51038TCONS_00001078-exon-sc0000007-1575043694:50802..51038Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:50420..50490TCONS_00001078-exon-sc0000007-1575043694:50420..50490Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:50259..50317TCONS_00001078-exon-sc0000007-1575043694:50259..50317Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:49970..50145TCONS_00001078-exon-sc0000007-1575043694:49970..50145Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:49260..49788TCONS_00001078-exon-sc0000007-1575043694:49260..49788Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:45113..45223TCONS_00001078-exon-sc0000007-1575043694:45113..45223Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:44796..44914TCONS_00001078-exon-sc0000007-1575043694:44796..44914Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:44503..44579TCONS_00001078-exon-sc0000007-1575043694:44503..44579Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:44317..44413TCONS_00001078-exon-sc0000007-1575043694:44317..44413Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:44137..44198TCONS_00001078-exon-sc0000007-1575043694:44137..44198Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:43803..43836TCONS_00001078-exon-sc0000007-1575043694:43803..43836Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:43621..43695TCONS_00001078-exon-sc0000007-1575043694:43621..43695Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:43389..43479TCONS_00001078-exon-sc0000007-1575043694:43389..43479Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:43143..43264TCONS_00001078-exon-sc0000007-1575043694:43143..43264Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:42703..42808TCONS_00001078-exon-sc0000007-1575043694:42703..42808Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:42337..42386TCONS_00001078-exon-sc0000007-1575043694:42337..42386Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1575043694:38255..42166TCONS_00001078-exon-sc0000007-1575043694:38255..42166Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:50802..51038TCONS_00001078-exon-sc0000007-1510915933:50802..51038Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:50420..50490TCONS_00001078-exon-sc0000007-1510915933:50420..50490Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:50259..50317TCONS_00001078-exon-sc0000007-1510915933:50259..50317Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:49970..50145TCONS_00001078-exon-sc0000007-1510915933:49970..50145Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:49260..49788TCONS_00001078-exon-sc0000007-1510915933:49260..49788Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:45113..45223TCONS_00001078-exon-sc0000007-1510915933:45113..45223Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:44796..44914TCONS_00001078-exon-sc0000007-1510915933:44796..44914Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:44503..44579TCONS_00001078-exon-sc0000007-1510915933:44503..44579Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:44317..44413TCONS_00001078-exon-sc0000007-1510915933:44317..44413Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:44137..44198TCONS_00001078-exon-sc0000007-1510915933:44137..44198Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:43803..43836TCONS_00001078-exon-sc0000007-1510915933:43803..43836Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:43621..43695TCONS_00001078-exon-sc0000007-1510915933:43621..43695Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:43389..43479TCONS_00001078-exon-sc0000007-1510915933:43389..43479Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:43143..43264TCONS_00001078-exon-sc0000007-1510915933:43143..43264Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:42703..42808TCONS_00001078-exon-sc0000007-1510915933:42703..42808Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:42337..42386TCONS_00001078-exon-sc0000007-1510915933:42337..42386Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1510915933:38255..42166TCONS_00001078-exon-sc0000007-1510915933:38255..42166Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:50802..51038TCONS_00001078-exon-sc0000007-1491911889:50802..51038Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:50420..50490TCONS_00001078-exon-sc0000007-1491911889:50420..50490Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:50259..50317TCONS_00001078-exon-sc0000007-1491911889:50259..50317Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:49970..50145TCONS_00001078-exon-sc0000007-1491911889:49970..50145Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:49260..49788TCONS_00001078-exon-sc0000007-1491911889:49260..49788Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:45113..45223TCONS_00001078-exon-sc0000007-1491911889:45113..45223Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:44796..44914TCONS_00001078-exon-sc0000007-1491911889:44796..44914Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:44503..44579TCONS_00001078-exon-sc0000007-1491911889:44503..44579Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:44317..44413TCONS_00001078-exon-sc0000007-1491911889:44317..44413Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:44137..44198TCONS_00001078-exon-sc0000007-1491911889:44137..44198Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:43803..43836TCONS_00001078-exon-sc0000007-1491911889:43803..43836Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:43621..43695TCONS_00001078-exon-sc0000007-1491911889:43621..43695Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:43389..43479TCONS_00001078-exon-sc0000007-1491911889:43389..43479Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:43143..43264TCONS_00001078-exon-sc0000007-1491911889:43143..43264Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:42703..42808TCONS_00001078-exon-sc0000007-1491911889:42703..42808Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:42337..42386TCONS_00001078-exon-sc0000007-1491911889:42337..42386Clytia hemisphaericaexon
TCONS_00001078-exon-sc0000007-1491911889:38255..42166TCONS_00001078-exon-sc0000007-1491911889:38255..42166Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:38255..51038 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.000216654 0.00131935 5.96073 6.49138 7.76041 8.43472 11.798 8.10381 17.0367 22.8466 17.2838 21.6397 7.21865 9.82644 6.97512 1.29647 5.27157 5.6864 3.21021 4.61156 4.49861 6.50038 0.000599382 0.00462716 2.81431 2.76006
Blast
BLAST of TCONS_00001078 vs. Swiss-Prot (Human)
Match: PWP1 (Periodic tryptophan protein 1 homolog OS=Homo sapiens GN=PWP1 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 3.114e-98
Identity = 159/312 (50.96%), Postives = 226/312 (72.44%), Query Frame = 1
Query: 1018 NLYVIGKMEEELSCLEVYVYNEEEDSLYVHHDILLESFPLCLEWLSFDPSLNGKSGNYVALGTMEPEIQIWDLDIVNTIEPAYTLAGHXXXXXXXGASSSNANQSGHSDAVLCLSWNPNAVNVLASGSADKTICLWDLSKVTTVHRLTHHTDKVQSIKWHPQEPQSLLTGSFDSTAVVLDCRSP-KAFKAWKLTGECEQVLWNHFSPYNFFASSDDGVVRYFDVRSDEPVFTLHAHDQATTGISLSTEMKGCLTTVSSDKTMKVWDFSTGKPANILSRDMKMGTMSFINNCPDASLLYAMGGEKEGLKMLNL 1950
            NL V G+ E++   LEV+VYN+EEDS YVHHDILL ++PL +EWL+FDPS +  +GNY+A+G M P I++WDLDIV+++EP +TL     KKKKK    S++ + GH+DAVL LSWN    NVLAS SAD T+ LWD+S       L  HTDKVQ++++HP E Q+L++GS+D +  + DCRSP ++ + W+ +G+ E+V WNHFSP +F AS+DDG V   D RSD+P+FTL+AH+   +G+ LS+++KGCL T S+DK +K+WD    +P+ + SRDMKMG +   + CPD   +YA GG+KEGL++ ++
Sbjct:  150 NLIVCGRAEQDQCNLEVHVYNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAVGNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKKGKKSSSAE-GHTDAVLDLSWNKLIRNVLASASADNTVILWDMSLGKPAASLAVHTDKVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTWNHFSPCHFLASTDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGCLVTASADKYVKIWDILGDRPSLVHSRDMKMGVLFCSSCCPDLPFIYAFGGQKEGLRVWDI 460          
The following BLAST results are available for this feature:
BLAST of TCONS_00001078 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PWP13.114e-9850.96Periodic tryptophan protein 1 homolog OS=Homo sapi... [more]
back to top