Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001070 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001070
Unique NameTCONS_00001070
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length836

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001070 ID=TCONS_00001070|Name=TCONS_00001070|organism=Clytia hemisphaerica|type=transcript|length=836bp
CTATTTCCCGCTCGAAAGAACGACCCGACTGTACAGAACGTCCTTAGGAT
TTTTCAGgtaaaaatcaaaataatggtGTTTTAATAAAGGAAAATTTCTA
ATAATGGCTGGTCATGTTTTAAGAAGAAATAGAGGAGCTTTATTCAGTTT
GAGAACAATCTTTCAACAATTTGGAAATTGCACAGAAATTCGTTCGATAT
CAACAAGTCAGATTCCTCCAGCAAAGAAGTACATCGACCACACAAAATAT
TCGATCAATGATGTCTTTGTGCTCCCTAAGAATGACCCAAGTGAAGTACA
AATCATAGAGAAGCATGGTAAAGCTTGGCATTTATTCCAAGAAGCAAAAA
CGTCTTCAATTGTGCACACTGTGAGCGGTGACTTCGATATGTACAATGGT
TTAGCTCGTGAATTTGCTGTCAATTTCAAACAAACTGATCAAAAGGCTCT
CAAAGAACACGATTTCCCACTTGGAAGTGTAGCTGTGCTACCGAACGGTG
ATCATTTCATATACTACTTGGTTATCCGTGAGAGTTGGTGGGATCGTGGA
GCCTACAGACCCTTACGTGAAGCGCTCAACTCCATGCGAAAACACGCTGC
GGAAAACGATGTCAGGTCGATCGCTATGGGACGCTTAGGAGCTCAATGTG
ATGGATTGAATTTTGTTGAAGTTCTAAAAGAAGTGAAAGATGTATTTTAT
GATTCGAATATGGAGTTAATTATTTATTCCCGAAGGGCGTGAAATATTTC
ATTGATCACTTATTTTGtgtacatttttaaaatttttatacatGTAAATT
TAtcgacaaaaagaaagaaagaattgATAATTGATG
Run BLAST on NCBI

protein sequence of TCONS_00001070-protein

>TCONS_00001070-protein ID=TCONS_00001070-protein|Name=TCONS_00001070-protein|organism=Clytia hemisphaerica|type=polypeptide|length=212bp
MAGHVLRRNRGALFSLRTIFQQFGNCTEIRSISTSQIPPAKKYIDHTKYS
INDVFVLPKNDPSEVQIIEKHGKAWHLFQEAKTSSIVHTVSGDFDMYNGL
AREFAVNFKQTDQKALKEHDFPLGSVAVLPNGDHFIYYLVIRESWWDRGA
YRPLREALNSMRKHAAENDVRSIAMGRLGAQCDGLNFVEVLKEVKDVFYD
SNMELIIYSRRA
Run BLAST on NCBI

transcript from alignment at sc0000007:1318491..1364679+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001070 ID=TCONS_00001070|Name=TCONS_00001070|organism=Clytia hemisphaerica|type=transcript|length=46189bp|location=Sequence derived from alignment at sc0000007:1318491..1364679+ (Clytia hemisphaerica)
CTATTTCCCGCTCGAAAGAACGACCCGACTGTACAGAACGTCCTTAGGAT TTTTCAGGTTTGTGGTTTgtgttaaagttttttttatttgattcttgATC ATAttcatagcttcagccaggtttctagctcccctCAACAAAGTAACgtc ccccccccaaaaaaaaatatcacgggctttcttttagtaaaaaccggaac gctttagcatacatagaataAAAGTTCAAAGCacgaagggttcaaagttc caTGCATGTCCAGACGATgccaatcgaacgaatcgaacgccgaatcaatt gaacgcaatcgaatgcaatcgaatgattgaaattcgattgccgaacgcaa tcgaatgccaatcgaatattaccgcgatTATCTCGactgattcgattgcg ttcgattagtgcctggattcgattgattcgattgattcgattgcgttcga ttgactaatgtattcgattgattcgattgattcgactaCGTTTGGTTGGC TTATGCATTTGactggttcgactggttcgacgGTTCGACTAATTGATTCT GCAGATTAACGTTGATTCTCGTTCAACATTTGAAGAGTTAAACGAGAtga ttttagcctggattctagaaaatgcagatcatgcaggcccacatgtttac tgcaggttgtgtgtcaaagcccgttggttgcgttgatttatctatcgtat cgatacttaacctccctaataagaggcgctcgaaattgaaaggaattgag gtaaattggagtctaatttaatcgaccacccgtcgaacgcagtcgaacgt aatcgaacatcaatcgaacatcaatcgaacgtaatcgaatatcaatcgaa cgtaatcgaatatcaatcgaatcaattNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNaatcgaatcgcaatcattcgattgcgttcgattgcgttcgatt gattcgattggaattttcgttcgattccgttcgattgacatcgtctgggc ATGTAGTCTCACTGCCACTggtagggtggacaggccaaaattttcccctc aatttttagaaaccaaactaattttatttgaaagtccttacctttgtgag aaaaaatgaggggtcatttattagaattggttaaagtattcccaaagtta ttccattttcaaaccacaaaaacatcaccttttcaaagaattgcctcctt acaccacgtcagcaagaaataatttttggaagcaccaaaatcgcgccaaa aatggtggatgaaatctagtcttctgTGTGAGTTTTTCCagtgcggtctg aaaatcggcccgatgactgttaaactttagcttatcgctaatgagctgga aaagGCTGgacacaagtgtttcaaccggtattccaacgaagccatatttt gatttgtacagaaatttcacccgctcaaatcaaaataacaaaatggtcaa tctcactaaagcaaaacattgccgccacggcatttccattgataaaaatt ctggtcacgtgaccatccatGATTTTAGgacaatgaaaacgcttcattcc acggattaaagttgtgtctacactaacacgcgggaaccagctagaaaaag aaagaaaaaaccgggggtcaaattaaatttttctcccttcttgcggcaaa acataaagactttaagaggccatttatttaccCCTTGTGTTATATCattt aaataaattatgtaagtaagtgatattttaagtgacaagttcattaacaa ttttattttgaagtttgtttttaaaaacaaaaccccctgctatacagtga ggctggaactttgatttttgaggattacgatgttaccagctttttagcga tttttgcctcgctaacccaaatcttgcaacctctttaccttaaaggaaga tcgaaatagagtttttcagcgttccgaaaaaaacgcaaagcaaaaatttt ttcatcttcacaggatcgattctcaacaacaaaatacatcttttggtctt tgggattgtttctgacgtttttgcttcaaagaatatcgaccactttcctt ttccccttgagcgcgcgagaaaaaaatgattagctcgcattctcgcgcgg gagaataaagatgaggcggcaatcttgcactgagggtgctacttagtttc cgccctattttgcgaccacaatagaatggtccaattacgggggtatttca aatgataaacgatgtcgttctgtatgtcagtgaggctggaacttcgattt tgaaggattacgattttaccagtcttttagcgatttttgcctcgctaacc caaatctcgcaacctctttaccttaaggaagatcgaaattagagtttttc agcattccgaaaaaaatgcagagcagaaattttttcatcttcacaggagc gattctcaacaacaaaatgcatcttttggtctttgggtttgtctctgacg tttttccttcaaagaatatcgatcactttcctttttaCCTTGAGcacgcg agaaaaaaatgattagcttgcattttcgcgcgggcgaataaagatgaggc ggcaatcttgcactgagggtgctacttagtttccgccctattttgcaccc acgatagaatggtccaaacacgggggtatttcatatgataaaaatatgtc gttctgtaagtgtttatttcctgagagatacaaatagtatattgaatgtT ATTGACTTGttcatttaagtatttttgagcgcaaatttaaatatatggtt aaataaaacacaaacgataacagttctgtttattcatcaaacccccggga aaagtttttttctcccATGGGAATTCCGAcacctaacccgattggttaat ttcggaacggcttcaagaaagtcataatggcagataattttaaaagtttc tgaggaaaatgtgtgtaatttatcgatgttgatggcttgttgattctttt aaagaaaaaagataacaggtatagctttttctaatcctggaatatcgagg ttccagctacactgtatgtgtttattttctaagagatacaaatagtatat tgaatattattaacttatttatttaagtatttttgagtccaaatttaaat atctgggtagataaaaaacaaacgatagcagttctgtttttcctcaaacc cccgggaaaagtttttttgccgactcagctattttacaaatttcggaaaa gaactcccataggaattctgaTTCATAACCCAATTGgttcatttcggaac ggcttcaagaaagttataatggcagatgattttaaaagtttctgaggaaa tgtgtgtaatttatggatgttgatggcttgttgattctttaaagaaaaaa gataacaggtatagctttttctaatcctggaatatcgaggttccagctac actgctatatgataatttcattttcttaacttatggacccatttggaagt atttgtaatacagatcgTTTGGTAGTGTAGCAGACCTGCCGACTTAAGAT GTTCATTTggcgtgagataaaaatttcgaaggaaaatcCGAAATCTTAGC CTGATATTTCCGATTTTCCGACTTCGGAAAACGGAAAAATGTTtccaaaa aattggaaaatcggggaaatttattccgaaaattggaaaatcggggaaat ttttttcccaaaaatcagaaaatcagggaaatttctttcaaatatcaaaa atgcgtgagaaatcaaacttttgaaaaattgcgtgAGACAGTGTTGGAAT GCGTGAGTCTCACgtccaatgcgtgagagttggcacctatgagtgtagtt gcagcctatacaagaattggaatctaaagtctgaagttgtaactccttgc cagtgaccctgcagagaaatttttagttggcagacactgactttaggttg gtttggaaatagttttattttgaaatgtaatcttcactttagatgaatac