Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001064 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001064
Unique NameTCONS_00001064
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1712

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001064 ID=TCONS_00001064|Name=TCONS_00001064|organism=Clytia hemisphaerica|type=transcript|length=1712bp
taGCTTTCAATAAGAGCAAAGAGACAAGGTCGCAAGATGAATTTATGAAT
AGTGAAGAGAGCCTTCCAAGCACACGACTCTTGAAAAAGAAACGTTGCTT
TGCTGGATGTATATTGCACAACACCAACATCAATATATAGGACCATCAAT
GTTTTTATATTGGCTTGCTTGGATTAAATATCATTTTAAACACTCTTTAT
CTGGTTTTGGCTCTAAATTGTCTGTTGTTATGATTGTAAACTTGATTGTG
TTTGGGACTGTTTGTGAAGAAAATTCATCTCTGTAGTGGAGCTACGTTAT
ATTTATTTAAAGTGAAAGCTTCAAGCTTAACAATTTAACCCAAGTTGCTT
CTAGCTGTGAAGCTGGATTTATTAATAATTTATAAGAGCATGGCTGGTGC
TCAACCACCAAACGAAAATGAAGAGGAGAAAATTCGTAGACTAATCCAAG
ATTTTGTTGGTGAAAGACTTCGGAGGAAAGGTATTTCTGTACCTGGCTAT
GATCAAGAAGAACTTATCAACGAAAATAGTAGCATTTCCGAAATTGCATT
AACTTTACGAAGAGTTGGTGATGAATTTGAACTGGCAGCAGATACACAAT
TTGTTGCAAACATGTGTACAAGACTTTCGATTACTCCAAATACTGCTTAT
CCTATGTTCCAAGCAATATCTGATAAAATTTTTGCCTCAGGGAAAAACTG
GGGGCGAGTTGTAGCTTTTCTGACATTTGGTAGTTCTTTGGCAGTTCATT
GTGCTGAGAAACCTGACATGGGTGTTACGTTTGTCGATACAATAGTCAGT
TGGATCCATCAGTACGTTGTCTCACGCTTGGGGGAATGGATCAAAGAACA
AGGTGGATTGaaagGATTCATGGACTTTTTCAAACGCGACCAAGCTCAAA
ATACGACTCAAAATGGATTCTTAATGTCCGCCCTAGCGGGTGTAGGATTG
GGCGCTTTCCTAATGATGACCTTCAAATAGATCAAATTGCATGAAATTCA
ACATCTGTCGGGAGCGGCGACGAAAACGAATCGAAAAGAATCGGTCAGCG
CGACCGAATGATACCGAAAAGTCGAGTtccaaaaaaaacgaaaataaaag
tGGAATTTTGGAACTGTCTCCCGTATCACGAGGCGCGAGAGTTCTTCTGA
ATTGACGACGTTGTGTTAGTTTAATTGGAAATTGGTTATGAcgttttttg
aatgtttgatAGACACTGTGGACATCGGGATAATGAATGATTTACCAATA
TGTTGAAAGTAGTATACATAGATAGGAAGTGATTTCTTACGAGATTTCAG
aaagttttcaaattcatcCAGCACTCATGCTGCTTTTCGTTTTGATTGCG
AAACAGTGCGAATCTTATGACTGGTAAACGATTGATTTAGCTCTATATTT
TTGACGTAActatttgtaaaaaaatcttatatacccccacatttttgttt
atttttattgctTATATCGATACTCCTATTGCATATTGACTTGCTTGGAT
CCTGATAATCTTCAAAGCACTACAAGTAATGCTAGTTCAGTTTAAACTGG
GAAACCTGGGAAAACATGAAAGTATCTTAGTTCGCAAAAGGCTAGGGTCT
TGAAGATGATAGGGTGCTAGCAAGTTTAGTGAAAATAGGTCTTTAAAACA
CCAACtcctctcgggtacctaataagcgtcccccCGCCAAAtaatttctc
gaaaattttcca
Run BLAST on NCBI

protein sequence of TCONS_00001064-protein

>TCONS_00001064-protein ID=TCONS_00001064-protein|Name=TCONS_00001064-protein|organism=Clytia hemisphaerica|type=polypeptide|length=196bp
