Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001011 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001011
Unique NameTCONS_00001011
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1640

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001011 ID=TCONS_00001011|Name=TCONS_00001011|organism=Clytia hemisphaerica|type=transcript|length=1640bp
AAAAATATTGTACCGGTAATTTACCGGATCATTTTCCGATTAGAATAGCG
GATATAAGCCGGAGCTGCATTCACGAGCAACCATTCCATAAACAAATATG
GCGGCCGTGCAACATGTTCTTTTATCCACCGAAGCTGAACTTCTGGTCAA
AGCTCTCGACGTCAGTTCTCTGGAAAAGGTTGGAGATAAAAGatGGTGGA
ATAGACATGACATGTTAGAGAAGTTGAATATTCAATCAATAATGAACATT
CCATCGAATTCTTGCTTCATAACTGAAAACCTGCTGACTCATGGGAAGAT
TTCATTGGTTATCAACGAGTTGATCACTTCAGAGATTTGGTCGGAAAGGA
TATTTCCTATTTTATACCATGAAATGTCACAGAAAGACCAATCCACACTT
CCTGTCTATATGACTCTTTTCCATGAAGCAACTGTTGCGGGATTGGTTGA
ATCAGTATTCTACTACAAGGAAGTGAGTGAAGAAGCAGGAGACTTTCTGT
TGGATCTTATCGATTATGCGTACCGAAAACTAACCAAACTCATTTCAAAg
cAACACTGTGAAAGTATAACTCAAAAGGACCCCAAAAACgacTTACTGAA
ACAGAATGAGGATATCCAATTTACGATTGCCATGAAATGCATCTCCATAA
TCAAATATATATGTGATGCTATGGATAGtataACATTGAGTGCAATCACA
AGAATTTTGAATACACATGACTTTCCGTACCTGCTGAGTCAATTGATTGA
TCTTGCTCCttggaaaaagagaaaagaaaacgGAGAAGTGGAAATATTCA
CGGATAACAAATGGGTCATAGTACCAAAAGATGAAACTCACTTACTTCCA
AAGATTGAGGGCCAGGTTTGGTTGACACTTTATCAATTGCTTTTACATCC
AGAAGCACAAAGAAAATATGAATACAACCTTCATCGGAAAACACAACTAT
TAAAGCTTCGAAGGTACCTGCACGAACTATTGTTGGATCAGTTGCCGTAT
CTGTCAGAAGTTCAACGATTTCTTGAGAACCTGTCGGTGATGGACCCACC
TCCCTCTAAGCAAGACCTCATCATTGAACAGATTCCGGAAGTCCGTAACA
AACTGGAGAGAATGTACGAAGGACGATGGAACAAGATTGCCAAAACACAA
CTTCAACAAAATTTCACCATGAGCAGTAAAGATATGAAAGAGCATGCGCA
AAGATTGGCTGCAACATATGATTTAGACATTCTTGAGAGTCTGATTGATG
AGGCGCCAACTTGTTCAAATTGTCAAAACGAAGCAACAAAGAGGTGCTCA
AGGTGTCAAAATGAGTGGTACTGCTCACGacCATGTCAAGTGAAACATTG
GTCCAAACATAAAGAACTGTGTAACATATTGTCAGCTAAATAATACAGCA
AATTGAAAGAAAGAATGCATAACTCTGGATGCTGACCAGCCTACAACATC
GACTGCCAAGAAGAGAAGGATGTCTTCAACAGCTTCCGCTTTAACAATCA
CACTTTTCGTTTTACACAGTATTGCTATTACGCTTCATTGTCTTGGANgt
tttcttcattttgttgcaagaacttttgaagaatattttggtTTTGGCAA
GTTCGTTGCAGCCTTCCATTTTGTAACATTTTATGTTAAT
Run BLAST on NCBI

transcript from alignment at sc0000007:663051..677968+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001011 ID=TCONS_00001011|Name=TCONS_00001011|organism=Clytia hemisphaerica|type=transcript|length=14918bp|location=Sequence derived from alignment at sc0000007:663051..677968+ (Clytia hemisphaerica)