ttttatttatttggattcctGAAAGGTTCaacagtcaggaacagtcgccc TATTagggccaaattgaaaagtggtcaaccaaaacacaaaatcaaaaatc ttacaaacaaaataagtagctgtgatttttaaaaaaaatatcaactgaGT CGCACTTTTAGTCTCTGTAATCAGGTGATTATATCGAAACACAACTAGTG AGGtttgtcacggaaggacaagtGTTAAAATATAATGGACCTTCTTNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNacttttttcaaatatc gaattccttccgtgacaatttcaagacaaaaagttttttcaccagTTTTG TGCAAGTACACTATTCTTGATATTATTGCAAGTTATAACTAGTGGTGCCC cctaacaaaaaatgaaattacattCCAAAGCAACCTCCTTCATATTCACT TACAAGGTCTGAAATtattgtccttccgtgacactttcaccttgtccttc cgtgacggattaaaaatatcttgttatttttagaaatcttggacttcaat gggtctaatttatTGTAGGatagtgtcctacgaggtttagaaccattggg aaccagctcaaccctgtatggagctcagaataagcctaactaaggctcca gtacagcgctgtaaggttacagcgtaagcccaggcggctctggaggccta aaaaccggttttctggcaaaactactgttcccagcgggttctaaacgctc aaaattgcttcagcaccatggaaatatgctaattagagcttttggaagta gttcacttgcttgcaaggttgcgtttttacgttttttgcttttaaaaagc cttaaaaacaaacgcttaaatagagctttttaagcgcttttaagctattt tagtgaaaatttgtcagttctgcccccttcgctggacttaaatgggtcta gtccattgcaggggagtgtccttcaaggtttatgaccattgggaaccagc tcagccctgtatggagctcagaataagcttaaaactAAGGCTNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNgctccagtacagcgctgtaagcttacagcg taaagcccaggcggctctggaggcctaaaaaccggttttctggcaaaact actgttcctagctggTTTTAGAGgattctaaatcgcttcagcaccatgga aatatgctaattagagcctttggaagtagctcactggcttgcaaggtcgc atttttacgtttttttgcttaaaaaatacaatCTTTCCTGTAAAATGTCC TAATTATTATCACcattgaacaataaaaatacagttCCAAGGTTTTGAAA TGAGCTGAATAGTAACAATGGCTATGATTTATGATATGATGTGTCACTTC ACTAGTTTCAGTCAACATTTCTTACTTAattgctgattttgaaaaatagg aattttttccttccgtgacggtgtccttccgtgacactgACCTTTCTCAG TTGCAAAGGCCTGTAGccattgaaattaattttttNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTAG GAGACGTCTCTTAATCaagagacccgtctcctaatcaggaggttcacgtc tcctaattaggagacgggtgTAATTATCTTGTGAACGAAGAAACTGTGCA TAATTTGGTTGCTCCCATTGGAAaaagcacaaaaaattgattccatatgg tgattttcaagaaaatccaCCGGGggaatcaatcacaattctaataatcc ataagaaccaatcagaagtaagaatctgtcttctgaacaaaagcgtctca aaaagaaaaatggcggacatgaaaaaaaggggcttccttgtagtattagg attgtgatcgattgcaccgataaattttgataatttttttaaaactttac caattcgaggctgctctttccattaaaactagtttcaaaatgcgcggaaa agcctaaagccctttatattgagatcaaagttttatgtctcctTATTAGG AGGCAGGTCTCCTAATcaagcgaccccaagcgacctacatgtctcctaat caggagacgtctcctaataaggcaaTTGTTCCTGAGTGTTCAagatttgt ttactttttatttcaaattatttcattgatttattgagctgcaatagctg acaatagctgattgaaaaacaaagatttttgatagttatcagcgtgggct tggccgccattttgaatttcgattttttttcttctgtactcggcaattta gaggctgtttgtaatacgcgatttggcttacgcgtaacacctGGTAACAC TTGtgtggaaatgatagctaaaaacaaatttcaccactagaaagctgaaa tcctcagctttcagatagtgtatggtgcttaaatgactttttgataaata acgagattgctcacgggaattttttgacccgcattCCGCGCGATCGTGTT TAATCGCCCGCACGTGTACGCTCTGTGAATTCTGTCTGCTGTATATGGGT ACTGTATACTAGAAAAAGCTCCTCTCTTCATTCTTTTGAGAATTCAAGGA GATTGGAGAGTGTTGTAACCCCCCAGatggaaattctaattttaaagGCA CTAGCAGGGTTTACAACCCGTTTGCTGCAGTCCCACTAAAGACTAAAGAG GCTCCCGCCTGTTGGAAAtgatctaaaatcatttgtttaagaaGTTAAAT GAAATTATAAAGGTCATGGCAAATAAAGACATAGTATCGTTAATCATTAT TCGATAACTATATCATCTTAAGTGGCCGAGTGGATAAGGCGTTGAACCGG CAGATATGAGAAAGTCATTTTtgagagttcgaatcctataAATACGGTGC GTTGAagtttgtgttattttgtcagcattgaccaacctttttctgttttt atgagctcttacttattgatatttttggaaattcccgttatatttttaag aaacaaaaattttataagtAGTGTCACCTCAGCGCAGTTTGactcaagta cagtatttcaaaatggatcaggttggttagtgggtggagagtcaagagtt atgactttcccttctcttgaaaatcaaGTATTCCAAAACTTTGAACTAAA AAAATTGCATAAAAATCGACTTTCGTCTTTTTTTATTATCTTACAAACAC TTTTTTcgaaaccacaagtgaaaagaaaagcagataaaaatgattgacag gtctaaaaaatgattgacaggtgcgggtttgctcgcgcgtgttagaaatt cccgtgagcaatctcgttatttatcagcatgtcttaaatgaaaaaatccg caatcttgttaaaaaatcgcaatttcttcttatttttcgaaattccagat ggcctgtagattttcaaataaagcactttgtgatagattgtagcctaatc ttaccctgggtttactaaaaaaaccgcgattgaaaagatgaaccagctca atagagaattttccggtgccgtggtcagcgctaaataGCGTTTTCACCTC GACatcgaaaaacatgaatatctttggaaagaaaatagatacctggatgc agttttttttacttgtttccctgataattcctgattgatttaaaaaaaag aatgaacagatttggatgatttaaaggtaagtactaatgtattgaagttc atttttgtaaattcttcctcgttccgcgcaaaaaatcccaacgagtgcgc accctaccaCTGGCACTGCTGAGGAcgataaatgtttcatttcgtgacac acatcttagaactaactttttttggtggaaactcgcgaatttgtatatgt agattccaaaatcaaaaagtttccacgatattatcgtgcaagtaacgagc aATTGGCGTAATTCCAGGCAAAAtggcaaggcctggaaattcatgatttt tgggggttcttcaaattaaaaaaagacctatatatcacatgatagagctc ttcaaactgagcaacaAAGtctattacaccaaagtcccaacttctctaga tcaaaatttattggcctatttgtggtaaaaaacttttggaaaacagggaa tttccctacaatctgcattaatttatgcaaaattaaacaccttttctATA TTCTAATGTCCTTATGTTGAGAAGATGacttattttacaaaataatgatc AGATGGTCAAATATGAAGCTTCTTTGATCAATCAAAATGCTTTCCCACCA TTTTCGAAGGGGTCCATGATGGGGTCcatatcacaggaaaaaatgatCTT ATCCCAAGGTTGGAATTTAGAATTTTCCGATGTGCATTTTTCGGTTGACT TCTCTAGCCCTGGTATTTCGGAAATTGGCGAAGCGGCTTGTTTCGGAAAA AGCCAATTCCCATTTGGAATTTCAAGAATTCCAATTTGTTAGTTAAAGAT TGACAAACAGTTCCATTGCGAATATTGCCggtttccaaggttggaaaatT CTCAAATTCGGACTTTGGGAAATGCGGGTCGGAAAATTGTGTGTCCTTCT AAATTGGGTTTTAAATGAAAAACGCTCATTCCATTaggaaaattgtattt ttccAAGTCGAGATTAATTTGATTGGGAGTTGCGAAAATGCGGGTCGGAA AATCGCGTTTCCCTAACAAATTAGGTTTTAAATGAAAAACGCTCATTCCA TTaggaaaattgtatttttccAAGTCGAGATTAATTTGATTGGGACTTGC GAAATGCGGGTCGGAAAATTGTAACAAACCATTAATGTTATAACATGCTT ATCAGCTTTAAATTTACAAGTCTTCTTTACAAAAATAGTGTACATTTTGt gatatcaaaataattttttttaataagaaaaagtTAATCTTTGAAGAGAA CCATAcaaatctcaatatattattATTAGGGATGGTCAAAGAAAGTTCTT CAGAAACTGAAGGAGAATGCTCAGCAACACCAGGCTTTCATCTTTGTCTG TTTCTGTAAATTTTATTATCAATCTGTGAAAGTGTTAATCTAGATTAAAA ATCAACGGTCAGAAATAAGCAAATTCCAATCAGGTAAATTACTACAATAA GTAAGTACTATTTAATCCAATATCAATCTAgcacttcaaaatcaaaatga aaatatggtCTATGAACATCAATACATaaaaagtcattttcattttcttg ataAATGATAACAGGGCGACTAATCGCGTTTACATTTTTCACAGCCATCG CATTTGGTATCGCATTATATATAGGGGGGTCCAAGTTATGTCTTCTCCCA ACAGAAAGGtcgaaactgtttttctttgcttagtggtcagagaggaataa tcgtttttcaatcagtgattcaagctttcatattattcctgtctctgtCT AAAGatgggtgtcagaattagacgagggatgtcgatatattagaccaact tacggtatgatTTTGGAGTTGTTGTGTAGTAGCCAAGGTTCTAAAAAAGC AAGCGCTAAATACGTAGTGCAgaaaggggtctgacccccctcttcttaaa tgatcccctCTTCTTAGTGTATCCccctaacctttaaaaatgtCTATCCC CCAAAGATTGTGGAtaaaaatagctaacaaatatttgtgaaatatcttta taaGAGAGAGAGAAGAAAGCAAAAtaataaatttctttcttctttttgac tctgACTACTCAGAAACAGAAAACTTTCTTTATCTTTATCATAGACAATA CACCACCTTTCCAATGACCCTGTCGACGCACCGGACAGTCCAGTGTGTTT GTCCAGTGCCAAAAAGTATCCCTCAGCTTCTGGACACCGAACAAAGTTTG