MAGAQPPNENEEEKIRRLIQDFVGERLRRKGISVPGYDQEELINENSSIS
EIALTLRRVGDEFELAADTQFVANMCTRLSITPNTAYPMFQAISDKIFAS
GKNWGRVVAFLTFGSSLAVHCAEKPDMGVTFVDTIVSWIHQYVVSRLGEW
IKEQGGLKGFMDFFKRDQAQNTTQNGFLMSALAGVGLGAFLMMTFK
Run BLAST on NCBI

transcript from alignment at sc0000007:1257073..1261405+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001064 ID=TCONS_00001064|Name=TCONS_00001064|organism=Clytia hemisphaerica|type=transcript|length=4333bp|location=Sequence derived from alignment at sc0000007:1257073..1261405+ (Clytia hemisphaerica)
taGCTTTCAATAAGAGCAAAGAGACAAGGTCGCAAGGTACATActacatt ttaaaacttttacaaattgACTTGGTGGTGATTAACGATCGGTAATCAGC ACATTTGACATTTTAAAGGTTACTATAATTCAAAGGATGGCGGACGATTT GAACACTATTTTATATATTGTATGTATACTGTACATTTTGTCAACTcaag gtttcttttgttgtcttTTCTACAAAGAGACCACCCATGATCCATATATT CGTTTAGACATCTACCGTTGTATTTTTTCTCGATAACGATATACCATACC AATAACCCTGTCCTGTTATCTCTCCCTAAAAAGACCCTATTTTTTTGTGA GGGCCGGGCGGGATAATGGGGTGGAACCCGGGCAAAAAGTTGTGCGGGAA TGTGCCGCTGTGACTAggttagggtaccttttttcatctccatgagtccc aggtaggctcacaaaaacactaaaatagaaaaatcagttcctTGGTAGAA TCTCGGAAGTAGAAATtcggcaaaattttcaaaaatcgagcACATGCAAT TTGACGGGgcggttttgttttcaaaagacCGCCCCCGCCAGCAGCGATCG CGTGCATGGATCTTTCTTTTTCGTGCGCGTCAAAGCAGAACAAACCAAAC CAGTCCAGTGGCAGAGAGGGGGAGGACACTAATTTTGTTTTCACCACTCC ATACCAACTAAATCAGGAAGAATTTCAGGTGGAATCTGGTTATGAATCTA CTAAACATGTTTGGCAGGAAGCTATATATTCAATTGAATTGGGGGTGTGA GTTATAtacttttttgaattatttataTCTTTTTACAGATGAATTTATGA ATAGTGAAGAGAGCCTTCCAAGCACACGACTCTTGAAAAAGAAACGTTGC TTTGCTGGATGTATATTGCACAACACCAACATCAATATATAGGACCATCA ATGTTTTTATATTGGCTTGCTTGGATTAAATATCATTTTAAACACTCTTT ATCTGGTTTTGGCTCTAAATTGTCTGTTGTTATGATTGTAAACTTGATTG TGTTTGGGACTGTTTGTGAAGAAAATTCATCTCTGTAGTGGAGCTACGTT ATATTTATTTAAAGTGAAAGCTTCAAGCTTAACAATTTAACCCAAGTTGC TTCTAGCTGTGAAGCTGGATTTATTAATAATTTATAAGAGCATGGCTGGT GCTCAACCACCAAACGAAAATGAAGAGGAGAAAATTCGTAGACTAATCCA AGATTTTGTTGGTGAAAGACTTCGGAGGAAAGGTATTTCTGTACCTGGCT ATGATCAAGAAGAACTTATCAACGAAAATAGTAGCATTTCCGAAATTGCA TTAACTTTACGAAGAGTTGGTGATGAATTTGAACTGGCAGCAGATACACA ATTTGTTGCAAACATGTGTACAAGACTTTCGATTACTCCAAATACTGCTT ATCCTATGTTCCAAGCAATATCTGATAAAATTTTTGCCTCAGGGAAAAAC TGGGGGCGAGTTGTAGCTTTTCTGACATTTGGTAGTTCTTTGGCAGTTCA TTGTGCTGAGAAACCTGACATGGGTGTTACGTTTGTCGATACAATAGTCA GTTGGATCCATCAGTACGTTGTCTCACGCTTGGGGGAATGGATCAAAGAA CAAGGTGGATTGGTAAGCTTTTTctataaactcaaaaatctttaccgtga gatcgggtaacttgcatcagtggaggctaacatgcataaccctcaaatga atgacctggctggtcattaaaatacaaagttacaacatcaaaacaaaaat