AAAAATATTGTACCGGTAATTTACCGGATCATTTTCCGATTAGAATAGCG GATATAAGCCGGAGCTGCATTCACGAGCAACCATTCCATAAACAAATATG GCGGCCGTGCAACATGTTCTTTTATCCACCGAAGCTGAACTTCTGGTCAA AGCTCTCGACGTCAGTTCTCTGGAAAAGGTTGGAGATAAAAGGTATACTT AGAAATTCAATGACTATCAAAAGGATAACTTTTTCCCTTGGATTTATATT TCCCCTTGTCAGAGATCTTCTACTTCTGCGCCAGCACACGACGGGCTTTC CAGTACACAGGTTAGCGTTTTCCTNGCGCCAGCACGGTGGGCTTTCCAGT ACACAGCACAGGTTTTCCTGGGCTGGGGGTTCCCTTTATCTCCCCATGGA TTTATTATGTTTCCCTTGTCAGAGATCTCCTGCTTTCTAGGAGCTTTCCA GGTTTACCGGCAGGTTTCCTTGATCCCCCTTGGCTGGGTTTCTATTTTCT GGTATATATAGAGGTTTCTTGCATGCCACAAGCCttttagcaactccaga agatttttcaaatttcaattttttttaaaacctatcctatcttgtagagc tttgaaaaagaaagaaaatgaggggtcataggccttcagaggataagtgg ttgtaaagatattcaaattttagtgtcaaaaatttgactaaaaatgtcaa aaaaaggttagaaaaatagcttggaaaaattcgaaaaatgtgtcaaaaaa gaaaaaaaagaaattttccccAGTCATGCctcttcaattttgcatatctc tttttctagtgtagctagaaaCCTGAAATTTGAAGGGAAAATTCTTTGAT TGCGTTAGAATAttaatatataaaaatatttgtaaaatatttagtatcaa aataacgaaagatatatttttttggaaaaaagaagacattgcattgtttt attttagtttttgaagaaaagtagcttgggaaaagttgaaatgagtcaaa aaaggtggtaggacccattttcaaggtgcctctggaaatggaggaacaaa aacttatgagtaaagcaagaataagtttttctgaaaggagaaaccccaaa tgaaaagaaaatccatttcggcagaaataaaaacttttttttcggacatt cccatgcaaaagaagcaaaaaagtgataaaaactacatgaaaatgaaaga actaaaaaattagcaaatgtgatttttgaattcctcaccctttttctgat aaacatacaaagtttcagccttcaaatacattttcctccgtttccagaca catttgttcatTGATAGTTGCAATTTTTTTTtctcccgtcggcaaacaat tttcaaaatgttgcaaaacattctgcattttaccaatttgccgtctagca cgtgtccacagtgttatataccgctggaaagctaagatcacgggctttca tttagtaaaaaaacGGAatgctttagcatacatagaaaaaagttccaagg gttcaaattttacagaaaaatgaaacatttggtttgacgtcaacgtgTAA CACTTGTGGCGACAAAAACGCGTATAAAACGCGAGTGTATTGCCCTATCT ACACCGTAGCAGATAAACATTTATAATGTAGCACGGGCTTTAATATTCCT AATTAGAACTAACGTGCCTAATTAGNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATTTTTACTTATGGCGTCA TTTTGAAGCCCTCCgcccaaattttgttttgatttttggctcaATATATC ATCTTTGACCTGCTCTATCTATTGCTCATAGTTAGAATTTGCGGATTTTG TTTGTTGGTGAAGAAtctgaatttttaaaaaatcatattcttaattagga ttgaaaaacaaagggataatcctaattaagaaagtccgtgcgatcaaaaa aaaatttgcttaatTAGAATAGAACTCCTGACTGACAAGGCACAGCCGGT TTATAGGTTTTTTCCTCTGTGGTTAGTTTCTATAGATTCATCCTCTCTAG TCGCAACAACATGTCTTTCATAGAAGAACAGTAAAGTCTCTAGTGGGATT TCTGAATAGACTTTACACGCTGTCTCTGTCTCggtaggcctccagaggat