TTTGAGAAATAATGCGCACCGGACACAAGTTCGATGTTGAAATTGTCCGG TGTTAAAAAGTATCCTCATCCAACACCGGACTTTGCGTGTCCAgtgttct tttaaagtttgtatttcttcagttttcaaatgtttctattTGATGGAAAA TGTTTTAAGTGCTCCCAGACCTTtctcttgacatcaaagttttcagaATT ATCGagaactacggcaaatgtaAAATAAGCAAAGCATGAATCTACTGTGG CTTGTTAGTGCCATGTATAAACTACTTATACTTACGGGTTTTAAGTCAAC TTACAAGCACTAAATCATCTTAGTAGTTTTAAGTCAACTTAGGAGTGCTA AGTCGACTTAGAAGTGCTAAGTCAACTTTAGGAGTGCTAAGTCAACTTAG GAGTGCTAAGTCAACTTAGGAGTGGAGCGCTAAGTCAACTTAACTTAAGA GCACTAAGTCGACTTAGAAGTGCTAAGTCGATTTAGAAGTGCTAAGTCGA TTTAGAAGCACAAAGGATAAGTATAGGGAAGAAGCAGCGGGTCCTCTGTT GTTGTGTATATAGAATGGGTAAATAtaacggctagttcgaaacgcaggtc acaggtcacaggtcgcaggtcacaggtcacaggtcagtgatgacaggNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNtatatgttatgatcttattatc ttttttccggtctgcactttgttgacctgtgacctgtgacctgttgacct gtgacctgtgacctgcgtttcgaactagccggtaAATATATTGATGTACA AAGCGATATTGGGCAATATTGGGCATTTTTTGATGTGGACAAGGTATGAA AAATGTGTAAAGGCTGTGGTGGTTGTCTGTTTGTTGTATAAAAAGGGCTC AATAAAATATATTATGATTCAACAGATTCAAATAAAGACCTTCAAGGAAT CaatgatagacaaaagattttatgaatAAGATACATAGATTAGGGATCTT TTCAACTCAGCCAATGccgttttcaattttctttcaggTCCAGACCACTT TTTACATTTCACTAGATGTGCGTAAAATGATTCCCCGCGCTTTTTTTCTA AGTTGACTTAGTACGTACTCCTAAGTTGACTTGATACTCCTAAGTCGACT TAGCACTTCTAAGTTGACTTAGTACTCCTAAGTTGACTTAGCACTTCTAA GTCGACTTAGTACTTCTAAGTTGacttacagtatgtggcccccaaaatgg cgatcaaatttaaaatttctctcaaagctagaggaaaagaggttttgcaa aaatttttcttgcatgcgaaactttaacatctctactttatttcccgaca gctctttttcaaaatttccaatttcaacaatatttttcaatcgcttaaag ataggtagcttttttctaatggcccccaaaacggaggtttgcaattttag cgatttctcgagatatctttaagatattaatacaaaattttgaccatagt tttgaaatgtgatttagaggattttgggcataaatttgtttgataaaatt tttacagtatacccctggttgtcaaaatgcaggtttggggcccccaaaac agaggtgtagttaaaatcaaattattacgcccagtggtaataggaggaaa aactatgaaaataaatttgtgtttACCCTTAAATTTACAACCCGatagat gtaaaatttatgatttttatgaaatatttcaagattttcaatattcaaag tCCAAaccgaaaatttagaaattttcaaaatgacaatttagatttaacaa cgtcttaatcaagtttctgaaaatcaatgtcttttgaaaatagctccatt catgtatggaaaaaattggtgaaaatttgagaagaaaagCTTAACTGCAG TGCTGCAATTAACGGCCGGTGActggtaattaccggtcattttTAAGCTA ATATGTGTGTTTTTTCTCGTGAAATTTTGATGGTTTCATTGTTGGTGCTT TCTGATTGAGTAATCACCGGCCAACTTGAAATTCCTCATTTGCAGCACtg taactgaaactgaaaatattaagctttaaaggtatttttctcctatattt tgcaaaaaaatgacagaatttgccatttttgttgattcagcgaaaatttt tatatataatgttaattttttgttatcgATCGCCTGAGGGCGATTTTAAC AGTGTAGATATACAAGTCAAATctcgtttttgaaatcgaaagtaaatgtt tgactcgcttacctttataaactcattagtttccttacattttgtctgaa taggagagattttaaatttttttcaggcTATATCCCATCCCCTTCTTCTA AGTGTAACTTTTTTCTCTAGGGTCTACGCTTTACTTTTGCTTTGATCATG TGTTATGTACTGACTAATAATGGCAAAAGTTGCAGATCAAATAAAATGTA NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNATGTATAACAGCCTTAAGTAGTCTATTGTAT TCATCACTTTTGtattgtttatgacgtcattcccCTATCATTTCAATGTT CGTCTCATTTATCCATGTTTATTATGCCACATTATGCTTAGAGCTGTTTT AAAGCGCATgcgtaaacattttgttttttactacaacGATTTTGATAGTA AAATAAGCGTCCTGAATTGAAATTGCATGGTCTTAGTAACAAAACAACGA TAAAGTAGCTTTTTAAGAGGTAAGGTTCACTCGACTATCTTACTTGGCTT TATAATTTCGTCTAGCTGTTCTAATCTTGCCATACAGTAATTTATCAGAG ACAGATCCGCATCGCAGGGTGTTAAGTAATAAGCCAACCTTGCCCTTCTA CGACTAAacgaaaaaaagtgaaaattaatttcttagTAAACACTACAGAA GGTTCTTTCTCCGATAATTTTGTCGGAAATAAGCGATCGCCAACAGTGTG TTTGAAACACGCTGACCTAGTAAGCTATTAACTCAacctgataggaatgg aattccaagattttttgctgtttttcatatttagaattttcggtcttatc aatgctgattctagggtcccaaaatactggttgacctttaagatgctaca cgcttttttttttataagaatagtgtactttggtctCAACcatgagcatt attcttatttttctattgttctaaacaataggcctattgttttaaacccg aaatctcaccctgatattcttatagaagttattcttataaaagaaaaagc gtgtatatcttttacccatcctctaaagtcacagatgtatctgtaTTTTC TGAACGCCATTatgtgtagaaagtttcctataccccattttcataactta ttttcaatatccaaagagctagagtgagttatatgcaatttttatctaat tttggtgttaaaatatctcCTTCatacgcaaatatgttattttgaatctg tctcaaaccatgaaaaacatgctcattttttagtataaccatcattcatt ctaaataaacaaaaatcgtttaattctgataaatctacaagtcagaatcc tcattttaatgacaacctccgttttgggggccatatactgtataacTTAG AACTACTAAGTTGACTTAGTGCTTGTAAGTTGACCTGGAACCCGTAAGTA TAAGTAGTTTATACATGACACTAACAAGCCACGGTATGAAtcctttctga tcatttttaaCTTGAGAGAAAATTAACTCGATCTGAGGACacaatttgac catttttttcaAGTATGGTTAAAAGATATCTCACCCAGGACGAATCAAAC TTTGAAGCAATAGCTTAACCGACGAGTGACAATgtagtagaggccactat gtcttcccgtgtgcagcagcttgtgcaaagggattttatgattgaatatt gttccttgaatgtagaagatcaaaatttgaggNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNtgatcttctacattcaaggaacaatattcaatcataaaatcc ctttgcacaagctgctgcacacgggaagctttttcgcgacatagtggccc ctactaATGGGTACCAGCGGCTAGTACAGTATCTAATAACataatatgat tcttcaatgggaatcaaaactatgagtgcacttacaaacatcaatttgtc agatctaacaaaattaataatggcactgtcatcattgacaaaggattttc tgtcaagatcctcgtaaacattccaacaactttcatcaaaatgatctgCC GCAGCCCATGAGCTCCCGCACgagtgaaaaactttaatctgtcaatcatt ttctcaagcgaagagtaggcaaagcgattctagcttcaTGATAGTGCAgc agatcatcagtggatagtattcaattatcattatccctttatttttatAT CTGGAActttagtttaaaaaaaaagaaaaatagaaaagctcTNAATTAta attatccctttatttttatATCTGGAActttagtttaaaaaaaagaaaaa tagaaaagctctaatcacatactgaatttgaaagatcttctatgtggcgt atttttgcaaacttcaaaaaactgatttttgtcctgcttttGCAGGACTT TTAGCTTAAGTGCCTGCGTGCAGCcttgggtacaaagtccaaatatgcgt ttcccataAACTTTATATGAAGAGTTAGGGCTATACTGTCATATTATACA ACTCAAATGAATAAGTCATGGTGAAGCAATTAGattgatttctctttaaa aaatttcacaattttcttttgaaataggATGGATCATGGTCAAGTCTCCC TGGAATGCAAATCAATTCAGTTTACAAACACTTTATACTTTATCTTCTAG TTGACTTCTGGAGGGATTTGTATGAAATAACAACCTCAAACTATTTTAAT gctaaatttcaaattaaagatGAACTGACAAAAAGAAGCTAATCTGAAAA TCTTGCACAAGCTTATTACAGGGAATTTTCCCAGACTAAAACACACATTT AAACTTGCCAATTGATTGATAAAACTGCGCTGTTCTAAAGGTGGAATATt gtaaattttcattatttttgaacTTTAGACTTTGCTGATGTCTTTTTAAG CTCTATTTCCACTAGACCCTTCCACTTTACCCAGTGCAGTGTAAACACTT ACATGCTTACCCTACTAATACCTGGTCCCAGCGAGACAGTAACCTGCCCA GCGTGGTTAAACATTTTACATTGTGTGCAAAGGGTGGCTTAAGGTTCcat gaaaatgtttttatttttattcaaacaatACTGTTGGACAAATtcctttt ttcttgaaaagctaACAAGATGAAATTGATCTTTGAATGTTTGTATTTAG TTAATGACCTGAAAAGAAAAGGTCCCACCCAACCTTGTCCTCCACTAACG GAAAGAAAATCCAATCGACAGAATAGAGTAGGGGGTGCAGACTATGTATT ACAAACACATACCTGCTATAAATCTTTACGTTTTCTTTcaggtaaaaatc aaaataatggtGTTTTAATAAAGGAAAATTTCTAATAATGGCTGGTCATG TTTTAAGAAGAAATAGAGGAGCTTTATTCAGTTTGAGAACAATCTTTCAA CAATTTGGAAATTGCACAGAAATTCGTAAGTATCAGTTTCACTGATTTCT CTTAAATGTGTGGGTGTGTGTGTGTAGTTTGAGATTGTTATCTCTACGAA TTCCAAAATCTGGCTGGTAATttcttttctcgaaattcaaCGCTTATTTA TTAAAAATGGTATTCAGATGTTTCTGGTTTATGTTTCTTTATTTAATTAA