ggtagagtagagctgtgagcggaaCCGCgaagttcctttgtttttaaatt ttgctgctttgattggtcagtcatttgatggctatgcaagttaccctcca ctgatgcaagttacacGACTTCATGGTATATATCAGGGTATAATGGGTCT AATGGTTTGTTGTCCATTCATTTTAAATAAGTGTAAGCTGTACCATCATC ATTGAGGTTAATTTCATAAGTTTGGAGTAACTTTCTAAATGTCTAAATCT TGGCCGCTAACAAGCACGTACtacttttatttgaaataaggCCTTCTCAA TGATTTTTACCATAAAAGTAGATTCTTTACTTACGTTAGTTTGTCTAATG TCAAAATCCCTCCTAATTCTGACAACCTTCTTTAGATATATGAATAAAAG GAAGGTCAGAATTgttgattgaaaaaatttttttcctttctgACCAGTAT GGTAAGCAAAGAaatagtttcaatcagcgaCTCTGACTTTTCTATTATTC CCATCTCTAAAAAGGATTTtagaattagatgagggatcaGGAAGGACGTG GACAATAGACCAACTACAGTAGACAAACTTTTGATCCTGACAGACAAAAA TTGACCCTGAGAAGTGGAAAAGATGACTAAAAGTGGACctgttttttgag atttaatgATTTTGTCATAATACTTTCAGGGCTTAAATAAGTGAGCATGT CAATACCCTTTCCCAAGTGACTCCCTCCCTCAGATATCATTTATGATAGT GCTTTAAAAAAGTATTGGGTGTGGTCAAAAGCTTTTTGtgcaagaaataa aaatacCAGATTTCACGAGTTAAAAAGTGATAATGACTGAAAAGAGTGTG AGTGTGAAGAAACATTTATcatgattttttaaagaacaatcCCTCAATTA TTATAGTTCAGTTAGACTGAGGTTTTTGAAGATTATTTCTATACATAGAT GAGAACATTCTTTTAGCAACACACATTTTGAATATAATTGGCTATGAATA TTTTCTTAGCATGGGAGATGAATAATCGATGCTTTGCTATTTAAACTGAT AATTGATTTCCTATTGAGCTTTTCAAAACTCTTTCAAAGATGACTTGAAA GTCTAAAGTACCTTTTGAAAATTGATGTCTCCTTCATTTGAGACATACAA AGTCACATGAGATAGTGAACCAACTTTATTCTTTCCTTGGGTGGTAttca ttttaaagtttgtatTGTATGTATAAgacaaaatatcaaataatGAAATC AACTCATATGACTTGACTACAACTAGGTCAGAGGAAAccccattgtaagg gagtgacATTGATAGGAATGCAATGATGAGCTTAATAATTTCTTTTATCA CAGACTCTCCCCCATAGAtgatttcttgtttttttatagGACAAAATAAG TATCGtcattatgaaaatatttttatgtaatcCTTTATACTGTTTTCGTT GGCCTgctaaaaatcattaaaaaaagacTGTCGCTTGtcaaaaacatatt tgaaaTTCTTGATATATACAATTTCCtatcaaatgttttttataattata gACTTGCCCAGTTGAAAAAGCGCTGAAGTAAGGTTCCCATGAATTGACCC TCCATTGCACAATTATCGTTaatcaaaaacaagttttcaTTTCCTGTAAA ATCTaatgtttattttatttctcctttttagaaagGATTCATGGACTTTT TCAAACGCGACCAAGCTCAAAATACGACTCAAAATGGATTCTTAATGTCC GCCCTAGCGGGTGTAGGATTGGGCGCTTTCCTAATGATGACCTTCAAATA GATCAAATTGCATGAAATTCAACATCTGTCGGGAGCGGCGACGAAAACGA ATCGAAAAGAATCGGTCAGCGCGACCGAATGATACCGAAAAGTCGAGTtc caaaaaaaacgaaaataaaagtGGAATTTTGGAACTGTCTCCCGTATCAC GAGGCGCGAGAGTTCTTCTGAATTGACGACGTTGTGTTAGTTTAATTGGA AATTGGTTATGAcgttttttgaatgtttgatAGACACTGTGGACATCGGG ATAATGAATGATTTACCAATATGTTGAAAGTAGTATACATAGATAGGAAG TGATTTCTTACGAGATTTCAGaaagttttcaaattcatcCAGCACTCATG CTGCTTTTCGTTTTGATTGCGAAACAGTGCGAATCTTATGACTGGTAAAC GATTGATTTAGCTCTATATTTTTGACGTAActatttgtaaaaaaatctta tatacccccacatttttgtttatttttattgctTATATCGATACTCCTAT TGCATATTGACTTGCTTGGATCCTGATAATCTTCAAAGCACTACAAGTAA TGCTAGTTCAGTTTAAACTGGGAAACCTGGGAAAACATGAAAGTATCTTA GTTCGCAAAAGGCTAGGGTCTTGAAGATGATAGGGTGCTAGCAAGTTTAG TGAAAATAGGTCTTTAAAACACCAACtcctctcgggtacctaataagcgt cccccCGCCAAAtaatttctcgaaaattttcca

