Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001054 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001054
Unique NameTCONS_00001054
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2740

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001054 ID=TCONS_00001054|Name=TCONS_00001054|organism=Clytia hemisphaerica|type=transcript|length=2740bp
TGAAGGTAATATCATGAATTTATCTGGCATCAAGTGGCTTTTTTCCCCTG
ATGTGTGAGAGCATTGGTCTCCAAAACCTAGACAACACATACCTGACCAT
TATTCAATAATTGAATCATTATGCTATGCGGCACTATCTGACGGAATTGG
ATTTCCAAAATGGCAATGCTTTTTTTGCATTCAATGCTTTCCAATTACTA
ATTGGTGTTTTTCTTTCAGGATAAAAAGATGTTaagaattttaacttttt
tccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCA
CATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATGAC
CAGTATCAAAACACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTG
AGccaacaaaaaaacattatgtACCTGAAAATTTAGGTGAGATTTTGAGA
GGTGATCGAATTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAACT
ACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAA
AAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACATgatCATT
GATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAACATGG
ATACAAACTTGGTTTTTATACAACAGATAATAAAGCTATATTGAACAATC
ACCTTCGAATGACTATCAAATATAACAAAgacactgagaaGAGTGTATTT
CGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAGAA
AGATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCAC
TCATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGTACAT
TGGGAAaaaagtgAGATTCGTTGGTCAACACGATGGGACACTTACCTTCA
GATGAGCAATGTACAAGTTCATTGGTTTGCTATCATTAACTCTATTGTCA
TCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATCATTCGAACGTTA
CGGAGGGATATCGCAAACTATAACAAAGACGATGATTTAGAAGAGGCCTT
GGAAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCAC
GCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTT
TGCATGGTCCTTATCACTATTGTATTTGCCATGTTGGGTATGCTATCACC
AGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTTCA
TGGGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAAAACATTGAAG
GGACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCTGG
AATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAAAC
AATCATCGGGTGCTATACCATTCACGACGATGATTGCTTTATTTTGCTTG
TGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGATA
CAGAAAAGCTccatacacgcATTCCGTAcgaaccaatcaaattccaAGAC
AAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGATG
GCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATTTT
AACTGCAATTTGGGAGaatcaattttattatttgtttggtttcttgtttt
tggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCATG
GTGTACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCGTT
CATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCT
ATTTCGTCACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTGATATAT
TTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCATCACTGGAAC
GATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTG
TCAAAATCGATTGAGCCCGATTCAATGATATTTTCATCAATTACTGACAT
AGTCatcttattttttaaattaactTCTATTTTTTCACCATATCTGAcat
gttttgtttataaatgaATTTCTCCAATAAGTAGATCAAAATGATCACAG
TCGACTTTTCCATTGCTCGAACGGTGGCTCCTGGGAAAACCGTCTTTTGT
GGTTCTCTTTAACAATTAAGATTACTGGTTTGCTCTTAACCTGACTCATG
CACTTGCGAGTCTAATAATGGACCAGACAACAGTAATTGTGGTGTGAACA
TCGGCTTTTTTCCCTTTGTTCCTAATTTTAGATAGGAAATGGCAATATGT
TAAACATAGGAAGAATATCTTCCAGTTTTTACAAAGTTGGACCCAATACT
GACCTTCAAAAAGAGTGGTGCTGAAGCTTGGTTTCGTTAAGGCTCTTTTT
GCTGTTGTTGTGTTTCTGAGTGAATGATGTTTGTGAGGAGATTTATGgta
aaagaatattttcaataacAATGACTTTTTATTAGGGTGTAGGAATTTTT
CATACTATTTTAGCCGCATTGTTTTTTGTAGAAGTATATACTGTAGGTTT
TACTCTGTAATTTATTATATTTATGCACAACCCGTTTAACAACACAGAGA
AAAGAAACCTAAAACAATGTCCCAAACATTTATTTTGGAA
Run BLAST on NCBI

protein sequence of TCONS_00001054-protein

>TCONS_00001054-protein ID=TCONS_00001054-protein|Name=TCONS_00001054-protein|organism=Clytia hemisphaerica|type=polypeptide|length=611bp
MLRILTFFLCLQNVASFYVPGVAPHEFAEGEEIYPKAVKMTSIKTQLPYD
YYTLAFCEPTKKHYVPENLGEILRGDRIVNTPYKLEAGKKLPCTFLCPSK
KLSGSQSKAFMERIKEDYSIHMIIDNLPAADLREGIKPQHGYKLGFYTTD
NKAILNNHLRMTIKYNKDTEKSVFRVVGFQVEASSISNIKKDSANTCAFP
SNAESKPLIINQGENEVQFSYEVHWEKSEIRWSTRWDTYLQMSNVQVHWF
AIINSIVIVLFLTGLLAMIIIRTLRRDIANYNKDDDLEEALEETGWKLVH
GDVFRPPRYPMILSALVGSGVQVFCMVLITIVFAMLGMLSPASRGSLATA
IIFLYVFMGTFAGYYSARLYKTLKGLHWKRAAFTTGLLFPGIVFSIAFFL
NFFLWGKQSSGAIPFTTMIALFCLWFGISIPLVYLGYFFGYRKAPYTHSV
RTNQIPRQVPDQVWYMHPFIGVLMAGILPFGAVFIELFFILTAIWENQFY
YLFGFLFLVFVILGICCSEIAIVMVYFQLCGEDYHWWWRSFMMSGACAVY
VFLYAIFYFVTKLEIVSVVSGLIYFGYSAIMVFAFWIITGTIGFFATYAF
VRTIYSAVKID
Run BLAST on NCBI

transcript from alignment at sc0000007:1075408..1086084+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001054 ID=TCONS_00001054|Name=TCONS_00001054|organism=Clytia hemisphaerica|type=transcript|length=10677bp|location=Sequence derived from alignment at sc0000007:1075408..1086084+ (Clytia hemisphaerica)
TGAAGGTAATATCATGAATTTATCTGGCATCAAGTGGCTTTTTTCCCCTG ATGTGTGAGAGCATTGGTCTCCAAAACCTAGACAACACATACCTGACCAT TATTCAATAATTGAATCATTATGCTATGCGGCACTATCTGACGGAATTGG ATTTCCAAAATGGCAATGCTTTTTTTGCATTCAATGCTTTCCAATTACTA ATTGGTGTTTTTCTTTCAGGATAAAAAGATGTTaagaattttaacttttt tccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCA CATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGTAACTATTAAAGG GCAAAACCACTTACTTTCTTAACCAACTTCTTTTTGAAAcgaaaatttat taaaacaGACTGAAATCTAATTTAgtaatttttagtttatttaacTTTCA AGAATCTTCTGTATTCTAATTAGGATTTGGCTATTTTTGAAGGACAGTGA GATATCGAGTAGCactcttttttcaaatttgatttccTGGGTGTGTTGCT TTTTAGAATGTGACATTAAAGATGAAAAACATTGAACTATTTCATAGGAT TTCTATACAAAAAATTGTTAGGGATAATGTTTTATAATCCATGAGAAACC ACAACAAAATGATTTAATGCATTTTTAGGCTGTCAAGATGACCAGTATCA AAACACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTGAGccaaca aaaaaacattatgtACCTGAAAATTTAGGTAAGTTAGTATTTGTGACCCC CTAGGCGATTTTGAGTACATTAGAaatgagaccggtcttggtgcggaCAG ATCGATAAAATGTGCGGCAAAAAAGCGGCGAAACGATTAACAGGCGGTAA AATGATACCTTTGTATCGGCcagaaatcatccaaaaatcttttctaaaaa TCCATTGAAATGCACTCGATCGGTCACTAAAGAGCACCATTTGAATAAGT GCGGTATTCAGTGCGGTCATGGTGCGGACATTTTGCCGTTCGAAACGTTT GCCGGCAAACGAGAAATCATAACAAACAGCATACATTTTACGGAATGGTT TTTTACGTGACTGTTTGCCGATTTTATAACGTTtggcaaaataaacaaag ttgAACTCAAGAATTCACATGTGAGCATCGAACATCGAAAGTTCTTTTTG TGTGTCCAGAAACAAGTTGTTGTTTTgcttgaggctgaaattcttacGGC AACcgaaagaaatataaacaaacggcGGGGACCGCACCATCATCTGCTTT AGTCGGCGCGGACCACACCATCGTCCGCTTTAATCGGCGTTTTGTACGCA CAGACCATACGGTACTGTGCGGTCTTCTGGccgcttttttcaacttttaa acgCACAATTAACCAGTCAGAAAGCGGCACGAGCACGACCGCACCAAGAC CGATCtcgtttttaatgtactccaaatcgtttGGAGGGTCACATTTATCT TTACTCAAATGTTTAACGTATATTCAGCCTATGCTCATAGAGGTTTTGAA AAGGTTGTTGGAattggtcggtcggtcggtcNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNttcaaattttctgattttttgcacaaagatgtattACTGTAAACCAT TGAATGTGAATGTTTAGGTGTGAAATTTTGTTTACTAGACGTGTTTTtac aaattcaatatttttttataagcacattaccaATTACTTAGTTATTACat agcttttcttgagattggcttattcattctttatgatatttttaaCAAAG GTGCGTAACTATAAACCTGACGTAGGCCAAttctcgaaaaaaaaattttg gggcactatttgtgttctgaaagattgtttaatggtcacgctcacataga tatcaattatacGTGTTAATAAATGCATAAGCAGGTAGGCCCATAAAAGC ATCTTTTGCTTTATTATGCTTTATTATATAATGAGATATAATTTCATACT TCTTACACTAGGTTTTGAATTACAATATTCATCTCATAATTATTTTGTTG TATAATTTTCATCTTCTTGCACTAGGTGAGATTTTGAGAGGTGATCGAAT TGTAAATACACCGTACAAGGTAAGGTGGATGTTCCTTTCTCTAGTATGAC CCTTCAAATTCTAAGATAAATTTGATTTGCTAATATTTATGACAAattct tttataaatttttaatcttttatctTTAGCTTGAAGCAGGGAAAAAACTA CCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAA AGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACATGTGagttt gctcttcaactttCATTCTATAAGTTTAATGTGATATTACCTAATCAATC TAGGCTTTTAGAGGCGATGGGGAGGgagggcttttcctgtaccacccctt aacttttgatctagtgggtcgttttggatgaaatttggcacacaagattc ttgttacataaagtaacttttgacaaaacattttttttgatgacgtcact cattaTGTCCAAAGTAAGCAAAAACCttaaatttcctttgttctcataaa tagctattgtattctaacaaaggctttagaaaaaagttgcctgagtttaa aatgcttattttatcctaaatattcaataaattacgatttaaacaatata tttgacataaaaaataaatttgtattggaaaagtgtcaatttgaCACCTt gctgtcagaaatgtcatcatgctcaaggtgtgaaaatatttaagtgtcaa attttttttttttgaagataaGTAAAAGTTAGGAAtctacagaaaatttc atggcaaaagctctattacttttggagctattaccaataacttgacctcc gaacagaaacagccccccctatttataaataataaattttttgtttttag gatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGGTAT GAGGTGCAAAAAGATTGTAAACAGACATTTCATATCTTTAGATTGTATTT CACCAAACTAACCAACTCTTCCCTTTAAGGACTGTGTAATACTGTTTGCA TGAAAAATTACAACAATTCCTCTTTACTTAACCCTTTTTTTCAGCCACAA CATGGATACAAACTTGGTTTTTATACAACAGATAATGTAAGCTTTGAtat catattttgatttttgaattcagCCCTCATCTTTGCGATCATAAGCTTTT TGTTCATTTGTTGTTTACTTATGATTCCATGTGATTGAATCTTtaatttt cagatattttgtaCAAAGCCATAAACCATCAAATCTGAAATCTGATGGAG CTTGatcttcaaacaataaaaaatgagaaatttcaACCAAGAATTagctt taaaaagttttttattatgTTTGTTTCTGTCACATCTTAATGactgtata tttttataaatatttttgtttccgttCTAGGCTGCCATTATaggtttttt tcgttttttgacaCTTTATTGTGAAtgctttcagaaaatcaaaagaaacc caTGTGACCTTAGCTGcaacttaaaatattttctgtcAAAGACTTTCACA CTTAGcaaaaatagccaaaacttCAACCAGCCCTCAAGCTGCCATTATGG GTTTTTGGGACCCAAAAATTTGGGATTCGGAGTTTTTTACTATTGTCtac caaatatccaaaaatgaaggcAAACTAGATTAACATACTAACAAGATCGT CCAAAACTGCCTGGTTCTTAAAGAATACAGCTCTTAATGGGTTCGTGGAC TCGTTTATATGCTCTATGTTTAGTGTTCTGTAGATTAATCAGACAAGTCA ATAAATTATCCCACCTTTTATAAACTAAACTTTATTTGGTTATATAACTA TATTATAGAAAGCTATATTGAACAATCACCTTCGAATGACTATCAAATAT AACAAAgacactgagaagtaagtatttgTTTTCTTTCATACAAAAATGTT AAGGTATCAGCACCCCAATGAGTTTTCAAGTTTTCCTTGTTCAAAACCCc taaaattacctttttttttttgcaaacaaaaaagaaaagtagaCTAGGGT GAGGTATTTTCTTATAGTTCTTCAAAAGTAATGTTTTCTTCTTTGTAGGA GTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGGTAAGCATTT GATTTTAATCACCTCAAGGTGTAGTGAGTTTGATTTTATTCACTTATATC TCGAAAATATCTTATTTGCAGCATCTCAAATATAAAGAAAGATTCAGCCA ACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTCATCATCAAC CAAGGTAATACTGAAGATTCTACTTTGGTTGAGAACTCTtctatttattt tgattttagaatttaaactttgctgttaaatatattttgattCTTTTAGA AAGATGGTCTTTGTAAGTTGAAATACTCTGGCACAAAatatagtccggga gccaaatcctatatctccttaaataagcacttttgcttatTGGCAATTTT ACCCCCCTGGTTTCTCCAACTGCACCCTGTATGTGAGAGTTTCAAGTCAG CATTGTAATTTTCTAGTGTATATTACACaaagatcaagttaaaactattc