ATATCTTCTTTACAAGGGATAAATCCCGTggagggggggggcactcaagt taaacgacctaccgtaggtgcggcccttaagggtcccTTCTCCAAGCTTA CCAAATTGCACTGTAAAGGTCTGACTTCAAAgacctaattttgggccgca cgtatAGTCGTTTTTTAATCGAGTGCCCCACCCCCACCGGGACAAAATTT GATAAGTAATTTCAGAAATCTTATAATCTTATTAATGCAAATCTCAAAAG ATTTGAAATATACTCCATAACAAATTATAAATTCTTGGATACAAAAAGTC TTACTAACACAATACTTgtcttataaataatttttaaattttcataattt attttgcaaacaaaATAANACTTTCGCTATGCAAAATTAATAATAATGAG CAAATACTAGTTTTACTAAACTAATAAACTTGTTTTCCTATATTTTGCGG TAAACATTTCCATTACAGAGGACGTAGTAATAGTGTTGGTATAATTTTCC GTTACACATGTTTGTTTTGGTGGTGGCGATTCCATTTTGGTAAGTTTGTG ATAAAATGTCATATATTCCGATTTATGTATCATTATAATTCAATTATTGA tcaaaatgagcaaagatgagaaaaagtgcattctaagggtgtaaaatttt gaaaatctaaccatattttgcctaaaaatggtcaaaaatcttCAAGAAAA TGCATGGTAAGGGTCAATTTTTCGCCCAAATTCGAGTGCCGAGTGCCCCA CTCCCCACGGGACAAAATTGGATAAGTAATTTCAGAAATCTTATTACATG CAAATCTTAAAAGATTTGAAATATACTCCATAACAAATTATAAATTCTTG GATACAGAAAGTTTTAATAACACAATACTTgtcttataaataatttttaa attttcataataaTTTATTGTGCAAACAAAATAGTTCATCCATACAACGT CACGTGACTTGGTATTGATTGATACGATGGTAAATGAATTTCGAAGTTAT CATAGGGATCTTTAAATTTGTTTTCGGGATGTCTTAGGATAGAGGCTGCC ATCGCAATACACAAACTCATTATGGGAGAACACTTGGCATCGGTGGCAAA ATTTATCCTTAGGATCGTAGGTTTGTCCTCTGCACCTCTTTTCCTTGCCA AAGACGAAACCATTTCGACAACCCTCTGATTCGATATCATAAAGGTGCTT TCTGAAATTGTAATAATTCGAAATATATCGTAatgaaacattaaaaacaa acataTTGGGAATTAGTGGTTTAATTCTAAAAGCTAAAGAAAATGATTCC TACAAACATTAACTCACCCACAGCACCGTTTGAAAGGTTCTTTTGCCAGT TTCACACCATCACAACAAAATTCTGCAACTCGATCATACCTCTCTCCGCC ACCTACAAAAATGTACGAAAAAAGCTCTATAATTTAAAGTTATTCATAAC TTAACCGTCTGAAGCCTTCGGAGAGTCCCTATTttggatttcaaattttt gtgtaGACTAAATTTTACCAATCAATATCCTCTGGCAAAAATCACGTAAA AATGGAAAGAATTTGCAAATGTCGTGAAAGTTATTCCACGTGCAATTAAA TAAGATTAAATACACCAAAGAACAGTAGAACAGTATATCGTGTATCACAA AAACCTCGATGTAGTTGCGGATAGCAAATAAACAGTCGGTAGAGTCCTCA ACAGCAAAAAGTCGCCTGTGGTTCTTGTGCTACATTCACGTGATTGGCAA ATACTGAAAGGTTATCTTACAATATCTCCACTTCTGCTTTGCTGCAGGGC ATCTGTGGATCAGTGGAGTTGGACGAATATATTCTCCGAGAGTTATACCA AATAGAAGAACCACCAAAGATATTGATAGAACAAATCTAGCCATGATGAT AGAATGTCGCACTTTACCTATTATAGCTTGAATAACCACACTTAAAAGCA CTGGATAATGTTCTTTACCCGTACTTAAGGTTGAAATTAAAGCAAGCGAT GTGTATCTATGTCTACAGGCATTGGCCTTTTTATACTGATCGTTCTACCT AGAAGAAAGTTTTTTGAACAAACACTATGTACCATATTATTTTAATGGTC TTTTTTAGTTCCCGTTTGTTTCATACGATTGCTTCATAATTTTTGAACAA ACACTATGTACCATATTATTTTAATGGTCTTTTTTCGTTCCCGTTTGCTT CATACGATTGCTTCATAATTTTTGAACAAACACTATGTACCATATTATTT TAATGGGCTTTTTTCGTCCCCTTTTGCTTCATACGAGTCAAAGGTCGATA TAAtgcctttttccttttttcttacTCAAtctttttgtcactttttcNAT ACGAGTCAAAGGTCGATATAATGcatttttccttctttcttaCTCAATTT CTTTGCCACTTTTTCCTATATATCCCTGATAAAAATATTGTTAATGTCGA TCCAACATCCGttaaaatgaaaatcgaaaTAACATTTTGTGACAGGATTT TCTTACTTTAGTGGGTGGGGTTACCACCTTACCTAAAAGACGATGTTTGA CTTGATTCTCCTAGAAAGTGGTTCCACAATATTTCCGCACCCATTGACCT TTTTTCCTTGTAATTTTCTCATATATATCTGCTGCTATTTATTAGGGAGT GACTTATGATGAAAATTGACTGTCTGGGTAAACGTTTTCATTGTTTAGTG TATATCCGCACTATCCTGGGGTGGGAGGTTGAAATTTGGTGGGAGTAGAA AGGGACTTTttggaaatctataaaaaaataattatcgtATTAACCATGTT CACACTATACCGGATAGCTCTTCGTGACGATAGAAAGTGGTTAATGTATC TATCCGATATGACGATAGAAAACCTATCGAACCAATTTTTGTAGCGGATA GGTGTTGAGACGATACGTCATCTTAGGTGCTACGTCGATCTTTTGGGTTT GAACACCCTATCCGATATGATTTTCGAGACGATAATAATTTTTTGAGATA TTAATATtactctttttggacctacctccgggtgccccggtggaggttct ataaattaacccatgtccgttcgtccgttcgtccgttcgttcgctcgtcc gtctgttaccagcttttctcaggattggctcattagttttttctgatttt ttgcacaatgatgcaaaatggcaatgcccagaacgtgacggagcccNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagctttatt tttccattctgaatttttgtacaattattgtcacttttttcttattttca tctgatgttaatcattaggtaggtccattcagcatgttgcttgttatcgT TACATCGTCTCAAATGTGAACACATTAAACAAAGAGAGTCCTTTGTAGCG TTTCATGCCGAAATGTGTTCACATTATATCGGATGGGCTATCGAACCGTT TCGAAAAGCTATTTAGTAtagtgtgaacatggtcttattCTCAGCTTAAG TTCCAACAATATCAATCCAAAATCGTTTAACAATGTTCTAAATTCATTTC CAAAACCTGTCTGTAACTAACAGCttgagtttttttctgatattaggcta cagtatatggcccccaaaacggagacggcccctaAAACGAAGGTTTTCCC TTAATAAGCCATGTTGGTACTTTAAAACCTGGAAAAGCTTCAGATTTAAT CTTAACGCATTTctcttaaaaaaatatcaaaatttcatttttaacatggc taattttcttcttcctattgttttttcaaaaattagtttcgaaaattcct ttgttttgaCTAAAACCGTCAAAAGTCAAACAAGATCGGAAATTAACCCC TAAAAACTTGGTAAATCGGGAAAGTATAAACATATACCAACAATACAATT CAAATTAGATACTGCTAGTATTTTGCACGGGACTTTGCACTTATCCTGAC CTGAAACAATTATTGTTTtggtatgaattttttttgccaaattatcaaaa aaataattattttatcgtGTCATAAGTTCGAAACATGATTAAATGATGGT TTTTTGACAACCATTTGTATGAAGATAAAgagaaaagtaaattttgactt tttaaagtcgTATACCTATTGATAGTAATTTGATTTCGGTGCTATGCTTT TTGATTAAGATATTTCGAAAAAACCATTAGAAAAATGTCACacaactttg actgaaaaaaatcatagaaaAATCTTTATTCTAAGAAAATTGCATTTTGG GAAGGAAACTAGACATGTTGAAGCTTGTTTCGCAAAACAATATTTAACTT TCCTTATTTTCTGAATTCACTAGAAAGATTTCAATTTGGatagacgtttt gggggccacatactgtactaACTTCTTTGAAAGTcgttaaaaaactttta tttagttATGTgtttaaaattacattttttattGGAATCAGCCTTTACTT GAGGTAGGACATAGGAAGCATTTCATGTGGGGGTTTCTGAAGAGGCGAGG CCTGGGAATGTGTATTTGACATGGAATCCCTCCGCGCACTCTCTCATCGG TGACCAGCAGATACTTTTTTCTAGGCACGCCAAACGCCCGGACAATATTA GGTAAATTTCTAAACAAGAACAGCactagtgtggtcgtgttacaaaaata caggctgtttgtagggaaaaaataagatctagctgaaactttatCCAAAc cttcatgcgcaagttccacttttcgccatattttggtctaaaattgacca taaattgCATTTTCTGCTTGAATTATCATGAGTAGTCTTccatatagttt ttcgagagctttcgaatggtatacttgataatgtctgaaaatgagtttga aattttcaaaaaatttcgcccttagggttttgcctggggaaaaaagaaat gtcctaAAAAAGGGATGTTCACCAGTGGGATtgtaggggattttttcctg aggtataaccatcctatagagaaggtctggggaaagtttcagctagatgt TATTTTTTCccccgtaaattatgctaaaacGACCCCACTACATACCATAT TTTGTGAGACAGGGTACAGCTCAAGAGCAGCAAGTCAATTTTGTTTGAGA CAACCTGCAAGATAAGTAGTCAAAGTATTCTGAGACACAGTTTGACAGAG TACAGCGAAGGTTGTCTGAAAACAGCAGGTTCAAAGAAGATCGTCGCAAA CTAAAtttttaactcaaaatttcttACCCTTTTGGGGACTTTGTAAAGGC TATCCCAGTGTTAAAGTACCAAGTTTTCAAGATGACAAATGGACGTGTTG TCTAAATCTAATATGTTATCCAAAactcaaaatcaatttttagagGAACT CGACAACTGAATCTTGAAAAGTTTACTTTTGGTTATCTTCGGAAGGCAAA TAccgaattttttttgctcttgtGAGAAGTGGTAGCaaataagacttttt tattacaccgcgaaaggctatcgtaatactttcgctatgcgaaattaata atgAGCAAATACTAgttttactaaacttttaaactTATTTTGCGGTAAAC ATTTCCATTATAGAGGACGTAGAAATAGTGTTGGTATAATTTCTTATTAT GACAGAATCTAACACGTGGGTTATGGGTTTTTCCGTTACATATGTTTGTT TTGGTGCTGGCGATTCCATTTTGGCAAGTTTGTGATAAAATGATGTCATA TGTTCCGATTTATGTATAATTATAATTCCGATTATTGatcgaaatgagca aagatgagaaaaagtgcaTTCTAAGGGtgtgaaatttaaaaatctgacca tattttgcctaaaaatggtcaaaattcttcaaGAAAATGCATGGTAAGGG