Coding sequence (CDS) from alignment at sc0000007:1257073..1261405+

>TCONS_00001064 ID=TCONS_00001064|Name=TCONS_00001064|organism=Clytia hemisphaerica|type=CDS|length=1182bp|location=Sequence derived from alignment at sc0000007:1257073..1261405+ (Clytia hemisphaerica)
ATGGCTGGTGCTCAACCACCAAACGAAAATGAAGAGGAGAAAATTCGTAG
ACTAATCCAAGATTTTGTTGGTGAAAGACTTCGGAGGAAAGGTATTTCTG
TACCTGGCTATGATCAAGAAGAACTTATCAACGAAAATAGTAGCATTTCC
GAAATTGCATTAACTTTACGAAGAGTTGGTGATGAATTTGAACTGGCAGC
AGATACACAATTTGTTGCAAACATGTGTACAAGACTTTCGATTACTCCAA
ATACTGCTTATCCTATGTTCCAAGCAATATCTGATAAAATTTTTGCCTCA
GGGAAAAACTGGGGGCGAGTTGTAGCTTTTCTGACATTTGGTAGTTCTTT
GGCAGTTCATTGTGCTGAGAAACCTGACATGGGTGTTACGTTTGTCGATA
CAATAGTCAGTTGGATCCATCAGTACGTTGTCTCACGCTTGGGGGAATGG
ATCAAAGAACAAGGTGGATTGaaagGATTCATGGACTTTTTCAAACGCGA
CCAAGCTCAAAATACGACTCAAAATGGATTCTTAATGTCCGCCCTAGCGG
GTGTAGGATTGGGCGCTTTCCTAATGATGACCTTCAAATAGATGGCTGGT
GCTCAACCACCAAACGAAAATGAAGAGGAGAAAATTCGTAGACTAATCCA
AGATTTTGTTGGTGAAAGACTTCGGAGGAAAGGTATTTCTGTACCTGGCT
ATGATCAAGAAGAACTTATCAACGAAAATAGTAGCATTTCCGAAATTGCA
TTAACTTTACGAAGAGTTGGTGATGAATTTGAACTGGCAGCAGATACACA
ATTTGTTGCAAACATGTGTACAAGACTTTCGATTACTCCAAATACTGCTT
ATCCTATGTTCCAAGCAATATCTGATAAAATTTTTGCCTCAGGGAAAAAC
TGGGGGCGAGTTGTAGCTTTTCTGACATTTGGTAGTTCTTTGGCAGTTCA
TTGTGCTGAGAAACCTGACATGGGTGTTACGTTTGTCGATACAATAGTCA
GTTGGATCCATCAGTACGTTGTCTCACGCTTGGGGGAATGGATCAAAGAA
CAAGGTGGATTGaaagGATTCATGGACTTTTTCAAACGCGACCAAGCTCA
AAATACGACTCAAAATGGATTCTTAATGTCCGCCCTAGCGGGTGTAGGAT
TGGGCGCTTTCCTAATGATGACCTTCAAATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000603XLOC_000603Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001064-proteinTCONS_00001064-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001064-exon-sc0000007-1491911889:1257073..1257108TCONS_00001064-exon-sc0000007-1491911889:1257073..1257108Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1510915933:1257073..1257108TCONS_00001064-exon-sc0000007-1510915933:1257073..1257108Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1575043694:1257073..1257108TCONS_00001064-exon-sc0000007-1575043694:1257073..1257108Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1491911889:1257911..1258734TCONS_00001064-exon-sc0000007-1491911889:1257911..1258734Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1510915933:1257911..1258734TCONS_00001064-exon-sc0000007-1510915933:1257911..1258734Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1575043694:1257911..1258734TCONS_00001064-exon-sc0000007-1575043694:1257911..1258734Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1491911889:1260554..1261405TCONS_00001064-exon-sc0000007-1491911889:1260554..1261405Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1510915933:1260554..1261405TCONS_00001064-exon-sc0000007-1510915933:1260554..1261405Clytia hemisphaericaexon
TCONS_00001064-exon-sc0000007-1575043694:1260554..1261405TCONS_00001064-exon-sc0000007-1575043694:1260554..1261405Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1257073..1261405 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
74.2067 62.953 20.3039 12.4566 51.7227 41.7359 46.1185 50.4954 49.5597 56.4587 40.5849 27.4528 36.6081 24.2343 30.2324 28.9041 51.8566 53.8916 27.6206 38.3311 59.1106 64.2819 94.4706 91.7573 20.8471 31.2012 120.472 137.408 102.855 105.053
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR026298Blc2_fam
IPR002475Bcl2-like
Vocabulary: Biological Process
TermDefinition
GO:0042981regulation of apoptotic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0042981 regulation of apoptotic process
Blast
BLAST of TCONS_00001064 vs. Swiss-Prot (Human)
Match: B2CL1 (Bcl-2-like protein 1 OS=Homo sapiens GN=BCL2L1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.311e-19
Identity = 45/114 (39.47%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  555 LRRVGDEFELAADTQFVANMCTRLSITPNTAYPMFQAISDKIFASGKNWGRVVAFLTFGSSLAVHCAEKPDMGVTFVDTIVSWIHQYVVSRLGEWIKEQGGLKGFMDFFKRDQA 896
            LR  GDEFEL     F +++ ++L ITP TAY  F+ + +++F  G NWGR+VAF +FG +L V   +K +M V  V  I +W+  Y+   L  WI+E GG   F++ +  + A
Sbjct:   90 LREAGDEFELRYRRAF-SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDK-EMQV-LVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA 200          
The following BLAST results are available for this feature:
BLAST of TCONS_00001064 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
B2CL12.311e-1939.47Bcl-2-like protein 1 OS=Homo sapiens GN=BCL2L1 PE=... [more]
back to top