tCGAAGATATTTTAAGCGAGATAAGTATTGAAAATTGCacaaattatgca aaaattcaataaaatggaCATTTTTACCCCCTCAAGCGTCgaaaataata ctaaatacaGTTACAATAATACTAAATAATGTTTCTGTTGTATCGCTTCA AATTATAACATAACACAAAGTTTGTGCCTCATTTAAAGTTGTTTTGGTAG GTCCCAGTCttataaagtgtcaaaattcagtgaaaatacccAAACTTTCC CTATTTTCCCCCAGGTAAACCCCCAACAATAATTTTTCGGAAAACCTTTT TGCCAATGATGATCACTAATCtatcttgaaacttttggcaaagtttcaaa gcaattggtcaatttaTTCATGAGATTAACAAATTATATCAaacatggaa agatattttccttaagaaatccttacaaagggtaaaaagtacccacTAAA CTCGGGcacagtatgaaaaattgaccaggagttagctttggggaccgacc atttcatAAACTTGGATAGttaaggattccaaaaatgtatagtttatcct gtagaatcttgggttaagcaaaatgccatttttcaggtttggctcccgga ctaataACATACCAAAATCATGCTCCTGGGGTATTATATTAATAATGACt atcgttttcttttttttcaggtgAAAATGAAGTGCAATTCTCATATGAAG TACATTGGGAAGTAAGTGATTTATTGAAAATAGCAGTTTTAATAATTGCC ATCACTAGAAACATTTTTGTCTTGTGAAAGTTCTGATAAAATGGCAGTTT TCCTGGCTTAGAAACATTTTGCGAAAAGGAGTGGTAGTCATTAAGGGGCG GACTTATTATTCTCCTTgtgctttttcagaaaagtgAGATTCGTTGGTCA ACACGATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTT TGCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTATGTCGT AAGGCTCATTCATATTTTCTAatcatctttattttcattgtttcttgAAA GTCAATCTGATATGTTTGTATTTATATTTTGTTTGCTCAGGTCTTTTGGC TATGATCATCATTCGAACGTTACGGAGGGATATCGCAAACTATAACAAAG ACGATGATTTAGTAAGCATCTAACTTCCTAAGTATTCATTCctatttttt gaagttttgaattttaatttactttctttttaaattttgctcacaaTAAG AGACGTGTGTTATTATAATTTTACTTCTCTTTCGTAGGAAGAGGCCTTGG AAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCACGC TATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTG CATGGTCCTTATCACTATTGGTATGTTCCTTTTCTTCCTCCAAAAAAGCA ACATCTTTAGAAGAACTGTTTAGCTTTTACTAATCGTTTTTACAATGCTT ATTGATCAAATACTATCCCTCAATATAAATCTTCTGAATTCGTTCTTGGC TGTCTTTGTAttgaacttgattttttagTAAATTTATTGATTATCGCAAT AATATATAACAGCCTCTTAAACTGGAACCTCTATggctcgaatgtctcct taactcggacAAGTTTTATCGTCCCATCAGTTAGCCCTTAATACCCTATA AACCTTGCTCTATATCACAAATTTGTTTTCCCCGTGTgtgctcgagttat ggagtCTTCACTGTACTTTGTATTTCTAACACTATTTTTTTGTTACTTAG TATTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCG ACTGCCATCATCTTCCTCTACGTCTTCATGGGGTAAGTGGTCCATGACTT AACCCAAGGGAAACTAATGCATAAATGGTGCCAGGTGGATGCAACCAATA ATGGttcttttctaaactttttaaatatccCCAAAGTCACAAAAGTTCAT CTTGTCTCTGTAAGGGCTCAAAAATCTCGAGAGTAGTAATTCAATGCAAT TTCTTGAATATGGACgaacatttgaaattcaatgataCAAACATTCTTTT TGTATTCACTGTAGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAA AACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTGTGAGTATTT TATTTTGAACTCCCCTTTATCATCATATGTCGATGGAAGTTCTCCTATAC ACATGGACCTTTATTGGTTTTGAAACTGTTTATTATTTACTGTGTGTGTC ATTGGTACAATACAGCAATAGAAGTGTACAGCAATCTAAAGACACTCGTA CTGATTAACCGATCTTTTCCACCTATAGACTGGTTTATTGTTCCCTGGAA TTGTCTTCTCCATCGCGTTCTTCCTGAACTTCTTCTTATGGGGAAAACAA TCATCGGGTGCTGTAAGTTCNTGTCTTCTCCATCGCATTCTTCCTGAACT TCTTCTTATGGGGAAAACAATCATCGGGTGCTGTAAGTTCACTATAactc ctcaaaacaaaaaatgcaaTTCCATTGCACTGGGATATTGAGTgcgtttt gaaaaaattactttcgCCTTTCACTGTACATCTTTTAACTGAGTTTTCTG AGTGTGTACTTTTCATGTGAATCTCAAATTAGTCTCAAGTCTACTATTCA AATGTTAATGAACGGTTATTCCAAAAAGAATGAAAGTCGTCACTTTTCCT GGCCATTATAGTGGATAATGTGTAACCCCTTTCTATTCCACGATTGACTA ATGatttattttgttctttcagATACCATTCACGACGATGATTGCTTTAT TTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTC TTTGGATACAGAAAAGCTGTAAGTCCGCAATATAacatattttgactttt aaattccTTTGACAGTGTTGGTAGGGTAGCTCAATCTTAGCTATAAAcga ttattcttattttcagccatacacgcATTCCGTAcgaaccaatcaaattc caAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGGTAA GTTAAATCATATATTCTCGAATTTTCGTGCGCATCGGTTACCTTGTTTGG ACCAAAGTTTAGCAGTTACTCTGTAAACAACAACAACTTTACTGCCTTTG TTGCAACACataattaattttatttaaCTGTTCCTTTTCCTTTCTTCTCC TTAGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAA CTCTTCTTTATTTTAACTGTAAGTTAACTGATTTTCTGTTTAGGGCTTAA TTactttaaaagaagaaatttcttcCCGCCGAAATTAGTTTTATCTTTCA TCCGCCAAAAATTTATGCTCGTcagatttattttatttttcttccatTCG CCAATTGGGAttgtttgagaaaaacttatCTTGACCTCATAATATTGACG ATGAGGTGTAAAGATATTGTTCCATTATTGAAGTATTATTGTAATGTTAT CGATTTTTCTCGTTTCAGGCAATTTGGGAGaatcaattttattatttgtt tggtttcttgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAA TTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGTAGGTCATCTT CTCTTTGGTTTGTGAAGATTCTTAGCTGGtcgttttctttgaaaatatgc CTTCTTTACGAGAGAAATGGGATGagattcaataaaaaaaattgaaaaag aaaaagtcaggGGAATATTTAAAGACTTTTCTAACATAAACCGTAAGGTA CTTTACTCTGATTGTTAATGACTGTTTTATGGGGGAAAGGAGTCATAATA GTGCTTGCTACAACATGTGTGGAACCTCTTAAACTACATCAATAAAATAA CTTTGTCCTTTACGCACAGGATTACCACTGGTGGTGGAGATCGTTCATGA TGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCTATTTC GTCACCAAGGTAAACTTTATTCTATTCCTCAATGTAGAAAACATGGAATT ATCGAATTATTTCCTTGATAACTTCTGGCCTCGTTAAACTTCGATTTATA CATTGATTTCCCAAAAAGCAAATATAAATGAAAGATATGGCCACAATCTT ATGTTTCACAACTATACCTACAACTCATCTCGATTCAATGGGTAGATtat cttttgaaatttatttaagAACGAGTCTGAAATAATGCGAGGTTTTTCTT TAAAGGCAGATGCTGCTATAATGATTTTGTTttactctttctttttttca gttggAGATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTATTCCG CCATCATGGTGTTCGCCTTCTGGATCATCACTGGAACGATCGGCTTCTTC GCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGATTG AGCCCGATTCAATGATATTTTCATCAATTACTGACATAGTCatcttattt tttaaattaactTCTATTTTTTCACCATATCTGAcatgttttgtttataa atgaATTTCTCCAATAAGTAGATCAAAATGATCACAGTCGACTTTTCCAT TGCTCGAACGGTGGCTCCTGGGAAAACCGTCTTTTGTGGTTCTCTTTAAC AATTAAGATTACTGGTTTGCTCTTAACCTGACTCATGCACTTGCGAGTCT AATAATGGACCAGACAACAGTAATTGTGGTGTGAACATCGGCTTTTTTCC CTTTGTTCCTAATTTTAGATAGGAAATGGCAATATGTTAAACATAGGAAG AATATCTTCCAGTTTTTACAAAGTTGGACCCAATACTGACCTTCAAAAAG AGTGGTGCTGAAGCTTGGTTTCGTTAAGGCTCTTTTTGCTGTTGTTGTGT TTCTGAGTGAATGATGTTTGTGAGGAGATTTATGgtaaaagaatattttc aataacAATGACTTTTTATTAGGGTGTAGGAATTTTTCATACTATTTTAG CCGCATTGTTTTTTGTAGAAGTATATACTGTAGGTTTTACTCTGTAATTT ATTATATTTATGCACAACCCGTTTAACAACACAGAGAAAAGAAACCTAAA ACAATGTCCCAAACATTTATTTTGGAA

Coding sequence (CDS) from alignment at sc0000007:1075408..1086084+

>TCONS_00001054 ID=TCONS_00001054|Name=TCONS_00001054|organism=Clytia hemisphaerica|type=CDS|length=42228bp|location=Sequence derived from alignment at sc0000007:1075408..1086084+ (Clytia hemisphaerica)
ATGTTaagaattttaacttttttccttTGTCTACAAAATGTGGCTTCATT
TTATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAAATTT
ACCCAAAGGCTGTCAAGATGACCAGTATCAAAACACAGCTTCCTTATGAT
TATTACACACTTGCTTTCTGTGAGccaacaaaaaaacattatgtACCTGA
AAATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAATACACCGTACA
AGCTTGAAGCAGGGAAAAAACTACCATGCACATTTCTATGTCCTTCCAAG
AAGCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGA
TTATTCAATCCACATgatCATTGATAATCTGCCTGCAGCTGACTTGAGGG
AAGGAATCAAGCCACAACATGGATACAAACTTGGTTTTTATACAACAGAT
AATAAAGCTATATTGAACAATCACCTTCGAATGACTATCAAATATAACAA
AgacactgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCAT
CAAGCATCTCAAATATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCA
AGCAATGCAGAAAGTAAACCACTCATCATCAACCAAGgtgAAAATGAAGT
GCAATTCTCATATGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAA
CACGATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTTT
GCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGC
TATGATCATCATTCGAACGTTACGGAGGGATATCGCAAACTATAACAAAG
ACGATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCAC
GGTGATGTCTTCCGTCCACCACGCTATCCCATGATTTTATCAGCCCTCGT
TGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTATTTG
CCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCC
ATCATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGATATTATTCTGC
ACGTTTGTATAAAACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTA
CTACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTG
AACTTCTTCTTATGGGGAAAACAATCATCGGGTGCTATACCATTCACGAC
GATGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTT
ATCTTGGCTACTTCTTTGGATACAGAAAAGCTccatacacgcATTCCGTA
cgaaccaatcaaattccaAGACAAGTGCCCGATCAAGTTTGGTACATGCA
CCCTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTT
TCATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaattttat
tatttgtttggtttcttgtttttggtttttgtcaTTCTTGGAATCTGTTG
TTCAGAAATTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATT
ACCACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTTAT
GTTTTCTTATACGCCATCTTCTATTTCGTCACCAAGttggAGATAGTGAG
TGTTGTATCAGGTTTGATATATTTCGGTTATTCCGCCATCATGGTGTTCG
CCTTCTGGATCATCACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTC
GTTCGAACAATCTACTCTGCTGTCAAAATCGATTGAATGTTaagaatttt
aacttttttccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAG
TTGCACCACATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTC
AAGATGACCAGTATCAAAACACAGCTTCCTTATGATTATTACACACTTGC
TTTCTGTGAGccaacaaaaaaacattatgtACCTGAAAATTTAGGTGAGA
TTTTGAGAGGTGATCGAATTGTAAATACACCGTACAAGCTTGAAGCAGGG
AAAAAACTACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATC
TCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACA
TgatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCA
CAACATGGATACAAACTTGGTTTTTATACAACAGATAATAAAGCTATATT
GAACAATCACCTTCGAATGACTATCAAATATAACAAAgacactgagaaGA
GTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAAT
ATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAG
TAAACCACTCATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCATATG
AAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAACACGATGGGACACT
TACCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTATCATTAACTC
TATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATCATTC
GAACGTTACGGAGGGATATCGCAAACTATAACAAAGACGATGATTTAGAA
GAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCG
TCCACCACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTC
AAGTCTTTTGCATGGTCCTTATCACTATTGTATTTGCCATGTTGGGTATG
CTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTA
CGTCTTCATGGGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAAAA
CATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTTATTG
TTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATG
GGGAAAACAATCATCGGGTGCTATACCATTCACGACGATGATTGCTTTAT
TTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTC
TTTGGATACAGAAAAGCTccatacacgcATTCCGTAcgaaccaatcaaat
tccaAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGAG
TTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTC
TTTATTTTAACTGCAATTTGGGAGaatcaattttattatttgtttggttt
cttgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCA
TCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGG
AGATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGC
CATCTTCTATTTCGTCACCAAGttggAGATAGTGAGTGTTGTATCAGGTT
TGATATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCATC
ACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTA
CTCTGCTGTCAAAATCGATTGAATGTTaagaattttaacttttttccttT
GTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCACATGAA
TTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATGACCAGTAT
CAAAACACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTGAGccaa
caaaaaaacattatgtACCTGAAAATTTAGGTGAGATTTTGAGAGGTGAT
CGAATTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAACTACCATG
CACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTT
TCATGGAGAGAATCAAAGAAGATTATTCAATCCACATgatCATTGATAAT
CTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAACATGGATACAA
ACTTGGTTTTTATACAACAGATAATAAAGCTATATTGAACAATCACCTTC
GAATGACTATCAAATATAACAAAgacactgagaaGAGTGTATTTCGAGTG
GTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAGAAAGATTC
AGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTCATCA
TCAACCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGTACATTGGGAA
aaaagtgAGATTCGTTGGTCAACACGATGGGACACTTACCTTCAGATGAG
CAATGTACAAGTTCATTGGTTTGCTATCATTAACTCTATTGTCATCGTCC
TTTTCTTAACCGGTCTTTTGGCTATGATCATCATTCGAACGTTACGGAGG
GATATCGCAAACTATAACAAAGACGATGATTTAGAAGAGGCCTTGGAAGA
GACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCACGCTATC
CCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATG
GTCCTTATCACTATTGTATTTGCCATGTTGGGTATGCTATCACCAGCGAG
TCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTTCATGGGAA
CCTTTGCTGGATATTATTCTGCACGTTTGTATAAAACATTGAAGGGACTT
CACTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCTGGAATTGT
CTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAAACAATCAT
CGGGTGCTATACCATTCACGACGATGATTGCTTTATTTTGCTTGTGGTTC
GGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGATACAGAAA
AGCTccatacacgcATTCCGTAcgaaccaatcaaattccaAGACAAGTGC
CCGATCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGATGGCTGGC
ATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATTTTAACTGC
AATTTGGGAGaatcaattttattatttgtttggtttcttgtttttggttt
ttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCATGGTGTAC
TTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCGTTCATGAT
GTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCTATTTCG
TCACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGT
TATTCCGCCATCATGGTGTTCGCCTTCTGGATCATCACTGGAACGATCGG
CTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAA
TCGATTGAATGTTaagaattttaacttttttccttTGTCTACAAAATGTG
GCTTCATTTTATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGA
AGAAATTTACCCAAAGGCTGTCAAGATGACCAGTATCAAAACACAGCTTC
CTTATGATTATTACACACTTGCTTTCTGTGAGccaacaaaaaaacattat
gtACCTGAAAATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAATAC
ACCGTACAAGCTTGAAGCAGGGAAAAAACTACCATGCACATTTCTATGTC
CTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATC
AAAGAAGATTATTCAATCCACATgatCATTGATAATCTGCCTGCAGCTGA
CTTGAGGGAAGGAATCAAGCCACAACATGGATACAAACTTGGTTTTTATA
CAACAGATAATAAAGCTATATTGAACAATCACCTTCGAATGACTATCAAA
TATAACAAAgacactgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGT
CGAAGCATCAAGCATCTCAAATATAAAGAAAGATTCAGCCAACACGTGTG
CATTCCCAAGCAATGCAGAAAGTAAACCACTCATCATCAACCAAGgtgAA
AATGAAGTGCAATTCTCATATGAAGTACATTGGGAAaaaagtgAGATTCG
TTGGTCAACACGATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTC
ATTGGTTTGCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGT
CTTTTGGCTATGATCATCATTCGAACGTTACGGAGGGATATCGCAAACTA
TAACAAAGACGATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAAT
TAGTCCACGGTGATGTCTTCCGTCCACCACGCTATCCCATGATTTTATCA
GCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTAT
TGTATTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGG
CGACTGCCATCATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGATAT
TATTCTGCACGTTTGTATAAAACATTGAAGGGACTTCACTGGAAACGCGC
TGCTTTTACTACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCAT
TCTTCCTGAACTTCTTCTTATGGGGAAAACAATCATCGGGTGCTATACCA
TTCACGACGATGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCC
TCTCGTTTATCTTGGCTACTTCTTTGGATACAGAAAAGCTccatacacgc
ATTCCGTAcgaaccaatcaaattccaAGACAAGTGCCCGATCAAGTTTGG
TACATGCACCCTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGG
AGCTGTTTTCATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaatc
aattttattatttgtttggtttcttgtttttggtttttgtcaTTCTTGGA
ATCTGTTGTTCAGAAATTGCCATCGTCATGGTGTACTTCCAACTCTGTGG
TGAGGATTACCACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCG
CTGTTTATGTTTTCTTATACGCCATCTTCTATTTCGTCACCAAGttggAG
ATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTATTCCGCCATCAT
GGTGTTCGCCTTCTGGATCATCACTGGAACGATCGGCTTCTTCGCTACTT
ATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGATTGAATGTTa
agaattttaacttttttccttTGTCTACAAAATGTGGCTTCATTTTATGT
TCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAAATTTACCCAA
AGGCTGTCAAGATGACCAGTATCAAAACACAGCTTCCTTATGATTATTAC
ACACTTGCTTTCTGTGAGccaacaaaaaaacattatgtACCTGAAAATTT
AGGTGAGATTTTGAGAGGTGATCGAATTGTAAATACACCGTACAAGCTTG
AAGCAGGGAAAAAACTACCATGCACATTTCTATGTCCTTCCAAGAAGCTT
TCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTC
AATCCACATgatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAA
TCAAGCCACAACATGGATACAAACTTGGTTTTTATACAACAGATAATAAA
GCTATATTGAACAATCACCTTCGAATGACTATCAAATATAACAAAgacac
tgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCA
TCTCAAATATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCAAT
GCAGAAAGTAAACCACTCATCATCAACCAAGgtgAAAATGAAGTGCAATT
CTCATATGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAACACGAT
GGGACACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTATC
ATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGAT
CATCATTCGAACGTTACGGAGGGATATCGCAAACTATAACAAAGACGATG
ATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTGAT
GTCTTCCGTCCACCACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTC
TGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTATTTGCCATGT
TGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATC
TTCCTCTACGTCTTCATGGGAACCTTTGCTGGATATTATTCTGCACGTTT
GTATAAAACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTACTG
GTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTC
TTCTTATGGGGAAAACAATCATCGGGTGCTATACCATTCACGACGATGAT
TGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTG
GCTACTTCTTTGGATACAGAAAAGCTccatacacgcATTCCGTAcgaacc
aatcaaattccaAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTT
TATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTG
AACTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaattttattatttg
tttggtttcttgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGA
AATTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATTACCACT
GGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTC
TTATACGCCATCTTCTATTTCGTCACCAAGttggAGATAGTGAGTGTTGT
ATCAGGTTTGATATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCT
GGATCATCACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGA
ACAATCTACTCTGCTGTCAAAATCGATTGAATGTTaagaattttaacttt
tttccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCAC
CACATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATG
ACCAGTATCAAAACACAGCTTCCTTATGATTATTACACACTTGCTTTCTG
TGAGccaacaaaaaaacattatgtACCTGAAAATTTAGGTGAGATTTTGA
GAGGTGATCGAATTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAA
CTACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATC
AAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACATgatCA
TTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAACAT
GGATACAAACTTGGTTTTTATACAACAGATAATAAAGCTATATTGAACAA
TCACCTTCGAATGACTATCAAATATAACAAAgacactgagaaGAGTGTAT
TTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAG
AAAGATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACC
ACTCATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGTAC
ATTGGGAAaaaagtgAGATTCGTTGGTCAACACGATGGGACACTTACCTT
CAGATGAGCAATGTACAAGTTCATTGGTTTGCTATCATTAACTCTATTGT
CATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATCATTCGAACGT
TACGGAGGGATATCGCAAACTATAACAAAGACGATGATTTAGAAGAGGCC
TTGGAAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACC
ACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCT
TTTGCATGGTCCTTATCACTATTGTATTTGCCATGTTGGGTATGCTATCA
CCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTT
CATGGGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAAAACATTGA
AGGGACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCT
GGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAA
ACAATCATCGGGTGCTATACCATTCACGACGATGATTGCTTTATTTTGCT
TGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGA
TACAGAAAAGCTccatacacgcATTCCGTAcgaaccaatcaaattccaAG
ACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGA
TGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATT
TTAACTGCAATTTGGGAGaatcaattttattatttgtttggtttcttgtt
tttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCA
TGGTGTACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCG
TTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTT
CTATTTCGTCACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTGATAT
ATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCATCACTGGA
ACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTACTCTGC
TGTCAAAATCGATTGAATGTTaagaattttaacttttttccttTGTCTAC
AAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCACATGAATTTGCC
GAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATGACCAGTATCAAAAC
ACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTGAGccaacaaaaa
aacattatgtACCTGAAAATTTAGGTGAGATTTTGAGAGGTGATCGAATT
GTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAACTACCATGCACATT
TCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTCATGG
AGAGAATCAAAGAAGATTATTCAATCCACATgatCATTGATAATCTGCCT
GCAGCTGACTTGAGGGAAGGAATCAAGCCACAACATGGATACAAACTTGG
TTTTTATACAACAGATAATAAAGCTATATTGAACAATCACCTTCGAATGA
CTATCAAATATAACAAAgacactgagaaGAGTGTATTTCGAGTGGTTGGT
TTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAGAAAGATTCAGCCAA
CACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTCATCATCAACC
AAGgtgAAAATGAAGTGCAATTCTCATATGAAGTACATTGGGAAaaaagt
gAGATTCGTTGGTCAACACGATGGGACACTTACCTTCAGATGAGCAATGT
ACAAGTTCATTGGTTTGCTATCATTAACTCTATTGTCATCGTCCTTTTCT
TAACCGGTCTTTTGGCTATGATCATCATTCGAACGTTACGGAGGGATATC
GCAAACTATAACAAAGACGATGATTTAGAAGAGGCCTTGGAAGAGACTGG
ATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCACGCTATCCCATGA
TTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTT
ATCACTATTGTATTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGG
AAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTTCATGGGAACCTTTG
CTGGATATTATTCTGCACGTTTGTATAAAACATTGAAGGGACTTCACTGG
AAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCTGGAATTGTCTTCTC
CATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAAACAATCATCGGGTG
CTATACCATTCACGACGATGATTGCTTTATTTTGCTTGTGGTTCGGCATT
TCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGATACAGAAAAGCTcc
atacacgcATTCCGTAcgaaccaatcaaattccaAGACAAGTGCCCGATC
AAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGATGGCTGGCATTTTA
CCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATTTTAACTGCAATTTG
GGAGaatcaattttattatttgtttggtttcttgtttttggtttttgtca
TTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCATGGTGTACTTCCAA
CTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCGTTCATGATGTCTGG
CGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCTATTTCGTCACCA
AGttggAGATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTATTCC
GCCATCATGGTGTTCGCCTTCTGGATCATCACTGGAACGATCGGCTTCTT
CGCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGATT
GAATGTTaagaattttaacttttttccttTGTCTACAAAATGTGGCTTCA
TTTTATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAAAT
TTACCCAAAGGCTGTCAAGATGACCAGTATCAAAACACAGCTTCCTTATG
ATTATTACACACTTGCTTTCTGTGAGccaacaaaaaaacattatgtACCT
GAAAATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAATACACCGTA
CAAGCTTGAAGCAGGGAAAAAACTACCATGCACATTTCTATGTCCTTCCA
AGAAGCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAA
GATTATTCAATCCACATgatCATTGATAATCTGCCTGCAGCTGACTTGAG
GGAAGGAATCAAGCCACAACATGGATACAAACTTGGTTTTTATACAACAG
ATAATAAAGCTATATTGAACAATCACCTTCGAATGACTATCAAATATAAC
AAAgacactgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGC
ATCAAGCATCTCAAATATAAAGAAAGATTCAGCCAACACGTGTGCATTCC
CAAGCAATGCAGAAAGTAAACCACTCATCATCAACCAAGgtgAAAATGAA
GTGCAATTCTCATATGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTC
AACACGATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGT
TTGCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTG
GCTATGATCATCATTCGAACGTTACGGAGGGATATCGCAAACTATAACAA
AGACGATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCC
ACGGTGATGTCTTCCGTCCACCACGCTATCCCATGATTTTATCAGCCCTC
GTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTATT
TGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTG
CCATCATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGATATTATTCT
GCACGTTTGTATAAAACATTGAAGGGACTTCACTGGAAACGCGCTGCTTT
TACTACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCC
TGAACTTCTTCTTATGGGGAAAACAATCATCGGGTGCTATACCATTCACG
ACGATGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGT
TTATCTTGGCTACTTCTTTGGATACAGAAAAGCTccatacacgcATTCCG
TAcgaaccaatcaaattccaAGACAAGTGCCCGATCAAGTTTGGTACATG
CACCCTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGT
TTTCATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaatttt
attatttgtttggtttcttgtttttggtttttgtcaTTCTTGGAATCTGT
TGTTCAGAAATTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGA
TTACCACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTT
ATGTTTTCTTATACGCCATCTTCTATTTCGTCACCAAGttggAGATAGTG
AGTGTTGTATCAGGTTTGATATATTTCGGTTATTCCGCCATCATGGTGTT
CGCCTTCTGGATCATCACTGGAACGATCGGCTTCTTCGCTACTTATGCTT
TCGTTCGAACAATCTACTCTGCTGTCAAAATCGATTGAATGTTaagaatt
ttaacttttttccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGG
AGTTGCACCACATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTG
TCAAGATGACCAGTATCAAAACACAGCTTCCTTATGATTATTACACACTT
GCTTTCTGTGAGccaacaaaaaaacattatgtACCTGAAAATTTAGGTGA
GATTTTGAGAGGTGATCGAATTGTAAATACACCGTACAAGCTTGAAGCAG
GGAAAAAACTACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGA
TCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCA
CATgatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGC
CACAACATGGATACAAACTTGGTTTTTATACAACAGATAATAAAGCTATA
TTGAACAATCACCTTCGAATGACTATCAAATATAACAAAgacactgagaa
GAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAA
ATATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAA
AGTAAACCACTCATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCATA
TGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAACACGATGGGACA
CTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTATCATTAAC
TCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATCAT
TCGAACGTTACGGAGGGATATCGCAAACTATAACAAAGACGATGATTTAG
AAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTC
CGTCCACCACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGT
TCAAGTCTTTTGCATGGTCCTTATCACTATTGTATTTGCCATGTTGGGTA
TGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTC
TACGTCTTCATGGGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAA
AACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTTAT
TGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTA
TGGGGAAAACAATCATCGGGTGCTATACCATTCACGACGATGATTGCTTT
ATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACT
TCTTTGGATACAGAAAAGCTccatacacgcATTCCGTAcgaaccaatcaa
attccaAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGG
AGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCT
TCTTTATTTTAACTGCAATTTGGGAGaatcaattttattatttgtttggt
ttcttgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGC
CATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGT
GGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATAC
GCCATCTTCTATTTCGTCACCAAGttggAGATAGTGAGTGTTGTATCAGG
TTTGATATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCA
TCACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATC
TACTCTGCTGTCAAAATCGATTGAATGTTaagaattttaacttttttcct
tTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCACATG
AATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATGACCAGT
ATCAAAACACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTGAGcc
aacaaaaaaacattatgtACCTGAAAATTTAGGTGAGATTTTGAGAGGTG
ATCGAATTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAACTACCA
TGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGC
TTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACATgatCATTGATA
ATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAACATGGATAC
AAACTTGGTTTTTATACAACAGATAATAAAGCTATATTGAACAATCACCT
TCGAATGACTATCAAATATAACAAAgacactgagaaGAGTGTATTTCGAG
TGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAGAAAGAT
TCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTCAT
CATCAACCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGTACATTGGG
AAaaaagtgAGATTCGTTGGTCAACACGATGGGACACTTACCTTCAGATG
AGCAATGTACAAGTTCATTGGTTTGCTATCATTAACTCTATTGTCATCGT
CCTTTTCTTAACCGGTCTTTTGGCTATGATCATCATTCGAACGTTACGGA
GGGATATCGCAAACTATAACAAAGACGATGATTTAGAAGAGGCCTTGGAA
GAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCACGCTA
TCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCA
TGGTCCTTATCACTATTGTATTTGCCATGTTGGGTATGCTATCACCAGCG
AGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTTCATGGG
AACCTTTGCTGGATATTATTCTGCACGTTTGTATAAAACATTGAAGGGAC
TTCACTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCTGGAATT
GTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAAACAATC
ATCGGGTGCTATACCATTCACGACGATGATTGCTTTATTTTGCTTGTGGT
TCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGATACAGA
AAAGCTccatacacgcATTCCGTAcgaaccaatcaaattccaAGACAAGT
GCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGATGGCTG
GCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATTTTAACT
GCAATTTGGGAGaatcaattttattatttgtttggtttcttgtttttggt
ttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCATGGTGT
ACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCGTTCATG
ATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCTATTT
CGTCACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTGATATATTTCG
GTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCATCACTGGAACGATC
GGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAA
AATCGATTGAATGTTaagaattttaacttttttccttTGTCTACAAAATG
TGGCTTCATTTTATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGA
GAAGAAATTTACCCAAAGGCTGTCAAGATGACCAGTATCAAAACACAGCT
TCCTTATGATTATTACACACTTGCTTTCTGTGAGccaacaaaaaaacatt
atgtACCTGAAAATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAAT
ACACCGTACAAGCTTGAAGCAGGGAAAAAACTACCATGCACATTTCTATG
TCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAA
TCAAAGAAGATTATTCAATCCACATgatCATTGATAATCTGCCTGCAGCT
GACTTGAGGGAAGGAATCAAGCCACAACATGGATACAAACTTGGTTTTTA
TACAACAGATAATAAAGCTATATTGAACAATCACCTTCGAATGACTATCA
AATATAACAAAgacactgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAG
GTCGAAGCATCAAGCATCTCAAATATAAAGAAAGATTCAGCCAACACGTG
TGCATTCCCAAGCAATGCAGAAAGTAAACCACTCATCATCAACCAAGgtg
AAAATGAAGTGCAATTCTCATATGAAGTACATTGGGAAaaaagtgAGATT
CGTTGGTCAACACGATGGGACACTTACCTTCAGATGAGCAATGTACAAGT
TCATTGGTTTGCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCG
GTCTTTTGGCTATGATCATCATTCGAACGTTACGGAGGGATATCGCAAAC
TATAACAAAGACGATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAA
ATTAGTCCACGGTGATGTCTTCCGTCCACCACGCTATCCCATGATTTTAT
CAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACT
ATTGTATTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCT
GGCGACTGCCATCATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGAT
ATTATTCTGCACGTTTGTATAAAACATTGAAGGGACTTCACTGGAAACGC
GCTGCTTTTACTACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGC
ATTCTTCCTGAACTTCTTCTTATGGGGAAAACAATCATCGGGTGCTATAC
CATTCACGACGATGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATC
CCTCTCGTTTATCTTGGCTACTTCTTTGGATACAGAAAAGCTccatacac
gcATTCCGTAcgaaccaatcaaattccaAGACAAGTGCCCGATCAAGTTT
GGTACATGCACCCTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTT
GGAGCTGTTTTCATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaa
tcaattttattatttgtttggtttcttgtttttggtttttgtcaTTCTTG
GAATCTGTTGTTCAGAAATTGCCATCGTCATGGTGTACTTCCAACTCTGT
GGTGAGGATTACCACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATG
CGCTGTTTATGTTTTCTTATACGCCATCTTCTATTTCGTCACCAAGttgg
AGATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTATTCCGCCATC
ATGGTGTTCGCCTTCTGGATCATCACTGGAACGATCGGCTTCTTCGCTAC
TTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGATTGAATGT
TaagaattttaacttttttccttTGTCTACAAAATGTGGCTTCATTTTAT
GTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAAATTTACCC
AAAGGCTGTCAAGATGACCAGTATCAAAACACAGCTTCCTTATGATTATT
ACACACTTGCTTTCTGTGAGccaacaaaaaaacattatgtACCTGAAAAT
TTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAATACACCGTACAAGCT
TGAAGCAGGGAAAAAACTACCATGCACATTTCTATGTCCTTCCAAGAAGC
TTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTAT
TCAATCCACATgatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGG
AATCAAGCCACAACATGGATACAAACTTGGTTTTTATACAACAGATAATA
AAGCTATATTGAACAATCACCTTCGAATGACTATCAAATATAACAAAgac
actgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAG
CATCTCAAATATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCA
ATGCAGAAAGTAAACCACTCATCATCAACCAAGgtgAAAATGAAGTGCAA
TTCTCATATGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAACACG
ATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTA
TCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATG
ATCATCATTCGAACGTTACGGAGGGATATCGCAAACTATAACAAAGACGA
TGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTG
ATGTCTTCCGTCCACCACGCTATCCCATGATTTTATCAGCCCTCGTTGGT
TCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTATTTGCCAT
GTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCA
TCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGATATTATTCTGCACGT
TTGTATAAAACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTAC
TGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACT
TCTTCTTATGGGGAAAACAATCATCGGGTGCTATACCATTCACGACGATG
ATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCT
TGGCTACTTCTTTGGATACAGAAAAGCTccatacacgcATTCCGTAcgaa
ccaatcaaattccaAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCT
TTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCAT
TGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaattttattatt
tgtttggtttcttgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCA
GAAATTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATTACCA
CTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTT
TCTTATACGCCATCTTCTATTTCGTCACCAAGttggAGATAGTGAGTGTT
GTATCAGGTTTGATATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTT
CTGGATCATCACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTC
GAACAATCTACTCTGCTGTCAAAATCGATTGAATGTTaagaattttaact
tttttccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGC
ACCACATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGA
TGACCAGTATCAAAACACAGCTTCCTTATGATTATTACACACTTGCTTTC
TGTGAGccaacaaaaaaacattatgtACCTGAAAATTTAGGTGAGATTTT
GAGAGGTGATCGAATTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAA
AACTACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAA
TCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACATgat
CATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAAC
ATGGATACAAACTTGGTTTTTATACAACAGATAATAAAGCTATATTGAAC
AATCACCTTCGAATGACTATCAAATATAACAAAgacactgagaaGAGTGT
ATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAA
AGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAA
CCACTCATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGT
ACATTGGGAAaaaagtgAGATTCGTTGGTCAACACGATGGGACACTTACC
TTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTATCATTAACTCTATT
GTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATCATTCGAAC
GTTACGGAGGGATATCGCAAACTATAACAAAGACGATGATTTAGAAGAGG
CCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCA
CCACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGT
CTTTTGCATGGTCCTTATCACTATTGTATTTGCCATGTTGGGTATGCTAT
CACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTC
TTCATGGGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAAAACATT
GAAGGGACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCC
CTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGA
AAACAATCATCGGGTGCTATACCATTCACGACGATGATTGCTTTATTTTG
CTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTG
GATACAGAAAAGCTccatacacgcATTCCGTAcgaaccaatcaaattcca
AGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCT
GATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTA
TTTTAACTGCAATTTGGGAGaatcaattttattatttgtttggtttcttg
tttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGT
CATGGTGTACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAGAT
CGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATC
TTCTATTTCGTCACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTGAT
ATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCATCACTG
GAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTACTCT
GCTGTCAAAATCGATTGAATGTTaagaattttaacttttttccttTGTCT
ACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCACATGAATTTG
CCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATGACCAGTATCAAA
ACACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTGAGccaacaaa
aaaacattatgtACCTGAAAATTTAGGTGAGATTTTGAGAGGTGATCGAA
TTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAACTACCATGCACA
TTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTCAT
GGAGAGAATCAAAGAAGATTATTCAATCCACATgatCATTGATAATCTGC
CTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAACATGGATACAAACTT
GGTTTTTATACAACAGATAATAAAGCTATATTGAACAATCACCTTCGAAT
GACTATCAAATATAACAAAgacactgagaaGAGTGTATTTCGAGTGGTTG
GTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAGAAAGATTCAGCC
AACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTCATCATCAA
CCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGTACATTGGGAAaaaa
gtgAGATTCGTTGGTCAACACGATGGGACACTTACCTTCAGATGAGCAAT
GTACAAGTTCATTGGTTTGCTATCATTAACTCTATTGTCATCGTCCTTTT
CTTAACCGGTCTTTTGGCTATGATCATCATTCGAACGTTACGGAGGGATA
TCGCAAACTATAACAAAGACGATGATTTAGAAGAGGCCTTGGAAGAGACT
GGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCACGCTATCCCAT
GATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCC
TTATCACTATTGTATTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGT
GGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTTCATGGGAACCTT
TGCTGGATATTATTCTGCACGTTTGTATAAAACATTGAAGGGACTTCACT
GGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCTGGAATTGTCTTC
TCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAAACAATCATCGGG
TGCTATACCATTCACGACGATGATTGCTTTATTTTGCTTGTGGTTCGGCA
TTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGATACAGAAAAGCT
ccatacacgcATTCCGTAcgaaccaatcaaattccaAGACAAGTGCCCGA
TCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGATGGCTGGCATTT
TACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATTTTAACTGCAATT
TGGGAGaatcaattttattatttgtttggtttcttgtttttggtttttgt
caTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCATGGTGTACTTCC
AACTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCGTTCATGATGTCT
GGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCTATTTCGTCAC
CAAGttggAGATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTATT
CCGCCATCATGGTGTTCGCCTTCTGGATCATCACTGGAACGATCGGCTTC
TTCGCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGA
TTGAATGTTaagaattttaacttttttccttTGTCTACAAAATGTGGCTT
CATTTTATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAA
ATTTACCCAAAGGCTGTCAAGATGACCAGTATCAAAACACAGCTTCCTTA
TGATTATTACACACTTGCTTTCTGTGAGccaacaaaaaaacattatgtAC
CTGAAAATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAATACACCG
TACAAGCTTGAAGCAGGGAAAAAACTACCATGCACATTTCTATGTCCTTC
CAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAG
AAGATTATTCAATCCACATgatCATTGATAATCTGCCTGCAGCTGACTTG
AGGGAAGGAATCAAGCCACAACATGGATACAAACTTGGTTTTTATACAAC
AGATAATAAAGCTATATTGAACAATCACCTTCGAATGACTATCAAATATA
ACAAAgacactgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAA
GCATCAAGCATCTCAAATATAAAGAAAGATTCAGCCAACACGTGTGCATT
CCCAAGCAATGCAGAAAGTAAACCACTCATCATCAACCAAGgtgAAAATG
AAGTGCAATTCTCATATGAAGTACATTGGGAAaaaagtgAGATTCGTTGG
TCAACACGATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTCATTG
GTTTGCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTT
TGGCTATGATCATCATTCGAACGTTACGGAGGGATATCGCAAACTATAAC
AAAGACGATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGT
CCACGGTGATGTCTTCCGTCCACCACGCTATCCCATGATTTTATCAGCCC
TCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTA
TTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGAC
TGCCATCATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGATATTATT
CTGCACGTTTGTATAAAACATTGAAGGGACTTCACTGGAAACGCGCTGCT
TTTACTACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTT
CCTGAACTTCTTCTTATGGGGAAAACAATCATCGGGTGCTATACCATTCA
CGACGATGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTC
GTTTATCTTGGCTACTTCTTTGGATACAGAAAAGCTccatacacgcATTC
CGTAcgaaccaatcaaattccaAGACAAGTGCCCGATCAAGTTTGGTACA
TGCACCCTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCT
GTTTTCATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaatt
ttattatttgtttggtttcttgtttttggtttttgtcaTTCTTGGAATCT
GTTGTTCAGAAATTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAG
GATTACCACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGT
TTATGTTTTCTTATACGCCATCTTCTATTTCGTCACCAAGttggAGATAG
TGAGTGTTGTATCAGGTTTGATATATTTCGGTTATTCCGCCATCATGGTG
TTCGCCTTCTGGATCATCACTGGAACGATCGGCTTCTTCGCTACTTATGC
TTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGATTGAATGTTaagaa
ttttaacttttttccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCT
GGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGC
TGTCAAGATGACCAGTATCAAAACACAGCTTCCTTATGATTATTACACAC
TTGCTTTCTGTGAGccaacaaaaaaacattatgtACCTGAAAATTTAGGT
GAGATTTTGAGAGGTGATCGAATTGTAAATACACCGTACAAGCTTGAAGC
AGGGAAAAAACTACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAG
GATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATC
CACATgatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAA
GCCACAACATGGATACAAACTTGGTTTTTATACAACAGATAATAAAGCTA
TATTGAACAATCACCTTCGAATGACTATCAAATATAACAAAgacactgag
aaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTC
AAATATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAG
AAAGTAAACCACTCATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCA
TATGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAACACGATGGGA
CACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTATCATTA
ACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATC
ATTCGAACGTTACGGAGGGATATCGCAAACTATAACAAAGACGATGATTT
AGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTGATGTCT
TCCGTCCACCACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGT
GTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTATTTGCCATGTTGGG
TATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCC
TCTACGTCTTCATGGGAACCTTTGCTGGATATTATTCTGCACGTTTGTAT
AAAACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTT
ATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCT
TATGGGGAAAACAATCATCGGGTGCTATACCATTCACGACGATGATTGCT
TTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTA
CTTCTTTGGATACAGAAAAGCTccatacacgcATTCCGTAcgaaccaatc
aaattccaAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATT
GGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACT
CTTCTTTATTTTAACTGCAATTTGGGAGaatcaattttattatttgtttg
gtttcttgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATT
GCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATTACCACTGGTG
GTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTAT
ACGCCATCTTCTATTTCGTCACCAAGttggAGATAGTGAGTGTTGTATCA
GGTTTGATATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGAT
CATCACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAA
TCTACTCTGCTGTCAAAATCGATTGAATGTTaagaattttaacttttttc
cttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCACA
TGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATGACCA
GTATCAAAACACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTGAG
ccaacaaaaaaacattatgtACCTGAAAATTTAGGTGAGATTTTGAGAGG
TGATCGAATTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAACTAC
CATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAA
GCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACATgatCATTGA
TAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAACATGGAT
ACAAACTTGGTTTTTATACAACAGATAATAAAGCTATATTGAACAATCAC
CTTCGAATGACTATCAAATATAACAAAgacactgagaaGAGTGTATTTCG
AGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAGAAAG
ATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTC
ATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGTACATTG
GGAAaaaagtgAGATTCGTTGGTCAACACGATGGGACACTTACCTTCAGA
TGAGCAATGTACAAGTTCATTGGTTTGCTATCATTAACTCTATTGTCATC
GTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATCATTCGAACGTTACG
GAGGGATATCGCAAACTATAACAAAGACGATGATTTAGAAGAGGCCTTGG
AAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCACGC
TATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTG
CATGGTCCTTATCACTATTGTATTTGCCATGTTGGGTATGCTATCACCAG
CGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTTCATG
GGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAAAACATTGAAGGG
ACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCTGGAA
TTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAAACAA
TCATCGGGTGCTATACCATTCACGACGATGATTGCTTTATTTTGCTTGTG
GTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGATACA
GAAAAGCTccatacacgcATTCCGTAcgaaccaatcaaattccaAGACAA
GTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGATGGC
TGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATTTTAA
CTGCAATTTGGGAGaatcaattttattatttgtttggtttcttgtttttg
gtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCATGGT
GTACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCGTTCA
TGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCTAT
TTCGTCACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTGATATATTT
CGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCATCACTGGAACGA
TCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTC
AAAATCGATTGAATGTTaagaattttaacttttttccttTGTCTACAAAA
TGTGGCTTCATTTTATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAG
GAGAAGAAATTTACCCAAAGGCTGTCAAGATGACCAGTATCAAAACACAG
CTTCCTTATGATTATTACACACTTGCTTTCTGTGAGccaacaaaaaaaca
ttatgtACCTGAAAATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAA
ATACACCGTACAAGCTTGAAGCAGGGAAAAAACTACCATGCACATTTCTA
TGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAG
AATCAAAGAAGATTATTCAATCCACATgatCATTGATAATCTGCCTGCAG
CTGACTTGAGGGAAGGAATCAAGCCACAACATGGATACAAACTTGGTTTT
TATACAACAGATAATAAAGCTATATTGAACAATCACCTTCGAATGACTAT
CAAATATAACAAAgacactgagaaGAGTGTATTTCGAGTGGTTGGTTTCC
AGGTCGAAGCATCAAGCATCTCAAATATAAAGAAAGATTCAGCCAACACG
TGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTCATCATCAACCAAGg
tgAAAATGAAGTGCAATTCTCATATGAAGTACATTGGGAAaaaagtgAGA
TTCGTTGGTCAACACGATGGGACACTTACCTTCAGATGAGCAATGTACAA
GTTCATTGGTTTGCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAAC
CGGTCTTTTGGCTATGATCATCATTCGAACGTTACGGAGGGATATCGCAA
ACTATAACAAAGACGATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGG
AAATTAGTCCACGGTGATGTCTTCCGTCCACCACGCTATCCCATGATTTT
ATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCA
CTATTGTATTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGC
CTGGCGACTGCCATCATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGG
ATATTATTCTGCACGTTTGTATAAAACATTGAAGGGACTTCACTGGAAAC
GCGCTGCTTTTACTACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATC
GCATTCTTCCTGAACTTCTTCTTATGGGGAAAACAATCATCGGGTGCTAT
ACCATTCACGACGATGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTA
TCCCTCTCGTTTATCTTGGCTACTTCTTTGGATACAGAAAAGCTccatac
acgcATTCCGTAcgaaccaatcaaattccaAGACAAGTGCCCGATCAAGT
TTGGTACATGCACCCTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGT
TTGGAGCTGTTTTCATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAG
aatcaattttattatttgtttggtttcttgtttttggtttttgtcaTTCT
TGGAATCTGTTGTTCAGAAATTGCCATCGTCATGGTGTACTTCCAACTCT
GTGGTGAGGATTACCACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCA
TGCGCTGTTTATGTTTTCTTATACGCCATCTTCTATTTCGTCACCAAGtt
ggAGATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTATTCCGCCA
TCATGGTGTTCGCCTTCTGGATCATCACTGGAACGATCGGCTTCTTCGCT
ACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGATTGAAT
GTTaagaattttaacttttttccttTGTCTACAAAATGTGGCTTCATTTT
ATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAAATTTAC
CCAAAGGCTGTCAAGATGACCAGTATCAAAACACAGCTTCCTTATGATTA
TTACACACTTGCTTTCTGTGAGccaacaaaaaaacattatgtACCTGAAA
ATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAATACACCGTACAAG
CTTGAAGCAGGGAAAAAACTACCATGCACATTTCTATGTCCTTCCAAGAA
GCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATT
ATTCAATCCACATgatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAA
GGAATCAAGCCACAACATGGATACAAACTTGGTTTTTATACAACAGATAA
TAAAGCTATATTGAACAATCACCTTCGAATGACTATCAAATATAACAAAg
acactgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCA
AGCATCTCAAATATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAG
CAATGCAGAAAGTAAACCACTCATCATCAACCAAGgtgAAAATGAAGTGC
AATTCTCATATGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAACA
CGATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGC
TATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTA
TGATCATCATTCGAACGTTACGGAGGGATATCGCAAACTATAACAAAGAC
GATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGG
TGATGTCTTCCGTCCACCACGCTATCCCATGATTTTATCAGCCCTCGTTG
GTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTATTTGCC
ATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCAT
CATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGATATTATTCTGCAC
GTTTGTATAAAACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACT
ACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAA
CTTCTTCTTATGGGGAAAACAATCATCGGGTGCTATACCATTCACGACGA
TGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTAT
CTTGGCTACTTCTTTGGATACAGAAAAGCTccatacacgcATTCCGTAcg
aaccaatcaaattccaAGACAAGTGCCCGATCAAGTTTGGTACATGCACC
CTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTC
ATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaattttatta
tttgtttggtttcttgtttttggtttttgtcaTTCTTGGAATCTGTTGTT
CAGAAATTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATTAC
CACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGT
TTTCTTATACGCCATCTTCTATTTCGTCACCAAGttggAGATAGTGAGTG
TTGTATCAGGTTTGATATATTTCGGTTATTCCGCCATCATGGTGTTCGCC
TTCTGGATCATCACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGT
TCGAACAATCTACTCTGCTGTCAAAATCGATTGAATGTTaagaattttaa
cttttttccttTGTCTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTT
GCACCACATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAA
GATGACCAGTATCAAAACACAGCTTCCTTATGATTATTACACACTTGCTT
TCTGTGAGccaacaaaaaaacattatgtACCTGAAAATTTAGGTGAGATT
TTGAGAGGTGATCGAATTGTAAATACACCGTACAAGCTTGAAGCAGGGAA
AAAACTACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTC
AATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAATCCACATg
atCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACA
ACATGGATACAAACTTGGTTTTTATACAACAGATAATAAAGCTATATTGA