TCAATTTTTCGCCCAAATTCGAGTGCCGagtgccccctcccccgggtcaa aatttgataagtaatttcaaaaatattattacatGCAAATCTCAAAAGAT TTGAAATATACTCCATATAACAAATTATAAATTCTTGGATACAGAAAGTT TTACTAACACAATACTTgtcttataaataatttttaaattttcataataa tttattttgcaaacaaaATAGTTCATCCATACAACGTCACGTGACTTGGT ATTGATTGATACGATGGTAAATGAATTTCGAAGGTATCATAGGGATCTTT AAATTTGTTTTCGGGATGTCTTAGGATAGAGGCTGCCATCGCAATACACA AACTCATTATGGGAGAACACTTGGCATCGGTGGCAAAATTTATCCTTAGG ATCGTAGGTTTGTCCTCTGCACCTCTTTTCCTTGCCAAAGACGAAACCAT TTCGACAACCCTCTGATTCGATATCATAAAGGTGCTTTCTGAAATTGTAA TAATTCGAAATATATCGTAatgaaacattaaaaacaaacataTTGGGAAT TAGTGGTTTAATTCTAAAAGCTAAAGAAAATGATTCCTACAAACATTAAC TCACCCACAGCACCGTTTGAAAGGTTCTTTTGCCAGTTTCACACCATCAC AACAAAATTCTGCAACTCGATCATACCTCTCTCCGCCACCTACAAAAATG TACGAAAAAAGCTCTATNCAGTAGAACAGTATATCATGTATCACAAAAAC CTCGATGTAGTTGCGGATAGCAAATAAACAGTCGGTAGAGTCTTCAACAG CAAAAAGCCGCCTGTGGTTCTTGTGCTACATTCACGTGATTGGCAAATAC TGAAAGGTTATCTTACAATATCTCCACTTCTGCTTTGCTGTAGGGCATCT GTGGATCACTGGAGTCGGACGAATCTGTTCTCCGAGAGTTATACCAAATA GAAGAACCACCAAAGATATTGATAGAACAAATCTAGCCATGATGATAGAA TGTCGCACTTTGCCTATTATAGCTTGAATAACCACACTTAAAAGCACTGG AAAATGTTCTTTACCCGTACTTAAGGTTGAAATTAAAGCAAGCGATGTGT ATCTATGTCTACAGGCATTGGCCTTTTTATACTGATCGTTCTAcctagaa aaaagttttttgaagaaaCACTATGTAACATATTATTTTAATGGGCTTTT TTCGTTCCCTTTTGCTTCATACGATTGCTTCATAATTTTTGAACAAACAC TATGTACCATATTATTTTAATGGTCTTTTTTCGTTCCCTTTTGTTTCATA CGAGTCAAAGGTCGATATAATGcatttttccttctttcttactcaatttt tttgctNGAGTCAAAGGTCGATATAATACCTTTTTCCTTCTttcttactc aatttttttgctactttttccTATCTATCTATGATAAAAATATTGTTAAT GTCGATCCAACATCCGttaaaatgaaaatcgaaaTAACATTTTGTGACAG GATTTTCTTACTTTAGTGGGTGGGGTTACCACCTTACCTAAAAGACGATG TTTGACTTGATTCTCCTAGAAAGTGGTTCCACAATAGTTCCGCACCCATT GACCTATTTTCCTTGTAATTTTCCCATATATATCTGCTGCTATTTATTAG GGAATAACTTATGATGAAAATTGACTTTCAGATCTCTGGTGCTTTAAAGT TGTTATACCATTAGTATTTTTGTCCGGGTTAACGTTTTCATCGTTTAGTG TATATCCgcactactttaatgggataaaatttcgcggggattaaattttg tggTTGGGCCTAtctgcgaaattcaaaaatttcgcggggacttaatttcg cgggtggcactattgggtctccatattttcacgatttttttactttcact gtcaaatcatacatgtggttgttgaaatacacattatttgcgcctctttg atgcaagtaaccattcaaaaagcatttatttgacatactttaggcgtaca aactttcgcgagcagaaactttcgcgaggacgaaaaatggcgaaattcac gacatttactttcgcgaatttaacggaaaaatatatttcgcgagcacaaa cttttgcgaattaAGACGtagaattgagaattttcacatgaaaaaatggc ttagcgggacaaatacttcttggattggcttatTAGTCTtatagcaggct aaaaagtgccataaaagttacattttatacaaagtttgaagatttacaaa ttatctatttcgtcaagaatttttcgcgagcataaactttcgcgaatggc ccttcctagaatttttaaatacatttactttcgcgaaaagggccaaaatt cgcNNNNNNNNNNNNNNNNNNNNNNccttcctagaatttttaaatacatt tactttcgcgaaaagggccaaaattcgcgaaaatcgcgaaagtttctgct cgcgaaagtttgtacgcctaaagtattttgagttttgtttagaaatattt cgcggatgaggcccttccaaatttccattggaacttaatttcacggattt tcgcggatgacaccgaaatctgcgaaatttaatccccgcggaagtttatc ccattaaagtatcttGAGGTGGGAGATTGAAATTTGGTGGGAGTAGAAAG GGACTTTTTGgagatcttttaaaaaaataattatcgtATTAACAATGTTC ACACTATACCGGATAGCTTTTCGTGATGATAGAAAGTGGTTAATGTGAAC ACCCTATCCGATATGACGATAGAAAACCTATCGAACCGATTTTTAAAGCG GATAGGTGTTGAGACGATACGATGTCCTAAGTGCTACGTCGCGTTCCGTC ACATTCTGGACCGGTGCATCTTTTGGGTTTGAACACCCTATCCGATATGA TTTTCGAGACGATAATAATTTTTTGAGATATTAATATTACTCTTTTTTAT CATTACATCGGGTCTCAAATGTGAACACATTAAACAAAGAGAGTCTTTCG TAGCGTTTCATACCGAAAGGTGTTCACATTATATCGGATGGGCTATCGAA CCGTTTCGAAAAGCTATCGAGTATTGTGTGAACATGGTTTTATTCTCAGC TTAAGTTCCAACAATATTAATCCAAAATCGTTAAACAATGTTCTAAATTC ATTTCCAAGACCTGTATGTAACTAACAGCttgagttttttttctgatatt agGCTACTAACTTCTTAGAAAGTCGTTAAAAGTCTTTTATTTAGTTATGT ggttaaaattaattttttttattggaatcAACCTTTACTTGATGTAGGAC ATAGGAAGCATTTCATAAGGAGGCCTCTTAAGGGGCGAGGAATGCGTATA TGGCATGGAATCCCTCCGTGCACTATTTCATCGATGACCAGTAGACACCT TTTTCTAGGGACGCCAAACGCCCGGAccatattttctcaaaaaaaagggC AGGTAAATTTCTGAGCCATTGACAGGCCActgttaatttttttaagaaac aacgAGGCATCGTACTACACAAGAAGAGCACaccatatttttaaaaacat tgagaCAAGGTACAGCTCATGAGCAGCagatcaaatttattttattcgtt gatcaatttgaagttttaataAAGCCAGGGTCTGTGAAATCGAGAACAAC AGCATGTGCTAATTTCTAAGATAGAAAATTTTCTTGGACAGACTTATACT TAGAGATCGAAATTTATATGTCGGACATGTGAAAACAGCAGGTTCAAAGA AGATCGtcgcaaaataattttttaactctaatttttttaccctttttgaG ACTTTGTAAAGGCTGTTCCTGTGTTTAAAGTACCAAGTTTTCAAGATGAC AAATGGACGTGTTGTCTTAATCTAATATGttatcaaaaactcaaaatcaa TTCTTAAAGGAACTATAAAAAGATTACTTTTGATTATCTTCGGAGGGCAA ATCCCGAATTTTCTGTTGATCTTGTGAGACTATTGAAGTGGTAGCAAATA AGACTTGTTTTACAGGGGATTCATATTAAATCTTGATAGCGCTTCCCTTT GTTCCGGGTGAAATGAGACTAAAATGATTGTTTTATGTAAATTTTATtgc acaaaaaaatttaaattatcaATAACCATATTCCtatatataatattttg atCCAATTAGATACAGTCTATAATATAAATAATGAGCAAATACTAGTTTT GCTAAACTATAAAACTTGTTTTCCTATATTTTGCGGAAAACATTTCCATT ACAGAGGACATAGTAATAGTGTCGGTATAATTTCTTATTATGACAGAACC TAACCCGTGGGTTATGGCTTTTTCCGTTACACATGTTTGTTTTGGTTGTG GCGATTCCATTTTGGCAAGTTTGTGATAAAATGTCATATGTTCCAGTtct gtatgaaaaattgaaaatgcagTGAAATAAGTAAAGCtatgaaattttta tcaaacgAATTTagtcaaaaattcgaattcaCTTCTGACACTGTGGTTGT TTGGTAGGTCTGTCACCTGGTGTCGAGGTGATTAGGGTTTCGGTCAGAAG TCAAGCGCGTTACCACTCGACCACCGTTCCCAAAAAGGAGAAGAAAAACT TCCACTTACCCACAACAACGATAGAAAGACCTTTTTCCATTGACACGACC ATCACAACACCATTCTGTCACTGGATCGTAGAGGGTTCCACTACCTGAAA GATTgataaagtgaaaaaatatactTTCAACACCCTCGTACCGTGGTTGC TGACAAAGTGGGATCCATGGTCATTGACCTTCCCGACAGGAGATCTGAGA TGTATATATTTATTTCACTGGAGGCTGACCCGCCGCATACATTTCAATTT GTAATTATGTAACTCTCCTTGAGAAGAATAACATATGAAAAGTTTTCAAC AAGCTTCGCATTACTATCACTGTTAAGAAATGCAACTTACAATATTGCCA AGGATTTTCTGAGTCGATCAGAGAACTATCATTGTTTTGTGATTTCATGT TGCCCGTTTTGTCCATATCACTGCCATATACTATGCCCAACAGAAGGACG GCTAAAGAAATCGAAGTCACCAATCTTGCCATGATGAATTGATCTGCTCG ATGAAGAAAAATTCTTATGTCTTTGCTCTCTTGAATTTTCTTTGATATCT GTAACCAGTAAATATCTTGTagtgattttttttggtttggaATATAAGCC TTTTATAGGTATGTTGTATATGTTGTCTGTGAATTAAAGGTTATTTCAGT AAATATATACGTCatatttttaatggttttttttctacttttactTCCCA AATTCGTTTTCAATTTTACTTCAAATGCCAAAAGGTCATTCACTCTAAGG AAGTTTAAATCTTACAAAaaaggatttgaaaataaaggtTTTGGTNCACC TGGTGTCGAGGTGATTAGGGTTTCGGTCAGAAGTCAAGCGCGTTACCACT CGACCACCGTTCCCAAAAAGGAGAAGAAAAACTTCCACTTACCCACAACA ACGATAGAAAGACCTTTTTCCATTGACACGACCATCACAACACCATTCTG TCACTGGATCGTAGAGGGTTCCACTACCTGAAAGATTgataaagtgaaaa aatatactTTCAACACCCTCGTACCGTGGTTGCTGACAAAGTGGGATCCA TGGTCATTGACCTTACCGACAGGAGATCTGAGATGTATATATTTATTTCA CTGGAGGCTGACCCGCCGCATACATTTCAATTTGTAATTATGTAACTCTC CTTGAGAAGAATAACATATGAAAAGTTTTCAACAAGCTTCGCATTACTAT CACTGTTAAGAAATGCAACTTACAATATTGCCAAGGATTTTCTGAGTCGA TCAGAGAACTATCATTGTTTTGTGATTTCATGTTGCCCGTTTTGTCCATA