aggTACGCTaagtagcgactccagaagtcatgcaacttttgttgacatca aaccaaatgtttcatttttccgtgaactttgaacccttcgaacttttttc tatgtatgctaaagcgttcttgtttttaccaaaagaaagcccgtgatctC CGCTTTCCAGCTGtaatataacactgtggacacgggttagacggcaaatt ggtaaaatgccgaacgttttgcaacattttttaaattgttttccGACGGG AGATAAAAAAATTGCAACTAGCAatgaacaaatgtttctggaaatggagg aaaatgtatttgaaggctgaaactttgtatgtttatcagaaaaagggtga ggaatttaAAAATCACATTTgctaattttagttctttcatttgcatgtag tttttttttacttttttgcttcttttgcatgggaatgtcccaaaaaaaaa attgatttcttccgaaatggattttcttttcatttggggtttctccttaa agaaaaacttattctttacttataactttttgttcctccattttcagagg ccccttgaaaatgggtcctaccaccttttttaactcatttcaaccttttc caagctacttttcttcaaagacaaaaataaaacattgcaatgtgttctat tttcaaaaaaagatatatcttttgttattttgataaatatactaaatatt ttacaaatatttttatataaataatAGTATtgtaacaccatcaaagaatt ctccctccaaatttcaggtctctagctacactagaaaaagagatatgcaa aattgaagaagcatgactagaaaatttcttttttttcttttttgacacat ttttcgaatttttccaagctattttcctaacctttttttttacattttta gtcaaatTCTTTACactaaaatttgaatatcttcacaaccacttatcctc tggaggcctttgacccctcattttctttctttttcaaagctctacaagat aggataggtttttaaaaaaattgaaatttgaaaaatcttctggagttgct acgcTAGGCGAAGGGAAGTTAGGTATTAGTTTACCGTTACAATGAATTCA AAATTCGAtgcggcaaaatttcattattcattattcattattttactAAC TCTCCCACGCGCTGCAAGTGTACCTGTACTATTAAGTTATACCCCTTCGA TATATATTACCCGAGGATAAAAATGCTTCTTTTCGAGGCGTGTGCCCTCA TATCCTTTGTTTCACATTGGGCGCGCTGGTCCTAGGTCACTTGTTTGACA GTACACTTGTGCGGCAGCTCAGTTGTTCAACATTTTAGCaaaattgtcga acaactgTATTGTCAACTAACTGGGAAGATCTGTTGTTAGACTTACCAGT CGGTTGGTTTGAAACGCAGGACGCAGGACAGGGTGTGTACATCAGTTTTa acaaaatgcttttttcatgATCAATATGATGCTAACGgtgcaagtggata tagattgatatattttgaaaacattaaatgctccaaaagggctgttttag agatatgaagaaagtgacgtcattttcatcaaaaatacgaggcaggggat aaaaatattgatatagtTATGAAATATGTACTTTTGACTGCCTTTAACGc cattttaatcaatttttgttatcatacccaaggtgatgcaggagatataa tgagatatgatatagcgattgtgaaatagctatttccCTGCCAGGAGGCT GTTTAAAGATGAcataaatatatatatatataacacGTGTACTTTGGATA TAACATATGTAACATACCAatgacattgaaaagataacttcTATTATACA TGCGTGATTTGtgtgtaatatataataaaacacgTGGTAGGCACGTGGAT agattttgacctttaaaaaggTTCCAGATCAACCTTCAGAATGATATTTC TAACAATTACAATTGTTTTTAAacattctcttctttttttacaTAAATTA AAACTGACCTGTCAGCAttgacctgcgtcctgtgtcctgtgtCTTGTGTT TCGAACCAACCGCTTCCCAGTTGGTTGACGCttacttgttcgacaatata tCGATATAAAAGTCAAACAACTGGGATGTCTAACAAGTAAGCGTCAAGTT GTTCAACATGTAAGTTGTTCGACAATACAGTTGTTAGACAATTATTTGTT TCCGCTCATTTTCTTCTCAAAGCTTAGATGGTAGGTACTAATCGGATTAA