ACAATCACCTTCGAATGACTATCAAATATAACAAAgacactgagaaGAGT
GTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATAT
AAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTA
AACCACTCATCATCAACCAAGgtgAAAATGAAGTGCAATTCTCATATGAA
GTACATTGGGAAaaaagtgAGATTCGTTGGTCAACACGATGGGACACTTA
CCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTATCATTAACTCTA
TTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCATCATTCGA
ACGTTACGGAGGGATATCGCAAACTATAACAAAGACGATGATTTAGAAGA
GGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTC
CACCACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAA
GTCTTTTGCATGGTCCTTATCACTATTGTATTTGCCATGTTGGGTATGCT
ATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACG
TCTTCATGGGAACCTTTGCTGGATATTATTCTGCACGTTTGTATAAAACA
TTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTT
CCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGG
GAAAACAATCATCGGGTGCTATACCATTCACGACGATGATTGCTTTATTT
TGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTT
TGGATACAGAAAAGCTccatacacgcATTCCGTAcgaaccaatcaaattc
caAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTATTGGAGTT
CTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTT
TATTTTAACTGCAATTTGGGAGaatcaattttattatttgtttggtttct
tgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATC
GTCATGGTGTACTTCCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAG
ATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCA
TCTTCTATTTCGTCACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTG
ATATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGGATCATCAC
TGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAACAATCTACT
CTGCTGTCAAAATCGATTGAATGTTaagaattttaacttttttccttTGT
CTACAAAATGTGGCTTCATTTTATGTTCCTGGAGTTGCACCACATGAATT
TGCCGAAGGAGAAGAAATTTACCCAAAGGCTGTCAAGATGACCAGTATCA
AAACACAGCTTCCTTATGATTATTACACACTTGCTTTCTGTGAGccaaca
aaaaaacattatgtACCTGAAAATTTAGGTGAGATTTTGAGAGGTGATCG
AATTGTAAATACACCGTACAAGCTTGAAGCAGGGAAAAAACTACCATGCA
CATTTCTATGTCCTTCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTC
ATGGAGAGAATCAAAGAAGATTATTCAATCCACATgatCATTGATAATCT
GCCTGCAGCTGACTTGAGGGAAGGAATCAAGCCACAACATGGATACAAAC
TTGGTTTTTATACAACAGATAATAAAGCTATATTGAACAATCACCTTCGA
ATGACTATCAAATATAACAAAgacactgagaaGAGTGTATTTCGAGTGGT
TGGTTTCCAGGTCGAAGCATCAAGCATCTCAAATATAAAGAAAGATTCAG
CCAACACGTGTGCATTCCCAAGCAATGCAGAAAGTAAACCACTCATCATC
AACCAAGgtgAAAATGAAGTGCAATTCTCATATGAAGTACATTGGGAAaa
aagtgAGATTCGTTGGTCAACACGATGGGACACTTACCTTCAGATGAGCA
ATGTACAAGTTCATTGGTTTGCTATCATTAACTCTATTGTCATCGTCCTT
TTCTTAACCGGTCTTTTGGCTATGATCATCATTCGAACGTTACGGAGGGA
TATCGCAAACTATAACAAAGACGATGATTTAGAAGAGGCCTTGGAAGAGA
CTGGATGGAAATTAGTCCACGGTGATGTCTTCCGTCCACCACGCTATCCC
ATGATTTTATCAGCCCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGT
CCTTATCACTATTGTATTTGCCATGTTGGGTATGCTATCACCAGCGAGTC
GTGGAAGCCTGGCGACTGCCATCATCTTCCTCTACGTCTTCATGGGAACC
TTTGCTGGATATTATTCTGCACGTTTGTATAAAACATTGAAGGGACTTCA
CTGGAAACGCGCTGCTTTTACTACTGGTTTATTGTTCCCTGGAATTGTCT
TCTCCATCGCATTCTTCCTGAACTTCTTCTTATGGGGAAAACAATCATCG
GGTGCTATACCATTCACGACGATGATTGCTTTATTTTGCTTGTGGTTCGG
CATTTCTATCCCTCTCGTTTATCTTGGCTACTTCTTTGGATACAGAAAAG
CTccatacacgcATTCCGTAcgaaccaatcaaattccaAGACAAGTGCCC
GATCAAGTTTGGTACATGCACCCTTTTATTGGAGTTCTGATGGCTGGCAT
TTTACCGTTTGGAGCTGTTTTCATTGAACTCTTCTTTATTTTAACTGCAA
TTTGGGAGaatcaattttattatttgtttggtttcttgtttttggttttt
gtcaTTCTTGGAATCTGTTGTTCAGAAATTGCCATCGTCATGGTGTACTT
CCAACTCTGTGGTGAGGATTACCACTGGTGGTGGAGATCGTTCATGATGT
CTGGCGCATGCGCTGTTTATGTTTTCTTATACGCCATCTTCTATTTCGTC
ACCAAGttggAGATAGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTA
TTCCGCCATCATGGTGTTCGCCTTCTGGATCATCACTGGAACGATCGGCT
TCTTCGCTACTTATGCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATC
GATTGAATGTTaagaattttaacttttttccttTGTCTACAAAATGTGGC
TTCATTTTATGTTCCTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAG
AAATTTACCCAAAGGCTGTCAAGATGACCAGTATCAAAACACAGCTTCCT
TATGATTATTACACACTTGCTTTCTGTGAGccaacaaaaaaacattatgt
ACCTGAAAATTTAGGTGAGATTTTGAGAGGTGATCGAATTGTAAATACAC
CGTACAAGCTTGAAGCAGGGAAAAAACTACCATGCACATTTCTATGTCCT
TCCAAGAAGCTTTCAGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAA
AGAAGATTATTCAATCCACATgatCATTGATAATCTGCCTGCAGCTGACT
TGAGGGAAGGAATCAAGCCACAACATGGATACAAACTTGGTTTTTATACA
ACAGATAATAAAGCTATATTGAACAATCACCTTCGAATGACTATCAAATA
TAACAAAgacactgagaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCG
AAGCATCAAGCATCTCAAATATAAAGAAAGATTCAGCCAACACGTGTGCA
TTCCCAAGCAATGCAGAAAGTAAACCACTCATCATCAACCAAGgtgAAAA
TGAAGTGCAATTCTCATATGAAGTACATTGGGAAaaaagtgAGATTCGTT
GGTCAACACGATGGGACACTTACCTTCAGATGAGCAATGTACAAGTTCAT
TGGTTTGCTATCATTAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCT
TTTGGCTATGATCATCATTCGAACGTTACGGAGGGATATCGCAAACTATA
ACAAAGACGATGATTTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTA
GTCCACGGTGATGTCTTCCGTCCACCACGCTATCCCATGATTTTATCAGC
CCTCGTTGGTTCTGGTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTG
TATTTGCCATGTTGGGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCG
ACTGCCATCATCTTCCTCTACGTCTTCATGGGAACCTTTGCTGGATATTA
TTCTGCACGTTTGTATAAAACATTGAAGGGACTTCACTGGAAACGCGCTG
CTTTTACTACTGGTTTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTC
TTCCTGAACTTCTTCTTATGGGGAAAACAATCATCGGGTGCTATACCATT
CACGACGATGATTGCTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTC
TCGTTTATCTTGGCTACTTCTTTGGATACAGAAAAGCTccatacacgcAT
TCCGTAcgaaccaatcaaattccaAGACAAGTGCCCGATCAAGTTTGGTA
CATGCACCCTTTTATTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAG
CTGTTTTCATTGAACTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaa
ttttattatttgtttggtttcttgtttttggtttttgtcaTTCTTGGAAT
CTGTTGTTCAGAAATTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTG
AGGATTACCACTGGTGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCT
GTTTATGTTTTCTTATACGCCATCTTCTATTTCGTCACCAAGttggAGAT
AGTGAGTGTTGTATCAGGTTTGATATATTTCGGTTATTCCGCCATCATGG
TGTTCGCCTTCTGGATCATCACTGGAACGATCGGCTTCTTCGCTACTTAT
GCTTTCGTTCGAACAATCTACTCTGCTGTCAAAATCGATTGAATGTTaag
aattttaacttttttccttTGTCTACAAAATGTGGCTTCATTTTATGTTC
CTGGAGTTGCACCACATGAATTTGCCGAAGGAGAAGAAATTTACCCAAAG
GCTGTCAAGATGACCAGTATCAAAACACAGCTTCCTTATGATTATTACAC
ACTTGCTTTCTGTGAGccaacaaaaaaacattatgtACCTGAAAATTTAG
GTGAGATTTTGAGAGGTGATCGAATTGTAAATACACCGTACAAGCTTGAA
GCAGGGAAAAAACTACCATGCACATTTCTATGTCCTTCCAAGAAGCTTTC
AGGATCTCAATCAAAAGCTTTCATGGAGAGAATCAAAGAAGATTATTCAA
TCCACATgatCATTGATAATCTGCCTGCAGCTGACTTGAGGGAAGGAATC
AAGCCACAACATGGATACAAACTTGGTTTTTATACAACAGATAATAAAGC
TATATTGAACAATCACCTTCGAATGACTATCAAATATAACAAAgacactg
agaaGAGTGTATTTCGAGTGGTTGGTTTCCAGGTCGAAGCATCAAGCATC
TCAAATATAAAGAAAGATTCAGCCAACACGTGTGCATTCCCAAGCAATGC
AGAAAGTAAACCACTCATCATCAACCAAGgtgAAAATGAAGTGCAATTCT
CATATGAAGTACATTGGGAAaaaagtgAGATTCGTTGGTCAACACGATGG
GACACTTACCTTCAGATGAGCAATGTACAAGTTCATTGGTTTGCTATCAT
TAACTCTATTGTCATCGTCCTTTTCTTAACCGGTCTTTTGGCTATGATCA
TCATTCGAACGTTACGGAGGGATATCGCAAACTATAACAAAGACGATGAT
TTAGAAGAGGCCTTGGAAGAGACTGGATGGAAATTAGTCCACGGTGATGT
CTTCCGTCCACCACGCTATCCCATGATTTTATCAGCCCTCGTTGGTTCTG
GTGTTCAAGTCTTTTGCATGGTCCTTATCACTATTGTATTTGCCATGTTG
GGTATGCTATCACCAGCGAGTCGTGGAAGCCTGGCGACTGCCATCATCTT
CCTCTACGTCTTCATGGGAACCTTTGCTGGATATTATTCTGCACGTTTGT
ATAAAACATTGAAGGGACTTCACTGGAAACGCGCTGCTTTTACTACTGGT
TTATTGTTCCCTGGAATTGTCTTCTCCATCGCATTCTTCCTGAACTTCTT
CTTATGGGGAAAACAATCATCGGGTGCTATACCATTCACGACGATGATTG
CTTTATTTTGCTTGTGGTTCGGCATTTCTATCCCTCTCGTTTATCTTGGC
TACTTCTTTGGATACAGAAAAGCTccatacacgcATTCCGTAcgaaccaa
tcaaattccaAGACAAGTGCCCGATCAAGTTTGGTACATGCACCCTTTTA
TTGGAGTTCTGATGGCTGGCATTTTACCGTTTGGAGCTGTTTTCATTGAA
CTCTTCTTTATTTTAACTGCAATTTGGGAGaatcaattttattatttgtt
tggtttcttgtttttggtttttgtcaTTCTTGGAATCTGTTGTTCAGAAA
TTGCCATCGTCATGGTGTACTTCCAACTCTGTGGTGAGGATTACCACTGG
TGGTGGAGATCGTTCATGATGTCTGGCGCATGCGCTGTTTATGTTTTCTT
ATACGCCATCTTCTATTTCGTCACCAAGttggAGATAGTGAGTGTTGTAT
CAGGTTTGATATATTTCGGTTATTCCGCCATCATGGTGTTCGCCTTCTGG
ATCATCACTGGAACGATCGGCTTCTTCGCTACTTATGCTTTCGTTCGAAC
AATCTACTCTGCTGTCAAAATCGATTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000597XLOC_000597Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001054-proteinTCONS_00001054-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001054-exon-sc0000007-1491911889:1075408..1075743TCONS_00001054-exon-sc0000007-1491911889:1075408..1075743Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1075408..1075743TCONS_00001054-exon-sc0000007-1510915933:1075408..1075743Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1075408..1075743TCONS_00001054-exon-sc0000007-1575043694:1075408..1075743Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1076086..1076185TCONS_00001054-exon-sc0000007-1491911889:1076086..1076185Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1076086..1076185TCONS_00001054-exon-sc0000007-1510915933:1076086..1076185Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1076086..1076185TCONS_00001054-exon-sc0000007-1575043694:1076086..1076185Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1078333..1078376TCONS_00001054-exon-sc0000007-1491911889:1078333..1078376Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1078333..1078376TCONS_00001054-exon-sc0000007-1510915933:1078333..1078376Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1078333..1078376TCONS_00001054-exon-sc0000007-1575043694:1078333..1078376Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1078487..1078599TCONS_00001054-exon-sc0000007-1491911889:1078487..1078599Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1078487..1078599TCONS_00001054-exon-sc0000007-1510915933:1078487..1078599Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1078487..1078599TCONS_00001054-exon-sc0000007-1575043694:1078487..1078599Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1079208..1079253TCONS_00001054-exon-sc0000007-1491911889:1079208..1079253Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1079208..1079253TCONS_00001054-exon-sc0000007-1510915