TCACTGCCATATACTATGCCCAACAGAAGGATGGCTAAAGAAATCGAAGT CACCAATCTTGCCATGATGAATTGATCTGCTCGATGAAGAAAAATTCTTA TGTCTTTGCTCTCTTGAATTTTCTTTGATATCTGTAACCAGTAAATATCT TGTAGTGATTTTTTTTGGCTTGGAATATAAGCCTTTTATAGGTATGTTGT ATATGTTGTCTGTGAATTAAAGGTTATTTCAGTAAATATATACGTCatat ttttaatggtttttttctacttttactTCCCAAATTCGTTTTCAATTTTA CTTCAAATGCCAAAAGGTCATTCACTCTAAGGAAGTTTAAATCTTACAAA aaaggatttgaaaataaaggtTTTGGTGGACTACTAGTTTGTATGACAAG CAACGTCATGACAAGCAACGTCATCTGACACTCTATGCAGTGACAATCAT GCAATTTAGAATTTGTTTTAATCTCTAGGCGAATTTTATGACATGGGCTT TCTAACATCCCTTGTTAGAAATGGTGTGTTATAAAAACATCTGAATGATT TAGACCTAAAGAAAGTTAAACAAGACGACTTtcaagtcgaaaatttcgca taatatactcgaacatcaacgacgaagacgctatgcattttgaatgaagc ctTACAGAAAATATACACAATGTNGGACTAGAAAAttgcagggtaaaaac tagccaactttaatactccttgagattaaactttgactccttcataactg ctttaaactgcatcccattaaacaaacccttCCCAATATCTTGCTGTTTA TCCCGTGGAAAATTATAGAGGAAAGAATCCAGAAAAGTAGTGCGGAagtg ggaatcttatacaaacaacggtaccatgattcaaaatgaaaatcctaatt agcaaaaggtgtatcaagatatcggtgaagtttgattgaaNttttttttt aatgaaaaatctcaatccttaaaaaaaaagattccttcaaaaatgcgact aaagaattccattctataaagcgtaaacaaaatctttcaattcagaataa ttcagagaactgcaatatacttgagNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNaatatctatcatcccatcgggaaggaaaagct ggaacttttactaaccaaactcatctaacaccaatcaaacttcatcggat aaaaaactgtcatcattaacgaggTACTGCTgtacatagaccttttttca aagaggccaccctgttgaataattatgtagtccagcagaaaaactatgat aaaaccatgcataattattacaatatgcatgatacagtgattatgcatgg ctctatcattgtttttatggctggactacataattattcaacaggacgtc ctctttgaaaaaaggtctattgtgcgGTGGTGTATGGtgggctggatcta aatgtcctttgtacggcggtgaaaataggttaatttgaaatctgctgtac TGTACACCCCACCTTACCCACCGTAAATCACNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNaaaaaaaaaaaaaaatagaaatttgttttgaaattttgctgc tttgattggtcagtcatttgatggctatgctatgcaagttaccctccact gatgcaatcaagttacccgacttcagtTCATggtacttgctaaaactgac tgtttgtcacaactggtttcactattaacacataactatctggtgaaaaa aggaaaaaaatatcataCCTATGTGCTGTTTGTAGctttggtgaagaaga gaagagagggttAATGTTGTTGTtctggaaaattaactcttttgtactac ttactgagcatgatcaatttgttggtgcattcactaactacacaaacata aaatacttggtagtaaacaaatattaaatctctttaaacactctacaaaa gaccagaaaacatgataaaaatttatacagcagcagcaagtttcaaaagc atgtgcaatcaagcagccattaaaaagttctcacNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNCCAAACGCCcccgccataatttgcgccccaaaaaatgT CTCGCCACATACATACACGGaagcctatcgtaatactttcgctaagcgaa attaaaaaaaaaaaaaataataatgtttAACCTAAACACTACACAGAATT TGGAATCCCCAATTATCACAGCccgattttaaattttaaacgtTAGAAAT TAGCATTCGTTTTTATCTGAATCAACCCATCGTTTCATCCTGTTTCATCC ATCAATGAAACATGACAGCGGGCAGGGGATAAGCGAAGGGAGAACTGTTT GATCGAAATGACATTTGAAGTAGGATTTCATGCTTTTTTAAGGAGTTGGC ACAACGCTGGCTGTTATTTATAcgtttaatttctttttttaacgaAGAAA GGCTCAAAATGGATTTGAAATCAGTATTTTCTTAGATACTTCTGAGATCT AAGGCTTGAAATCGTTAGATTTGGCcatttcattaaatttccattcactG GGGGGGGATGGACGAACCATTGcaagtcaaaaacatttcttcGAGATGTG TGGAtatcccctggaaaatggcaaaaccTGTAAAAAATACCTTGGGAAAT TTCTATTCATTTAAGGGGACGGTGGACGAACTttaatcagtcttttaccc ctggaaatttcaaattgattttttaccgcctggaaaaattaaaaaacact cTTTTAGACTACTGGGAATTAATTTTGCTcaattatcccctggaaatgtt cgtctaCCCGGCccttgtatggatataaaatggaatgacccaGTATCATT TAATCATGATTAAAATGATTGGAAAAATGCAATTATTTCACCTCTAGGTT CGATATCAACAAGTCAGATTCCTCCAGCAAAGAAGTACATCGACCACACA AAATATTCGATCAATGATGTCTTTGTGCTCCCTAAGAATGACCCAGTAGG TTTCCTTTTATTTCCTTCTTACGAAGCTTGTAGATATAACACTTTGGCGG CAGACATGGATTTAAATTATATTCTATCCGTTTTGATGGTTATTGTTCTT TAGGGAGTTTGAATTTGATACTTAACTTGTGATTTCGATTCAACCTCATC ACATAGGTGAACACGTGCTACGTTAAGCGGATTCGTTCTGCGAAAATTGA TAAGAATGTTCGGAGGACGTCTTGACTTATACCATACCATTAACGCATTA TCACAATACCATAACATTAACAAAGGATTATTTCTTCCACACTCTGCAAA TATTAAACTTCAAATTGCAATTTTCTATAAAATACAAAACGTAAAAACAT CGCCCCGTCGAACGACTCCAGGTTGAGTTTTCTATAGAAttgtgaagttt gattgaaaatgttcattaagggaacttattttggcgagaacttaaaTATT TTGGCGAAATTGGCGATTTTAAACAAGCATTTAGCCTGTTATTcaccaaa tttaaaaacttcgaccattcgccaaaataagttctcttaATGTAGTACAC TCTGGTACACTTTATAATAATGTCAatgatgaaaatggctaaaaaattaa gaataatactAAGAATATCACCTTCATGGCATTTTGCTAGTCAAGCTAAA AAAgccatttttagaccattttcaGTAAGGCTCGCTCCTTTCACAAAAGT GCAAATAtctgcttgagacgtatgtactaaatgttaaatctagtctgaat cggGATCCTAAtctaagaatgctgtaaaaaTACcaggtgacccacgaaaa agttcggacggttTTCGATGGCTAGGGTCTGAaataaaataaaccagccg aggctggaaggtcagccaatagagcttagctagatagctttaataagtgg gttaacagatgtactcttaggtgccaaataaacggggggggttggaataa acggggggggggtggaaaatttttgaaatttcaataaacNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCCGg aactgcatgaaaaatagtttgatcaatttcaacaagaactgtatatatta atattaatataattgatcaaattccaaagaccatttgtcataatttttca agtccaataataggagatgtgatgacatcgatgtcatcatttggttcccg tcatctgaccgaccctgatttacggtcagcaggtagagttggagagtcag aaagcttttccgctgctttgatggatttccactgtcgacctctgcacgct ctgtgtttacaagttttcaaatcgaagtagcgagccgcatgctaatggag agtaaaccgaaaaccagtttatccacggtttcttaattttttaatttggt cAGATCAATCCACAcagattccctttcaacaagacgtagctgcttcttaa cagaaaatattttcgaccgaccgactgaacgacccccactttttaaagta gaaatgacgggaaccaaacaattttttgtgatttgccttatatcaaacac gtccaacaagtccaaaaaagcacgattgcatccagtcttttgTAAAcgtt atcaaattccaataacattataacaccatcaatcctaaggggaggcaaac aagaaaaatatgtttttattgcaaaaactattaaaaagcagcaataaaaa gtatcagaaaattcaacataaacaaaaacttgNacagaaattgaagcttg caacagatttacactggaaatactttggtacaacactgacttatcacagc tcttatcacatctgactatcgcTCGAGCcaccgccatcttgaaactacat tatgatcagtaaaaacaacgcacgctaaaagtacccaaaaagttaacccg atcggaagaaagtttagaaatcaaagtagtgagatcggaaaatcggattt tttttttgccgtcttatgatgctgctgatgatgatggaagaaaattttac ctatttgaatgctcagcttaggctgaccaataatataaactcaatctttt ttttaaagatagaggatgctctaacttaaactttgagctattacttttta aatttggttcagtggTTCTTCATTAAtcagcttttaaagtcaaaattcaa ttatcggaaagtgcaaaaacacgtcaaaaatggGGTGTCAAattataatt gttttctttatctttaacaTTGTGTTTTTCGAGTGTGCTGATGTTTTACG ACCTCGTTAATTAGTGTTGtagtagactatgctatagtctaagacgagtt tcatctaagaggaacaaacgtgaagacgggaattttttacggGAGTAGCT GTTGTCTTAGACTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATCGGCCGGCCCGGTTcga acaaatgtaaacaaacagtcgGGTCTGGCCGTTAATTGCCACCACCAATT CTTGCTGCTAATGCTGATGGACCCGACTGGAAAATGATTCCAGAAAGTTA ATCTGTAGGTGTGGAAATTATTTGTGCAATTctttagcattttttgagtC TAGCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGTTGCTATTTTGCCCTTCTGTATTCAA TATGGGCATTTACTGTATATAAAAGGCATTATTTACAATTATCATATAAT TGAATCATAttgaacattttaaattttgttttttttttataaagaaagta aaaaagaaagtctTAGACACAATCCATGCAAAAATTCtcactctttaaaa