TCTTCGCCTTCTTCGCCAAATGTATCCACGCGGAATTTTCGAGATCAGAC TTTTGGGTAAACCGGGCTTGTAAATATGGTGTTTATGTGACGAAAATTGC TTTTAAATTCTactcatgtaaatgggtcagtgtttgaagTCCGGCAAGAT TTCCGGGGAAAAAGCCTATCCTGCGGtgtgcggatctaggtgggtttgGT CTctcccgtagatctttttcttgggaagttgatcttcaaattagttttca acgTTGGCTTGGCtccaattttttcatttatggctcaaattttaggtaat ttctcatagtttttgaaaatattaatttctataaaaagtgccgggttatt tttttgtgattccctttagaagttttgcagcACATTTATTTGCctgcgag tcaagtaaacgcTATAGCGCTTTTGCAGTATTAATCTTTGATGCGCATTT CGGTGGGACGCTAATATGACTAACTGTCAAGTATGAATAACTGTTAATgg gaatcaaaattataaagtgcacttacaaacatcaatatatcagatttaac aaaattaataacgacactgtcatcattgacaataaagcaaaagattttct gtcaagagccttgtaaacattgcAACAAcctccatcgaaatgatctgccg cagctaagtctaccattttagcgcggtccaAGGATTGAGCAGAGAACACT CACAGAACACCCGCAAGCTCCCgtgcgggtgaaaaactttaatctgtcag TCATTTTCTCAATTGAAGAGTACgagaagcgattctagctttacaatagt gccgcggatcattagtggatagtattcaattatcattatccctttatttt cattcctagaacttttgcaaaaaaaaaaggatcttttactgctctattca catactgaatttgaaagatcttctatgtggcgttttttttgcaaatttca aaaaactgatttttgtcctgcttttgcgggactttagcttaagtgcttgc atGCAGCATCTAGGCTCCAAATATACGTGTTTCCCGTAATtcttgtatga agagttaggtctatactgccatagatgaaaaaatttgagccaagccaacc ttgaaaactaatttgaaaatcaacttcccaagaaaaagatctacagggga gacggaacccacctagatccgcgcaccaccggataggctatttcctggaa attttcccggacctcaaacactgaccaatttacatgtgcggaattatttt ttctttagcatataaacaaggccttaaattaaaaattgaagcaatgtcag ggaattgaatgacaaagttTGGTTGGTTAATATTCTGGATGCTGCACATT TGCAATaggtcattttgtctcattttaagttttcaagttttaattaattg ttttgGGAActaacttgaacttgattcaggtaactctcatccttgttgtg gcAAATActtcctgtagatgactgatgttgttttttctgaaagcttgatt tcctagtgtgactaactgacagtCCGACCaactgataatttttttaactt ttccaaatcttttgagTCAGAGAGACGcaaaattgttgaaattttaTCCA ATTCCATAATATCCAACCCAAAACAAATATTAAGCACCTAAATAGCAGAG TCATGGCTGtattccttttttataagaacaccttAACCTGCAATTGTAGA AGTGATCTTGCAATTGAGGTGTGTGCCTTTGTGGATCCAAACTTAGGTAT TTCTTTATGTTTGCGGTTTGGATTCTAGGATTGTGCGATTGCTtgaaaaa ttgaggtttttggtgggaaaattAAACAAAGGTTCAAATTTCAGCTACCA ACCGTCCGACCcattttttaagcatttaggacacgaaccaaacattcaat tgggcctggcccaAAACAGAGATACcccatttgaaaaaaagaaggaaGCA TGGTAGCCCATACACAAAAGGGTCACGAAAAATCAAGAAACATAAATTAT TTCCATGCGAAAGtgggttttaaatttttttaaagattgacaCTGTCATG ATTTCCTCTCCAATATGCTAATTCCTACATTTCCCCCCTGAACATTCACT TTGGTTGTTCTTATTGAACTTCAAATAGAAATATCTTCTCAATTAAACCT AATTATGTGTATCATTCCCTAAGGGAAGGGGcattttaaagaaggaaaag