933:1079208..1079253Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1079208..1079253TCONS_00001054-exon-sc0000007-1575043694:1079208..1079253Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1079402..1079443TCONS_00001054-exon-sc0000007-1491911889:1079402..1079443Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1079402..1079443TCONS_00001054-exon-sc0000007-1510915933:1079402..1079443Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1079402..1079443TCONS_00001054-exon-sc0000007-1575043694:1079402..1079443Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1080166..1080224TCONS_00001054-exon-sc0000007-1491911889:1080166..1080224Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1080166..1080224TCONS_00001054-exon-sc0000007-1510915933:1080166..1080224Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1080166..1080224TCONS_00001054-exon-sc0000007-1575043694:1080166..1080224Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1080406..1080447TCONS_00001054-exon-sc0000007-1491911889:1080406..1080447Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1080406..1080447TCONS_00001054-exon-sc0000007-1510915933:1080406..1080447Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1080406..1080447TCONS_00001054-exon-sc0000007-1575043694:1080406..1080447Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1080529..1080611TCONS_00001054-exon-sc0000007-1491911889:1080529..1080611Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1080529..1080611TCONS_00001054-exon-sc0000007-1510915933:1080529..1080611Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1080529..1080611TCONS_00001054-exon-sc0000007-1575043694:1080529..1080611Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1081578..1081618TCONS_00001054-exon-sc0000007-1491911889:1081578..1081618Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1081578..1081618TCONS_00001054-exon-sc0000007-1510915933:1081578..1081618Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1081578..1081618TCONS_00001054-exon-sc0000007-1575043694:1081578..1081618Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1081787..1081898TCONS_00001054-exon-sc0000007-1491911889:1081787..1081898Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1081787..1081898TCONS_00001054-exon-sc0000007-1510915933:1081787..1081898Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1081787..1081898TCONS_00001054-exon-sc0000007-1575043694:1081787..1081898Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1081998..1082068TCONS_00001054-exon-sc0000007-1491911889:1081998..1082068Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1081998..1082068TCONS_00001054-exon-sc0000007-1510915933:1081998..1082068Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1081998..1082068TCONS_00001054-exon-sc0000007-1575043694:1081998..1082068Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1082195..1082327TCONS_00001054-exon-sc0000007-1491911889:1082195..1082327Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1082195..1082327TCONS_00001054-exon-sc0000007-1510915933:1082195..1082327Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1082195..1082327TCONS_00001054-exon-sc0000007-1575043694:1082195..1082327Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1082708..1082789TCONS_00001054-exon-sc0000007-1491911889:1082708..1082789Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1082708..1082789TCONS_00001054-exon-sc0000007-1510915933:1082708..1082789Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1082708..1082789TCONS_00001054-exon-sc0000007-1575043694:1082708..1082789Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1083022..1083097TCONS_00001054-exon-sc0000007-1491911889:1083022..1083097Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1083022..1083097TCONS_00001054-exon-sc0000007-1510915933:1083022..1083097Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1083022..1083097TCONS_00001054-exon-sc0000007-1575043694:1083022..1083097Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1083286..1083309TCONS_00001054-exon-sc0000007-1491911889:1083286..1083309Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1083286..1083309TCONS_00001054-exon-sc0000007-1510915933:1083286..1083309Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1083286..1083309TCONS_00001054-exon-sc0000007-1575043694:1083286..1083309Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1083380..1083439TCONS_00001054-exon-sc0000007-1491911889:1083380..1083439Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1083380..1083439TCONS_00001054-exon-sc0000007-1510915933:1083380..1083439Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1083380..1083439TCONS_00001054-exon-sc0000007-1575043694:1083380..1083439Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1083730..1083825TCONS_00001054-exon-sc0000007-1491911889:1083730..1083825Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1083730..1083825TCONS_00001054-exon-sc0000007-1510915933:1083730..1083825Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1083730..1083825TCONS_00001054-exon-sc0000007-1575043694:1083730..1083825Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1083924..1084003TCONS_00001054-exon-sc0000007-1491911889:1083924..1084003Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1083924..1084003TCONS_00001054-exon-sc0000007-1510915933:1083924..1084003Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1083924..1084003TCONS_00001054-exon-sc0000007-1575043694:1083924..1084003Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1084162..1084225TCONS_00001054-exon-sc0000007-1491911889:1084162..1084225Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1084162..1084225TCONS_00001054-exon-sc0000007-1510915933:1084162..1084225Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1084162..1084225TCONS_00001054-exon-sc0000007-1575043694:1084162..1084225Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1084476..1084595TCONS_00001054-exon-sc0000007-1491911889:1084476..1084595Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1084476..1084595TCONS_00001054-exon-sc0000007-1510915933:1084476..1084595Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1084476..1084595TCONS_00001054-exon-sc0000007-1575043694:1084476..1084595Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1084877..1084966TCONS_00001054-exon-sc0000007-1491911889:1084877..1084966Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1084877..1084966TCONS_00001054-exon-sc0000007-1510915933:1084877..1084966Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1084877..1084966TCONS_00001054-exon-sc0000007-1575043694:1084877..1084966Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1491911889:1085259..1086084TCONS_00001054-exon-sc0000007-1491911889:1085259..1086084Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1510915933:1085259..1086084TCONS_00001054-exon-sc0000007-1510915933:1085259..1086084Clytia hemisphaericaexon
TCONS_00001054-exon-sc0000007-1575043694:1085259..1086084TCONS_00001054-exon-sc0000007-1575043694:1085259..1086084Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1075408..1086084 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
44.789 43.7314 10.8428 6.90764 33.9705 28.0146 63.9035 67.0803 66.5569 70.358 68.6527 64.4676 47.7833 47.4255 47.9247 47.7618 52.3568 52.6427 34.6998 41.7365 34.3597 33.8084 42.1456 45.6921 46.4276 43.4427 26.9754 23.0978 36.6313 32.8817
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004240EMP70
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
Blast
BLAST of TCONS_00001054 vs. Swiss-Prot (Human)
Match: TM9S4 (Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 368/632 (58.23%), Postives = 478/632 (75.63%), Query Frame = 1
Query:  241 LTFFLCLQNVASFYVPGVAPHEFAEGEEIYPKAVKMTSIKTQLPYDYYTLAFCEPTKKHYVPENLGEILRGDRIVNTPYKLEAGKKLPCTFLCPSKK----LSGSQSKAFMERIKEDYSIHMIIDNLPAADLRE--------------GIKPQHGYKLGFYTTDNKAILNNHLRMTIKYNKDT----EKSVFRVVGFQVEASSI--SNIKKDSANTCAFPSNAESKPLIIN-QGENEVQFSYEVHWEKSEIRWSTRWDTYLQMSNVQVHWFAIINSIVIVLFLTGLLAMIIIRTLRRDIANYNKDDDLEEALEETGWKLVHGDVFRPPRYPMILSALVGSGVQVFCMVLITIVFAMLGMLSPASRGSLATAIIFLYVFMGTFAGYYSARLYKTLKGLHWKRAAFTTGLLFPGIVFSIAFFLNFFLWGKQSSGAIPFTTMIALFCLWFGISIPLVYLGYFFGYRKAPYTHSVRTNQIPRQVPDQVWYMHPFIGVLMAGILPFGAVFIELFFILTAIWENQXXXXXXXXXXXXXXXXXCCSEIAIVMVYFQLCGEDYHWWWRSFMMSGACAVYVFLYAIFYFVTKLEIVSVVSGLIYFGYSAIMVFAFWIITGTIGFFATYAFVRTIYSAVKID 2061
            L  F  +   ++FYVPGVAP  F + + +  KAVK+TS +TQLPY+YY+L FC+P+K  Y  ENLGE+LRGDRIVNTP+++    +  C  LC        L+  QS+   ERI EDY +H+I DNLP A   E               ++ +HGY+LGF T  NK  L+NHL   + Y+++     ++  +RVV F+V   SI   ++K D  ++C  P    S P  I+   EN++ F+Y VHWE+S+I+W++RWDTYL MS+VQ+HWF+IINS+V+V FL+G+L+MIIIRTLR+DIANYNK+DD+E+ +EE+GWKLVHGDVFRPP+YPMILS+L+GSG+Q+FCM+LI I  AMLGMLSP+SRG+L T   FL++FMG F G+ + RLY+TLKG  WK+ AF T  L+PG+VF I F LN F+WGK SSGA+PF TM+AL C+WFGIS+PLVYLGY+FG+RK PY + VRTNQIPRQ+P+Q WYM+ F+G+LMAGILPFGA+FIELFFI +AIWENQFYYLFGFLFLVF+IL + CS+I+IVMVYFQLC EDY WWWR+F++SG  A YV +YAIFYFV KL+IV  +  L+YFGY+A+MV +FW++TGTIGF+A Y FVR IY+AVKID
Sbjct:   12 LLLFSLMCETSAFYVPGVAPINFHQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQSNKPVTLTVEQSRLVAERITEDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGF-TDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSCTLPEGTNSSPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHWFSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 642          
The following BLAST results are available for this feature:
BLAST of TCONS_00001054 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TM9S40.000e+058.23Transmembrane 9 superfamily member 4 OS=Homo sapie... [more]
back to top