aaaaaaattgaaaggaatttttCAAGGGCAGATTTGTCATGCCAAAATCA ATGTATGaaatttctttcatatttttggtTATCTTTTTTAANNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNTTTTATGGAATTGTCACTTGGATGATTTAAAAGGatatttgagta aagaaatttaaaacgtggttttattttgactaggtattttttgcaaaaca tCCGGTTTAGTCAAAAAGGCCTTCTCGGCCTCaggtctaaaattgaaaat ttgaaccacagattttttggggaatttttccttaCAAATACATTTCAATC ATCACAGTGACCCTATATTTCAAATCTAAAGTAGTTTTGATCATTGGTTC Aggaattatgataaatttttagttttttacaaaattcaaacaaaatttgt gttttcgcaGGATTAtggttgtaaaattttagatgaaatttgtaaactac cgtgagatcggggtAACTTAatacatcagtggaggctaacatgcataacc CTTAAATGagtgacctggctggtcattaaaatacaaagttaaatcaaatt aaaaaattgtcgAGTAGAggtgcgagcggagctgcgtagttcatttgttt tgaaattttgctgctttgattggtcagtcatttgatgacTATGCAAGTTA CCAGACTTCACGGTATACAGTATcataggaaaaaatcaaaaaaaattacc ttgacCTTTTAGATGAATTGGCGGTGAAAAACTATTATAATCTTTCAATA ATGACATGGTGATTAGCTGAAATTTCAccgtaaatttattaaaagattGC AGGTTTTCACCTTGAATTGCCCTACGGTCAGgagaaatttttatatcttG CATTCTGTGTATAGTCTGATTGGGTAGCCGATATAATTTTGCATTTCTCC AGAAGAATGTGGaaatttgaagtgaaaaaagattctttttgatACAATTT CAAATGTTAGATATCACagaaagtcttgtttagacacGGTGGAAGGTGTC GGTCTGATATCgtgaaaggtgttggttgaattttgtagaAATGCATTGGT TGAAATATGCTAGATAACCATGGTTTTTTAAATATTGCTGGTACCACTAC TTTCACTCAAGTGCcaagctgaaaaattgactatcaaaaaatatcaatca agcccaacaaaaaaataaacaggaagtaaaatctgttgaaatttagacta tcttagaaaaactttacagagattgaagattttttgcGCGCACAAAATCA TTACTTGACAGAACTggaaaaagtcaatatttcagTCTCAACTGACACTG ATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNTAAAAGAAACTACGAAATCCAGTGAATATAAACCTTACCTTTAGATGC TACTTCAGGTGTCAGGCATcaagttgaataaaatttccaaaaaatcaaag ttgAAATTTGTTTGTGGGCCTTGAGGAAAACAATCCCTTCTAACTAATAT TGTCATAAAAGCTAAAGATGAATGCGTTTATGTAAGATCTTCAGCNactc tatccgccgcgaaacatattacgttttataatatacaaattatgttatat cataataatatattatacggacgatagcatcgtctagtgtTGTAGGTAAt taaagtttgtaaaataataaattaacaaCGAAGTAGATTaatataaattt attgtaaatatttttggcaaataggcaaaatttgccttctttatgaaaat gtcGCGTCTTATGAAAGAACAAAGAGTGTGGGTTTGCCTGGAATATGCTA GAAAGTGTATGGTGGTGGTTCTTTTCTGAACGAATAACTGGttaataaat tttgtgaaagtaaagaatctaaaaaaagttttaaaattgaataaaaatat ctaacatGCTCTTTTCTAACGATTTAACGAATttgcttgattgattgata ataaaacaaattgatacctcttttttgacgtaatttcgctctttccgaaa agtgaattttgactttaaaagctcataagtagggaACTTgtgggtcaaat ttaaaaagtaatNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNctttttcg tgggtcacccggtattataggatgattttcccaaaaaagttaggaatatc catgatgaaatggatttccaccattcttataaaaagcgtgtaatttaaTT TACCTTCAGAGTGAAGTACAAATCATAGAGAAGCATGGTAAAGCTTGGCA TTTATTCCAAGAAGCAAAAACGTCTTCAATTGTGCACACTGTGAGCGGTG ACTTCGATATGTACAATGGTTTAGCTCGTGAATTTGCTGTCAATTTCAAA CAAACTGATCAAAAGGCTCTCAAAGAACACGGTAAggattttttaattca tttttaaaaaaatatttatggcATATCAATTTCAATATATCCTATTGGAT AATTTTAAAAGGGCTTGAATTACAAGAAAGGATGAAATCAACAGTGTATA CTGTACAAGGCTAGGTATGTAATTTAATTGTgttatttgaaattcaaaat tagcaGAAGATATTAGACTGTATCTCACGTGTACGTAGCATCGCGAATGA AGGAAAATTCTAAATCCTCTACCTTGTCTTGTTTACTTTAAATATTGCGT GTGcattgtttataaaaaataagtcattttttaaattgaccttttttatg tttgtgtttgtgtttttttcttcataagcGTACACAGGCTCAGAACTGGG TTTTGAAAAAACGgcttttgtataagaacattgaATCGTAAACCTGTGGT gtgcctgaccaaggggcagatacttttaaaaggaaaaagctGTATCAAGT GGCTGTATAAAGTGGCAATCAGAAAATATGACACTTCGTTAAATTTCTGA TGTTCAAAAATGCATTTGGAGGATCGATTTTTAGGGATGTACAATTCACA TGAGATTTGACCCTGCGTTTTCGTTTCGAATATCATTGCGAAATGCAACT TCTAATTTTAAGTTTGTGGCTACAGATTTGTTATTGATGTATGTTCAAGT GGCATGTTTAAGAGTGCAAACATCTCTAACATTGCGATGCATTTGTTCTA AAAACTTCATTGTCCCCCAGCAGATCCCTACTCAATNGCAGGGTATATAA AATAAGTTATTGAAAATTGCTTTGAATTAGCTTGGAGCTCGAATTAAACC TCCATGTCTTATTTGAATTTGATCATTCTGTTTTTGAAGTAGAAATGCGC TTAAACCTGGCCCTCACTTAAAAATTTCAGGAATCGTACTATCGGAACTC NACAGTTACGTCCCTTTGTGTTCCTACCCTATACTGAAAGAATAATTTAT AACCCCGACTCATGGGTTTATTACTTCATTTCTATTTGGGTATCCAATCT TCTACTTCATTTTTTGTAATGAAAACTATCGGTAAGACCGTGAACATATA AACAACTGTCATCCATCTATTTTTGTAGAAAGCACCTGCTAGCTTAATTA ATTTTGCTTGGAAATACCTTGcacgtttttttgtaagaacatccatttga gtattttttgtctattttcctaagaaattggatgttttagagtccgcgaa gccttaaaatgttcttaacttgttcctaacattttggccatcgaaacctt atgctcttatatagtttgtttttataaaaaaacgtgtgctAGCTGCGTTA AAACTTCGAcgaaagtctctgttgttctactctactcaagtcttttatct atatcataacgaAGACAgtggcaaaatcatcgtcagtatgaactccgact aatattttataaaattttgacttaaaaagtttcgaataattttagagagc gCCACATTCAAACTTTGATATTCCTTTTGTACAAGCTTTATACTTGGGca tattatttttcttcaagtcaTAGTAGAGAAAATGTTAGAGTGATAAAATA TTAATCCTTTTAGctaagtaattcaaagaaataatctTGTGACGGACGGC AACAAAGCtagcttcaaagagacaatagaagatagacgtccagtcgttGA TGTGTCCATGGCAAGAGCGGAAATATTCAGTAATATTTTGTTTTATCTTT GTTTAGATTTCCCACTTGGAAGTGTAGCTGTGCTACCGAACGGTGATCAT TTCATATACTACTTGGTAAGAAGGTTTACATGTGCATTCTTTATTGCGCC ATTTCAATGTTTCAGCAAACAACAACACGTCTCGTATTTCAAAATGTTAA CGCTTTTGAAAGTTATGTAGTATTAAggagataaaaatttcgaaccATTG TAGCTCAAGTTACACTTTTAAAGAAACGTTGTAAGGTAAATATATAGAAT GGGGATTATGTAACCTTGTCTCACTTCATTGGTACAAGAAGCCAAATTTA CTGTTAGCAAAACTTTATACTACTGTTTAAGTAACCTCATGAGAATTTTT AGTCGCAGGGTATATAAAATAAGTTATTGAAAATTGCTTTGAATTAGCTT GGAGCTCGAATTAAACCTCCATGTCTTATTTGAATTTGATCATTCTGTTT TTGAAGTAGAAATGCGCTTAAACCTGGCCCTCACTTAAAAATTTCAGGAA TCGTACTATCGGAACTCAATCGAACTTTGAGCACTTTGAGCGTTCTGTTT ACATTTATAAATTATAAGATTCTACCTGACGATCGCATAAGCATGAAACA CTCTGAAATATGttataaattttgaataattaaattTCGATGAtacgatt tttaaaaatatatttgaaaaaattcaaattacttTTTTGATGAACGATAA CAAGGTTTACAATGTGGAGAATTCTCATTGTGACACTTTTGATAAACTGT GCTCAATAATGACTCATTTTTAGGTTATCCGTGAGAGTTGGTGGGATCGT GGAGCCTACAGACCCTTACGTGAAGCGCTCAACTCCATGCGAAAACACGC TGCGGAAAACGATGTCAGGTCGATCGCTATGGGACGCTTAGGAGCTCAAT GTGATGGATTGAATTTTGTTGAAGTTCTAAAAGAAGTGAAAGATGTATTT TATGATTCGAATATGGAGTTAATTATTTATTCCCGAAGGGCGTGAAATAT TTCATTGATCACTTATTTTGtgtacatttttaaaatttttatacatGTAA ATTTAtcgacaaaaagaaagaaagaattgATAATTGATG

Coding sequence (CDS) from alignment at sc0000007:1318491..1364679+

>TCONS_00001070 ID=TCONS_00001070|Name=TCONS_00001070|organism=Clytia hemisphaerica|type=CDS|length=3195bp|location=Sequence derived from alignment at sc0000007:1318491..1364679+ (Clytia hemisphaerica)
ATGGCTGGTCATGTTTTAAGAAGAAATAGAGGAGCTTTATTCAGTTTGAG
AACAATCTTTCAACAATTTGGAAATTGCACAGAAATTCGTTCGATATCAA
CAAGTCAGATTCCTCCAGCAAAGAAGTACATCGACCACACAAAATATTCG
ATCAATGATGTCTTTGTGCTCCCTAAGAATGACCCAAGTGAAGTACAAAT
CATAGAGAAGCATGGTAAAGCTTGGCATTTATTCCAAGAAGCAAAAACGT
CTTCAATTGTGCACACTGTGAGCGGTGACTTCGATATGTACAATGGTTTA
GCTCGTGAATTTGCTGTCAATTTCAAACAAACTGATCAAAAGGCTCTCAA