tgTTATTTATTTTAAGTAATATGGTAAGGAAGTTTCAACTGAAGCTTGTT GGTCGCAATCCTTTTAAAGCTTGGGTGTCGGTGGGGGCTTTTGAGATTTT CAGAATGTAGAAAACTAAATTCAATTGAATTACTTGGATGGTTGGTACAA AATTTATCTTCATTCTGTtataatgtttttctttcagatGGTGGAATAGA CATGACATGTTAGAGAAGTTGAATATTCAAGTATGTTTAAAGTTTCCAAA TTTAGAATCATTTTGGTTTATCCttctaactttttattttgttagtTATA GTAAAATTTGAATGAATACACTGGAATACCCCGCTGAACCCTGGGGTTGG GTTAATGCCAAAGCATACAAGAGggtacaagggggaggggtgGTCAATCT TCATCGATTCTGAGCatacatactttttgaatggtcccaaagaaaatttt taagaatttatgaACAAAATCCTATAAATGGGTGTATAATTCAAGAAATG CACTAAGATGAACTCTGGTTTCTATTTGAATTCTCAACATCATCTCAATT ATATATCTCTTTTTAGTCAATAATGAACATTCCATCGAATTCTTGCTTCA TAACTGAAAACCTGCTGACTCATGGGAAGGTAAATgtttatttgtaaaaa ttaaTTAACCACTTACTGACACTATCATCTTATGTGAaggattttcttaa aatttgaatCCATTTAAACGTTCtagaaaatcttcaaagatctttttttt ctctccAGGTTTCTCTAATTCTTAGTTAGCTATTATCAAGCTGTTATCTT TATCAAATTATTAAGAAATTTTCTTGCCTTCGTGGGATTTATCAATGTTT ATTTCATGGGATCATTTTAGATTTCATTGGTTATCAACGAGTTGATCACT TCAGAGATTTGGTCGGAAAGGATATTTCCTATTTTATACCATGAAATGTC ACAGAAAGACCAATCCACACTTCCTGTCTATATGACTGTATGTTTTTTTG ATATCATTCTTGAATACAGCAATTTACAGCTATTCTTTTGCTTTCACAAT ACTTTTCACTATTTTCAGCATTAGATTGAAAGTGTGATAGCTATGGTTTT CATAAAATGTTATGGTATGTTATTATTTTAGCTTTTCCATGAAGCAACTG TTGCGGGATTGGTTGAATCAGTATTCTACTACAAGGTATTTAGACTTCtt cctgaattttcaaaatatacttCTTTGTCTCATTGACACTACTATGACAT TGCATAGTTTTTTTGCACATTTACACCGACATATGTTTTTTTAGGAAGTG AGTGAAGAAGCAGGAGACTTTCTGTTGGATCTTATCGATTATGCGTACCG AAAACTAACCAAACTCATTTCAAAGTACGTATCATTTCTGTATATATATG TGACTTTTTGGAACAAGCAAGTTAATTGATCAATAATGATCTGATAAGGT ctcttgtttttaacattttaggcAACACTGTGAAAGTATAACTCAAAAGG ACCCCAAAAACGTAAgataattgattttctttaagaTATCTTGAATGATT ACAAGAAGTAAAAATCGATGACAAGTTAAccaaaatttgtatttttcagg acTTACTGAAACAGAATGAGGATATCCAATTTACGATTGCCATGAAATGC ATCTCCATAATCAAATATATATGTGATGCTATGGATAGGTAAGtgtcttg tttttcttttacttttaaaactTCTAATACAGGAGAATGGTAATCGGTAT AATATCGGTAAAATATTAATTTGTTCACTCGAcctctatttttttttcag tataACATTGAGTGCAATCACAAGAATTTTGAATACACATGGTATGTTAG CAATTATGAAAACATTTGATTACAGTGGCTGTATCTACTTTTGTTTTTAT GAATCAGTTTTTTTCTTGATTAGGCATCATATTATTTATTGAACATAAAC TTCTGTTGTAGACTTTCCGTACCTGCTGAGTCAATTGATTGATCTTGCTC Cttggaaaaagagaaaagaaaacggtgagtttacaaaataatttttcatt cgtTAAGGGCGTCATTTAAAGTATCTGCTACAATTTGCTTACAcaacatt tttaaacaaaaaaaaacgactTTTTCTCCTTTCGGCGCCCTGCgtgaata aatttgaaaaattcttttgtttattctataatgtcagcatagaggcgcgc cttctttcaatttcataaaagtaTCTTCAATCGGTTCGCAATCATAGTGT