Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001062 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001062
Unique NameTCONS_00001062
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1852

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001062 ID=TCONS_00001062|Name=TCONS_00001062|organism=Clytia hemisphaerica|type=transcript|length=1852bp
CTTGCCCTGGCCGGTGAGGTACTACAGAAATGACTGGTGAGAATTTCAAT
GATTTCCTACGAAAAACGACATACTGAGaacgatttgaaaataattttgt
tctACTTTTGAGTGGTTCGTATTCCCCCTTTTGTATAGGGGAGTGAGTGT
TGcatctttccaaatttttgatattccaccctgtttcagtgacctGCTTT
CAATAATCATGTCTAATACCTTTactttctttgatgttttttagattcaa
ttttaaaaaaaaacaatactttAGAATGTAGGGGAAATGGTATATCTAAT
AATCTTTGTAATCCTGGTGGCAGTTTATCCTTTTGAAACTGTTGGTCAGA
AACAAGCATGGTCTAATGTTGTGGCAAGCACATGTAAATTCACTGTGAAT
CATGACCTTGATATTCGATTCGAACAAAACCCCTTGCTGTTCATTGATCG
ATTGACTGAACCTGATGTCAACAGTTGTCGAAAGCAATGTTGTGACCACA
AAACATGTAATAGCTATGTGTGGGATGCATATGATCGAGTGAATGGCAAC
TGCAAATTATTGAAGTGTTCAGATGAAGGGACAGATTGTAGGAATGCATT
AACACGAAGAACAAGTGTTGGTGAAGATATAAGTCAACACGAAGTGGGCT
TCATCACTGGCGTCACTGATAACACAACGCCCAATCCTTTGGACGCTGTG
TTAGGCCCTCAACCCACTCCAAAAACGACGACCTTGAAAACGAATCCTCC
ACACATGTATCCTTCATCTCAAGTAAAGCAGGACAATCTTGTTACAGATA
CACCTTTTTCAAGAAAGCCTCTCGCATCTACAACAACTACGACCAAATCT
GTCCCTTTGATAAAAGACATGGCTGAAAGGCCATCTACAACGACCACTAC
ATCAAGTACGACATTCATGAGATCAGCAATGAGCACTATCAAACCAGCAA
CATCAACTAAAACTTCCACAGTAGTGACACCTGTTCCAACAATAATGGAA
TTTTTACAAACGAACCAATCAACAACAGATTTACCATTGACCAcTCCAAA
GAAGACGCATATTCACACGAAAACACCAAAGAACGTAACCAAGTCATCTT
CAAAGGGGGTCATTGAGGCAGGAAGTGGAATTTCTCATTCTGATAACATC
TCTTTAACTGGTGCAGTTTTCTTTGGACTTGCTTTTTCCTTTGTGACCAT
TTATTTAGTTGGTAAACGGTGGATAGAAGGACTTCGAGAATCTAAAGGCA
GGCGTGGTTACACTCGTATTTCCTATCTTCTAAATGGAGTTTGAGTTTCG
ATATTCGTTTGAATATATTAGGTTTGATAAGTTAGGGTTCGTAGATTTCG
ATATTCGTTTTTGAGTATCTGTTTTTTGGATATTTATCGACGTTTGTAAA
TATAAGTTATTTTGGAGTAAAATGCAATAAGTTCTCATCAAATTACATCA
CAAATGTTTTCAAGGAACAAAATTTTGACACCCTGACTTCTTTATTCGTT
CTCAGTTAATACACTATTTTTGGAGACtctaaaaaaaactttcctGATTA
TTTGACTTAATTAGGTTTGCTTCTCCGTTCTAGATGTTATATTTTGATGA
TTGTTATCTATAATCATTcttaaaatatttaatttttggttgtacatgtt
tttttttaccttgCTTTATTTATTTCACTTGATGATTCACTTGAAAAAGG
GATAATTTCGTAATATTAGCGTCTTATATACATTATTcacatcatttttg
aaattatgcatTTTTAAGAATGATATTTTGTACAACttgataaaaaatat
gaaagagcttgaatttaaaagaagaatttttcctTCTCATATTCATCTAA
TT
Run BLAST on NCBI

protein sequence of TCONS_00001062-protein

>TCONS_00001062-protein ID=TCONS_00001062-protein|Name=TCONS_00001062-protein|organism=Clytia hemisphaerica|type=polypeptide|length=335bp
MVYLIIFVILVAVYPFETVGQKQAWSNVVASTCKFTVNHDLDIRFEQNPL