AGAACACGATTTCCCACTTGGAAGTGTAGCTGTGCTACCGAACGGTGATC
ATTTCATATACTACTTGGTTATCCGTGAGAGTTGGTGGGATCGTGGAGCC
TACAGACCCTTACGTGAAGCGCTCAACTCCATGCGAAAACACGCTGCGGA
AAACGATGTCAGGTCGATCGCTATGGGACGCTTAGGAGCTCAATGTGATG
GATTGAATTTTGTTGAAGTTCTAAAAGAAGTGAAAGATGTATTTTATGAT
TCGAATATGGAGTTAATTATTTATTCCCGAAGGGCGTGAATGGCTGGTCA
TGTTTTAAGAAGAAATAGAGGAGCTTTATTCAGTTTGAGAACAATCTTTC
AACAATTTGGAAATTGCACAGAAATTCGTTCGATATCAACAAGTCAGATT
CCTCCAGCAAAGAAGTACATCGACCACACAAAATATTCGATCAATGATGT
CTTTGTGCTCCCTAAGAATGACCCAAGTGAAGTACAAATCATAGAGAAGC
ATGGTAAAGCTTGGCATTTATTCCAAGAAGCAAAAACGTCTTCAATTGTG
CACACTGTGAGCGGTGACTTCGATATGTACAATGGTTTAGCTCGTGAATT
TGCTGTCAATTTCAAACAAACTGATCAAAAGGCTCTCAAAGAACACGATT
TCCCACTTGGAAGTGTAGCTGTGCTACCGAACGGTGATCATTTCATATAC
TACTTGGTTATCCGTGAGAGTTGGTGGGATCGTGGAGCCTACAGACCCTT
ACGTGAAGCGCTCAACTCCATGCGAAAACACGCTGCGGAAAACGATGTCA
GGTCGATCGCTATGGGACGCTTAGGAGCTCAATGTGATGGATTGAATTTT
GTTGAAGTTCTAAAAGAAGTGAAAGATGTATTTTATGATTCGAATATGGA
GTTAATTATTTATTCCCGAAGGGCGTGAATGGCTGGTCATGTTTTAAGAA
GAAATAGAGGAGCTTTATTCAGTTTGAGAACAATCTTTCAACAATTTGGA
AATTGCACAGAAATTCGTTCGATATCAACAAGTCAGATTCCTCCAGCAAA
GAAGTACATCGACCACACAAAATATTCGATCAATGATGTCTTTGTGCTCC
CTAAGAATGACCCAAGTGAAGTACAAATCATAGAGAAGCATGGTAAAGCT
TGGCATTTATTCCAAGAAGCAAAAACGTCTTCAATTGTGCACACTGTGAG
CGGTGACTTCGATATGTACAATGGTTTAGCTCGTGAATTTGCTGTCAATT
TCAAACAAACTGATCAAAAGGCTCTCAAAGAACACGATTTCCCACTTGGA
AGTGTAGCTGTGCTACCGAACGGTGATCATTTCATATACTACTTGGTTAT
CCGTGAGAGTTGGTGGGATCGTGGAGCCTACAGACCCTTACGTGAAGCGC
TCAACTCCATGCGAAAACACGCTGCGGAAAACGATGTCAGGTCGATCGCT
ATGGGACGCTTAGGAGCTCAATGTGATGGATTGAATTTTGTTGAAGTTCT
AAAAGAAGTGAAAGATGTATTTTATGATTCGAATATGGAGTTAATTATTT
ATTCCCGAAGGGCGTGAATGGCTGGTCATGTTTTAAGAAGAAATAGAGGA
GCTTTATTCAGTTTGAGAACAATCTTTCAACAATTTGGAAATTGCACAGA
AATTCGTTCGATATCAACAAGTCAGATTCCTCCAGCAAAGAAGTACATCG
ACCACACAAAATATTCGATCAATGATGTCTTTGTGCTCCCTAAGAATGAC
CCAAGTGAAGTACAAATCATAGAGAAGCATGGTAAAGCTTGGCATTTATT
CCAAGAAGCAAAAACGTCTTCAATTGTGCACACTGTGAGCGGTGACTTCG
ATATGTACAATGGTTTAGCTCGTGAATTTGCTGTCAATTTCAAACAAACT
GATCAAAAGGCTCTCAAAGAACACGATTTCCCACTTGGAAGTGTAGCTGT
GCTACCGAACGGTGATCATTTCATATACTACTTGGTTATCCGTGAGAGTT
GGTGGGATCGTGGAGCCTACAGACCCTTACGTGAAGCGCTCAACTCCATG
CGAAAACACGCTGCGGAAAACGATGTCAGGTCGATCGCTATGGGACGCTT
AGGAGCTCAATGTGATGGATTGAATTTTGTTGAAGTTCTAAAAGAAGTGA
AAGATGTATTTTATGATTCGAATATGGAGTTAATTATTTATTCCCGAAGG
GCGTGAATGGCTGGTCATGTTTTAAGAAGAAATAGAGGAGCTTTATTCAG
TTTGAGAACAATCTTTCAACAATTTGGAAATTGCACAGAAATTCGTTCGA
TATCAACAAGTCAGATTCCTCCAGCAAAGAAGTACATCGACCACACAAAA
TATTCGATCAATGATGTCTTTGTGCTCCCTAAGAATGACCCAAGTGAAGT
ACAAATCATAGAGAAGCATGGTAAAGCTTGGCATTTATTCCAAGAAGCAA
AAACGTCTTCAATTGTGCACACTGTGAGCGGTGACTTCGATATGTACAAT
GGTTTAGCTCGTGAATTTGCTGTCAATTTCAAACAAACTGATCAAAAGGC
TCTCAAAGAACACGATTTCCCACTTGGAAGTGTAGCTGTGCTACCGAACG
GTGATCATTTCATATACTACTTGGTTATCCGTGAGAGTTGGTGGGATCGT
GGAGCCTACAGACCCTTACGTGAAGCGCTCAACTCCATGCGAAAACACGC
TGCGGAAAACGATGTCAGGTCGATCGCTATGGGACGCTTAGGAGCTCAAT
GTGATGGATTGAATTTTGTTGAAGTTCTAAAAGAAGTGAAAGATGTATTT
TATGATTCGAATATGGAGTTAATTATTTATTCCCGAAGGGCGTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000605XLOC_000605Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001070-exon-sc0000007-1491911889:1318491..1318547TCONS_00001070-exon-sc0000007-1491911889:1318491..1318547Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1510915933:1318491..1318547TCONS_00001070-exon-sc0000007-1510915933:1318491..1318547Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1575043694:1318491..1318547TCONS_00001070-exon-sc0000007-1575043694:1318491..1318547Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1491911889:1336132..1336265TCONS_00001070-exon-sc0000007-1491911889:1336132..1336265Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1510915933:1336132..1336265TCONS_00001070-exon-sc0000007-1510915933:1336132..1336265Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1575043694:1336132..1336265TCONS_00001070-exon-sc0000007-1575043694:1336132..1336265Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1491911889:1353138..1353235TCONS_00001070-exon-sc0000007-1491911889:1353138..1353235Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1510915933:1353138..1353235TCONS_00001070-exon-sc0000007-1510915933:1353138..1353235Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1575043694:1353138..1353235TCONS_00001070-exon-sc0000007-1575043694:1353138..1353235Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1491911889:1361700..1361871TCONS_00001070-exon-sc0000007-1491911889:1361700..1361871Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1510915933:1361700..1361871TCONS_00001070-exon-sc0000007-1510915933:1361700..1361871Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1575043694:1361700..1361871TCONS_00001070-exon-sc0000007-1575043694:1361700..1361871Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1491911889:1363597..1363655TCONS_00001070-exon-sc0000007-1491911889:1363597..1363655Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1510915933:1363597..1363655TCONS_00001070-exon-sc0000007-1510915933:1363597..1363655Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1575043694:1363597..1363655TCONS_00001070-exon-sc0000007-1575043694:1363597..1363655Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1491911889:1364364..1364679TCONS_00001070-exon-sc0000007-1491911889:1364364..1364679Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1510915933:1364364..1364679TCONS_00001070-exon-sc0000007-1510915933:1364364..1364679Clytia hemisphaericaexon
TCONS_00001070-exon-sc0000007-1575043694:1364364..1364679TCONS_00001070-exon-sc0000007-1575043694:1364364..1364679Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001070-proteinTCONS_00001070-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1318491..1364679 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
90.9232 90.781 48.6318 32.4489 84.8 65.0359 87.1029 84.8888 93.7362 74.9694 81.8967 58.2403 42.773 41.6622 45.9903 42.1703 77.0327 83.9144 24.6891 30.8546 57.7995 59.5013 108.643 91.9578 93.4066 97.2104 64.464 46.2462 56.885 52.9738
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001070 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top