TTGTGTTTTGCTTTTATTAAGTTACACAACATATCACTCTATTTTTCTTA CATACCGTAGGAGAAGTGGAAATATTCACGGATAACAAATGGGTCATAGT ACCAAAAGATGAAACTCACTTACTTCCAAAGATTGAGGGCCAGGTATGTC ATCTTGAATATCTTATCATATCACGAGGCTGCCTCCATTTTGCAGGGTGT CTGCTGGATCTCAATAAAAAAGCCTCAAATATTCCTTGATACTGATCCTG ATACCCTTTTTTGTAGTATtcatgtttgttttgtttttctttggagCTTT AGAAAGTGTTCTATCTATAAGTCTTGAAAACTTTGAATCTAGTGTAAAAA CTTTCGTATGCGCCCTGTTTTAGTTTCTTATGCTTGTACTCTTTCTTAGG TTTGGTTGACACTTTATCAATTGCTTTTACATCCAGAAGCACAAAGAAAA TATGAATACAACTCTCATCGGAAAACACAACTATTAAAGGTAAGAAATTA CAGTTCTACCGTTAATTTTCTAAAGTCATTAAAGCAGATtgtaattttta ttgttttatatttGATAGCTTCGAAGGTACCTGCACGAACTATTATTGGA TCAGTTGCCGTATCTGTCAGAAGTTCAACGATTTCTTGAGAACCTGTCGG TGATGGACCCACCTCCCTCTAAACAAGACCTCATCATTGAACAGGTTTTT CCTTTTCCTCTCACATTATCTCACCTNGATTGAGGGCCAGGTATGTCATC TTGAATATCTTATCATATCACGAGGCTGCCTccattttgcagggtatctg cTGGATCTCAATAAAAAAGCCTCAAATATTCCTTGATACTGATCCTGATA CCCTTTTTTGTAGTATtcatgtttgttttgtttttctttggagCTTTAGA AAGTGTTCTATCTATAAGTCTTGAAAACTTTGAATCTAGTGTAAAAACTT TCGTATGCGCCCTGTTTTAGTTTCTTATGCTTGTACTCTTTCTTAGGTTT GGTTGACACTTTATCAATTGCTTTTACATCCAGAAGCACAAAGAAAATAT GAATACAACCTTCATCGGAAAACACAACTATTAAAGGTAAGAAATTACAG TTCTACCGTTAATTTTCTAAAGTCATTAAAGCAGATtgtaatttttattg ttttatatttGATAGCTTCGAAGGTACCTGCACGAACTATTGTTGGATCA GTTGCCGTATCTGTCAGAAGTTCAACGATTTCTTGAGAACCTGTCGGTGA TGGACCCACCTCCCTCTAAGCAAGACCTCATCATTGAACAGGTTTTTCCT TTTCCTCTCACATTATCTCACCTTGCAAATACACCATTCTTAAGATGGAA AATGCGATAGCGATAAGTGAGAGTCCAAAAAAATGGATTGTCATTTGAAA TGATATTtgataatgggcttttccagaaaaaaaatttacccccactgttg aggatattgatttttcgaagtattgaaccccctggatatcctactttatt agtaaagacctcttggatatccactcttatgaagatgcttacccctggcc ctggatatcgtattttttacttgaaaagacactttaccccctggatatcc gctcccttatAGATATTTAACcacctggatatccacttttgaacaaaaat cgttaaccccctggatatcccaTATCCTCAACAAGGGGGgaacggactat ttctggaaaagcccaatatggTGGTAATACTCAAAATGTGAAGTTTCGTC TGGTCATCCAAAAATACAAACTTGAACTAGAATCTCTCTGACTTCCTTGT GACTTTCTTTTGTTCATTTCTCTGATAAGATTCCGGAAGTCCGTAACAAA CTGGAGAGAATGTACGAAGGACGATGGAACAAGATTGCCAAAACACAACT TCAACAAAATTTCACCATGAGCAGTAAAGATATGAAAGAGCATGCGCAAA GGTTTGTTTTGGGAACTTTTTTATCCTGTATGAAACTAACTGCGTGCTCA GCCTGTATCCACGCTACTTCATAAACTAGTAAAAAGATTATTTGGAAAAG TaaaattctgatttttatgAATTGTCAGATTGGCTGCAACATATGATTTA GACATTCTTGAGAGTCTGATTGATGAGGCGCCAACTTGTTCAAATTGTCA AAACGAAGCAACAAAGAGGTGCTCAAGGTGTCAAAATGAGTGGTACTGCT CACGGTAGGTAGAATCACGTTCTTTGACGTCAATCAGTGGAGCAGATTAG