LFIDRLTEPDVNSCRKQCCDHKTCNSYVWDAYDRVNGNCKLLKCSDEGTD
CRNALTRRTSVGEDISQHEVGFITGVTDNTTPNPLDAVLGPQPTPKTTTL
KTNPPHMYPSSQVKQDNLVTDTPFSRKPLASTTTTTKSVPLIKDMAERPS
TTTTTSSTTFMRSAMSTIKPATSTKTSTVVTPVPTIMEFLQTNQSTTDLP
LTTPKKTHIHTKTPKNVTKSSSKGVIEAGSGISHSDNISLTGAVFFGLAF
SFVTIYLVGKRWIEGLRESKGRRGYTRISYLLNGV
Run BLAST on NCBI

transcript from alignment at sc0000007:1253534..1256195+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001062 ID=TCONS_00001062|Name=TCONS_00001062|organism=Clytia hemisphaerica|type=transcript|length=2662bp|location=Sequence derived from alignment at sc0000007:1253534..1256195+ (Clytia hemisphaerica)
CTTGCCCTGGCCGGTGAGGTACTACAGAAATGACTGGTGAGAATTTCAAT GATTTCCTACGAAAAACGACATACTGAGaacgatttgaaaataattttgt tctACTTTTGAGTGGTTCGTATTCCCCCTTTTGTATAGGGGAGTGAGTGT TGcatctttccaaatttttgatattccaccctgtttcagtgacctGCTTT CAATAATCATGTCTAATACCTTTactttctttgatgttttttagattcaa ttttaaaaaaaaacaatactttAGAATGTAGGGGAAATGGTATATCTAAT AATCTTTGTAATCCTGGTGGCAGTTTATCCTTTTGAAACTGTTGGTCAGA AACAAGCATGGTCTAATGTTGTGGCAAGCACATGTAAATTCACTGTGAAT CATGACCTTGATATTCGATTCGAACAAAACCCCTTGCTGTTCATTGATCG ATTGACTGAACCTGATGTCAACAGTTGTCGAAAGCAATGTTGTGACCACA AAACATGTAATAGCTATGTGTGGGATGCATATGATCGAGTGAATGGCAAC TGCAAATTATTGAAGTGTTCAGATGAAGGGACAGATTGTAGGAATGCATT AACACGAAGAACAAGTGTTGGTGAAGATATAAGTCAACACGAAGTGGGCT TCATCACTGGCGTCACTGATAACACAACGCCCAGTAAGTCCACTGGTTTT CTCAATAACACAACGCCCAGTAAGTCCACTGGTTTTCTCAGTATCTCATC TCAATTAATATTCTTATGCCATATTCGATCATATTTTAACCATTCTTATT TCTCGTTGCCTATTCACGCCTAAAAATTAGAGATTTCAATTCTCTTGAAA CAAATCTTAAAAAGACCTATTCATATATCTTTTTTAATAGGCATAATTTT TAATGTCTTTTTATTTCAGATCCTTTGGACGCTGTGTTAGGCCCTCAACC CACTCCAAAAACGACGACCTTGAAAACGAATCCTCCACACATGTATCCTT CATCTCAAGTAAAGCAGGACAATCTTGTTACAGATACACCTTTTTCAAGA AAGCCTCTCGCATCTACAACAACTACGACCAAATCTGTCCCTTTGATAAA AGACATGGCTGAAAGGCCATCTACAACGACCACTACATCAAGTACGACAT TCATGAGATCAGCAATGAGCACTATCAAACCAGCAACATCAACTAAAACT TCCACAGTAGTGACACCTGTTGTGagttttataatattttttctaatcCA CGATACACATCTCGCATGATTACTCCTTTTTTCCTATCAGAACCATATAG ACCAGCAAGCATGACCTGTATAGACCGCAAAACTGGAATTAATTTCTATT AGaggtgaaatttatgacttttaTCTTTTGAAATCATCTGCAGATCGTCC AAAAACTGAAAGCCTTAGAAATCGCCAAAATAGTTAAATATATAAGTTGA TATATTCAAAGTCTTTTAATGTctattttgattaaattttaaAGTACACC TTTTCTTCTACTTTCCAGCCAACAATAATGGAATTTTTACAAACGAACCA ATCAACAACAGATTTACCATTGACCAGTATGTTTTCTTTCTCATGCTCTC TTTTCTCCATTTACCTTTAAAACTTTCATGGGCTCCCTCTTGTTTGCGAA TCAGTCAGGCTTGATTTATTGATGTTTTGGTTGGTTGAATATATTTGAAA TAAGTTGATGTTTTCGTGATAAATTTTGTCTTCGTCAAGCATTAAAGTAA ATTTCCAATGTCACGAGACTCGTCATTAGAGACTTCAAAGGCTAAGAATA CGttcaaggttaaaaaaaacTCTAATATTCACAGccaatgttttttgttt tagcTCCAAAGAAGACGCATATTCACACGAAAACACCAAAGAACGTAACC AAGTCATCTTCAAAGGGGGTCATTGAGGCAGGAAGTGGAATTTCTCATTC TGATAACATCTCTTTAACTGGTGCAGTTTTCTTTGGACTTGCTTTTTCCT TTGTGACCATTTATTTAGTTGGTAAACGGTGGATAGAAGGACTTCGAGAA TCTAAAGGCAGGCGTGGTTACACTCGTATTTCCTATCTTCTAAATGGAGT TTGAGTTTCGATATTCGTTTGAATATATTAGGTTTGATAAGTTAGGGTTC GTAGATTTCGATATTCGTTTTTGAGTATCTGTTTTTTGGATATTTATCGA CGTTTGTAAATATAAGTTATTTTGGAGTAAAATGCAATAAGTTCTCATCA AATTACATCACAAATGTTTTCAAGGAACAAAATTTTGACACCCTGACTTC TTTATTCGTTCTCAGTTAATACACTATTTTTGGAGACtctaaaaaaaact ttcctGATTATTTGACTTAATTAGGTTTGCTTCTCCGTTCTAGATGTTAT ATTTTGATGATTGTTATCTATAATCATTcttaaaatatttaatttttggt tgtacatgtttttttttaccttgCTTTATTTATTTCACTTGATGATTCAC TTGAAAAAGGGATAATTTCGTAATATTAGCGTCTTATATACATTATTcac atcatttttgaaattatgcatTTTTAAGAATGATATTTTGTACAACttga taaaaaatatgaaagagcttgaatttaaaagaagaatttttcctTCTCAT ATTCATCTAATT

Coding sequence (CDS) from alignment at sc0000007:1253534..1256195+

>TCONS_00001062 ID=TCONS_00001062|Name=TCONS_00001062|organism=Clytia hemisphaerica|type=CDS|length=4032bp|location=Sequence derived from alignment at sc0000007:1253534..1256195+ (Clytia hemisphaerica)
ATGGTATATCTAATAATCTTTGTAATCCTGGTGGCAGTTTATCCTTTTGA
AACTGTTGGTCAGAAACAAGCATGGTCTAATGTTGTGGCAAGCACATGTA
AATTCACTGTGAATCATGACCTTGATATTCGATTCGAACAAAACCCCTTG
CTGTTCATTGATCGATTGACTGAACCTGATGTCAACAGTTGTCGAAAGCA
ATGTTGTGACCACAAAACATGTAATAGCTATGTGTGGGATGCATATGATC
GAGTGAATGGCAACTGCAAATTATTGAAGTGTTCAGATGAAGGGACAGAT
TGTAGGAATGCATTAACACGAAGAACAAGTGTTGGTGAAGATATAAGTCA
ACACGAAGTGGGCTTCATCACTGGCGTCACTGATAACACAACGCCCAATC
CTTTGGACGCTGTGTTAGGCCCTCAACCCACTCCAAAAACGACGACCTTG
AAAACGAATCCTCCACACATGTATCCTTCATCTCAAGTAAAGCAGGACAA
TCTTGTTACAGATACACCTTTTTCAAGAAAGCCTCTCGCATCTACAACAA
CTACGACCAAATCTGTCCCTTTGATAAAAGACATGGCTGAAAGGCCATCT
ACAACGACCACTACATCAAGTACGACATTCATGAGATCAGCAATGAGCAC
TATCAAACCAGCAACATCAACTAAAACTTCCACAGTAGTGACACCTGTTC
CAACAATAATGGAATTTTTACAAACGAACCAATCAACAACAGATTTACCA
TTGACCAcTCCAAAGAAGACGCATATTCACACGAAAACACCAAAGAACGT
AACCAAGTCATCTTCAAAGGGGGTCATTGAGGCAGGAAGTGGAATTTCTC
ATTCTGATAACATCTCTTTAACTGGTGCAGTTTTCTTTGGACTTGCTTTT
TCCTTTGTGACCATTTATTTAGTTGGTAAACGGTGGATAGAAGGACTTCG
AGAATCTAAAGGCAGGCGTGGTTACACTCGTATTTCCTATCTTCTAAATG
GAGTTTGAATGGTATATCTAATAATCTTTGTAATCCTGGTGGCAGTTTAT
CCTTTTGAAACTGTTGGTCAGAAACAAGCATGGTCTAATGTTGTGGCAAG
CACATGTAAATTCACTGTGAATCATGACCTTGATATTCGATTCGAACAAA
ACCCCTTGCTGTTCATTGATCGATTGACTGAACCTGATGTCAACAGTTGT
CGAAAGCAATGTTGTGACCACAAAACATGTAATAGCTATGTGTGGGATGC
ATATGATCGAGTGAATGGCAACTGCAAATTATTGAAGTGTTCAGATGAAG
GGACAGATTGTAGGAATGCATTAACACGAAGAACAAGTGTTGGTGAAGAT
ATAAGTCAACACGAAGTGGGCTTCATCACTGGCGTCACTGATAACACAAC
GCCCAATCCTTTGGACGCTGTGTTAGGCCCTCAACCCACTCCAAAAACGA
CGACCTTGAAAACGAATCCTCCACACATGTATCCTTCATCTCAAGTAAAG
CAGGACAATCTTGTTACAGATACACCTTTTTCAAGAAAGCCTCTCGCATC
TACAACAACTACGACCAAATCTGTCCCTTTGATAAAAGACATGGCTGAAA
GGCCATCTACAACGACCACTACATCAAGTACGACATTCATGAGATCAGCA
ATGAGCACTATCAAACCAGCAACATCAACTAAAACTTCCACAGTAGTGAC
ACCTGTTCCAACAATAATGGAATTTTTACAAACGAACCAATCAACAACAG
ATTTACCATTGACCAcTCCAAAGAAGACGCATATTCACACGAAAACACCA
AAGAACGTAACCAAGTCATCTTCAAAGGGGGTCATTGAGGCAGGAAGTGG
AATTTCTCATTCTGATAACATCTCTTTAACTGGTGCAGTTTTCTTTGGAC
TTGCTTTTTCCTTTGTGACCATTTATTTAGTTGGTAAACGGTGGATAGAA
GGACTTCGAGAATCTAAAGGCAGGCGTGGTTACACTCGTATTTCCTATCT
TCTAAATGGAGTTTGAATGGTATATCTAATAATCTTTGTAATCCTGGTGG
CAGTTTATCCTTTTGAAACTGTTGGTCAGAAACAAGCATGGTCTAATGTT
GTGGCAAGCACATGTAAATTCACTGTGAATCATGACCTTGATATTCGATT
CGAACAAAACCCCTTGCTGTTCATTGATCGATTGACTGAACCTGATGTCA
ACAGTTGTCGAAAGCAATGTTGTGACCACAAAACATGTAATAGCTATGTG
TGGGATGCATATGATCGAGTGAATGGCAACTGCAAATTATTGAAGTGTTC
AGATGAAGGGACAGATTGTAGGAATGCATTAACACGAAGAACAAGTGTTG
GTGAAGATATAAGTCAACACGAAGTGGGCTTCATCACTGGCGTCACTGAT
AACACAACGCCCAATCCTTTGGACGCTGTGTTAGGCCCTCAACCCACTCC
AAAAACGACGACCTTGAAAACGAATCCTCCACACATGTATCCTTCATCTC
AAGTAAAGCAGGACAATCTTGTTACAGATACACCTTTTTCAAGAAAGCCT
CTCGCATCTACAACAACTACGACCAAATCTGTCCCTTTGATAAAAGACAT
GGCTGAAAGGCCATCTACAACGACCACTACATCAAGTACGACATTCATGA
GATCAGCAATGAGCACTATCAAACCAGCAACATCAACTAAAACTTCCACA
GTAGTGACACCTGTTCCAACAATAATGGAATTTTTACAAACGAACCAATC
AACAACAGATTTACCATTGACCAcTCCAAAGAAGACGCATATTCACACGA
AAACACCAAAGAACGTAACCAAGTCATCTTCAAAGGGGGTCATTGAGGCA
GGAAGTGGAATTTCTCATTCTGATAACATCTCTTTAACTGGTGCAGTTTT
CTTTGGACTTGCTTTTTCCTTTGTGACCATTTATTTAGTTGGTAAACGGT
GGATAGAAGGACTTCGAGAATCTAAAGGCAGGCGTGGTTACACTCGTATT
TCCTATCTTCTAAATGGAGTTTGAATGGTATATCTAATAATCTTTGTAAT
CCTGGTGGCAGTTTATCCTTTTGAAACTGTTGGTCAGAAACAAGCATGGT
CTAATGTTGTGGCAAGCACATGTAAATTCACTGTGAATCATGACCTTGAT
ATTCGATTCGAACAAAACCCCTTGCTGTTCATTGATCGATTGACTGAACC
TGATGTCAACAGTTGTCGAAAGCAATGTTGTGACCACAAAACATGTAATA
GCTATGTGTGGGATGCATATGATCGAGTGAATGGCAACTGCAAATTATTG
AAGTGTTCAGATGAAGGGACAGATTGTAGGAATGCATTAACACGAAGAAC
AAGTGTTGGTGAAGATATAAGTCAACACGAAGTGGGCTTCATCACTGGCG
TCACTGATAACACAACGCCCAATCCTTTGGACGCTGTGTTAGGCCCTCAA
CCCACTCCAAAAACGACGACCTTGAAAACGAATCCTCCACACATGTATCC
TTCATCTCAAGTAAAGCAGGACAATCTTGTTACAGATACACCTTTTTCAA
GAAAGCCTCTCGCATCTACAACAACTACGACCAAATCTGTCCCTTTGATA
AAAGACATGGCTGAAAGGCCATCTACAACGACCACTACATCAAGTACGAC
ATTCATGAGATCAGCAATGAGCACTATCAAACCAGCAACATCAACTAAAA
CTTCCACAGTAGTGACACCTGTTCCAACAATAATGGAATTTTTACAAACG
AACCAATCAACAACAGATTTACCATTGACCAcTCCAAAGAAGACGCATAT
TCACACGAAAACACCAAAGAACGTAACCAAGTCATCTTCAAAGGGGGTCA
TTGAGGCAGGAAGTGGAATTTCTCATTCTGATAACATCTCTTTAACTGGT
GCAGTTTTCTTTGGACTTGCTTTTTCCTTTGTGACCATTTATTTAGTTGG
TAAACGGTGGATAGAAGGACTTCGAGAATCTAAAGGCAGGCGTGGTTACA
CTCGTATTTCCTATCTTCTAAATGGAGTTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000602XLOC_000602Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001062-exon-sc0000007-1491911889:1253534..1254216TCONS_00001062-exon-sc0000007-1491911889:1253534..1254216Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1510915933:1253534..1254216TCONS_00001062-exon-sc0000007-1510915933:1253534..1254216Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1575043694:1253534..1254216TCONS_00001062-exon-sc0000007-1575043694:1253534..1254216Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1491911889:1254453..1254754TCONS_00001062-exon-sc0000007-1491911889:1254453..1254754Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1510915933:1254453..1254754TCONS_00001062-exon-sc0000007-1510915933:1254453..1254754Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1575043694:1254453..1254754TCONS_00001062-exon-sc0000007-1575043694:1254453..1254754Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1491911889:1255052..1255109TCONS_00001062-exon-sc0000007-1491911889:1255052..1255109Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1510915933:1255052..1255109TCONS_00001062-exon-sc0000007-1510915933:1255052..1255109Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1575043694:1255052..1255109TCONS_00001062-exon-sc0000007-1575043694:1255052..1255109Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1491911889:1255387..1256195TCONS_00001062-exon-sc0000007-1491911889:1255387..1256195Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1510915933:1255387..1256195TCONS_00001062-exon-sc0000007-1510915933:1255387..1256195Clytia hemisphaericaexon
TCONS_00001062-exon-sc0000007-1575043694:1255387..1256195TCONS_00001062-exon-sc0000007-1575043694:1255387..1256195Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001062-proteinTCONS_00001062-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1253534..1256195 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
76.5763 80.8197 45.1669 42.0122 73.6015 57.0001 66.9493 69.0299 64.2239 55.7028 56.9055 54.7913 35.9966 34.5001 27.6845 29.1032 31.8862 35.7685 27.5679 32.2228 20.2094 21.3361 44.2521 38.6168 34.9945 34.9859 21.8457 20.0662 23.7123 23.1858
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001062 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top