ATGGTTTTGCACAATAGTGTGTTTTCCCCAGTTTTAACCTGTAGGACCCT AAATAGCGAATAAGATGCGTCACTAcatctctattttgttttactCTTTC AATGTTTCATTCAGACTGGCCCCTTTTCTTTTACAAGAATTCTACTTCGT GGTAttctaaatttagaaaaagtagTTTGGTTTTCTTTTGGAAAGATGGT TTCTTTTTTACATTGTCCTCGAACGCAATAAAAATCGGATTCTGAATAAA TTGTTATTTTACGAAGAGTTTCTATTTCTTCTCCGTCATACTGTGAAAAT GTCTCTTTGTGTTTTCACCAAATAAAAAGGAGCAAACACTCATCACTTTG CTTTGATCAGGGATATTGGTAGCAAAATTACCAATCGGTACGGTGCACAA TAAGAAACCCATTTCACTCCAAACGAATGTGTACGTGTGATTATTAAATT GTTTCATTGGAAAACGAATCATTTGTAAACCGCTTTTGAAAGGGAATTTC TCattgtgtttttattttctttagacCATGTCAAGTGAAACATTGGTCCA AACATAAAGAACTGTGTAACATATTGTCAGCTAAATAATACAGGTAGGAT TtagttgtttttcttcttcgacAAAATTTAAGCCAATTTGCCGCTCTATT GATGTCTCCAACCCACGAAATCCATTTGTCGAAAATTCTGAAGATTCTCT CCATCTCTTAATTGatgtagatttttcacttttcattttcttgttttctA ATGATCTTTGAAACCACAGTAGGTCTTGTATTTTGGTGACTTTTCCGTGT TTTCTCTTCTCTCCTCTCCTCTCCTTATGACTTTAATTCAAACAGTCTTC CTATCAAAACTTCAATTCTTCGCTCCCATGATTTGCATAAAGATTTATTG GTTTTAACTTTAAGACATGATTTTATCTCTATATGGTCGAGATTTTCTGG TAGCTAATATCAATATTAAGGTTGGTTTTGCTTTTTTGTTTGTCGTGCTG CAGCTCACTACAGTATTTGGTGAATCTGTCATTTTTACATTGTTATCAAa ctaaatgttgaaaaaagcaatgCATCAAACTCTTGAACCATTACTATTTA TATTTTAATAAGTCGTTTTCTACAAAACCTTTTTTGGAGCCGATATTTAG TCTAAAATCAAAACCTTTGATACGAATTCGCAAgtttttccaataaaatt tacTTGAGATAATTAATGAAATTTACCCATTTGAATTGATTTAAACCACT AACGTTTTGCTATTATTTTTTATCAGTGATTCTTGGTTGAAAAAGGTGGG CAAAGAGTCGTTCTAATGTGATTTGATAAGTTATCTTCTAGAGCTGTCTA TCTTCATTCGCCGATGcggttttaattttcttaaatgacgttttacattt taaaatcaCATTTATCTTAATTCAGCTCTTAATTCATAGCTTTTATTATT TATCGTGAGGATTATCTAAATTGTCACATCTTTATATGAACCTCGCTGGG CTTTTTCTCGACACAAAATCTTCAGAAATTTTCGTGGatgtttttggaaa ttttttaaatgcacttcaattcatcatggatattcttaactttttggaga aatcgtcctaaaatatttattctgcattcttaggttatagtctaaattca aactagatttaaTATGTAATACATACGTCTAAACCATAAAATAACATTTT GGTGAAAGTGTTgagataattggcaatttacagttaaaaatgctctgaaa tggcatttttagggtttatttactaaattccatgatggcgatattcttag catattcttaagtttttggccaattttatcaagaatattcttataaaaga aaagcgTGTATACTGTTcgacgaagaaaaaatattaccTAGCGTGAAGGG AAATGGAATATTATAATATGGGAATGCGTGAAAAGGGGGTTGACGAGAAT TCTTTGCTTTACTCAGGAGAGAAGGTTTTATCTCTTTGttatgaagcaaa ataattCAGCGGGCAGAATTGAAAAAGGAGATCCTAATTATCTGAATTAT TTCGCCGCCTGTTTACTTTATATGAATCACCATGGTAACACGAGAGAGAA AATCTTCTACTCCATTTTCTGTTGACTCTTCATGttaacatttcaaattt tccagtcaaaaaCAAAGTTGCCATNTTATCAGATAAAATGAATTAGCCTC GGCAAAATCTTTATAATTTTAAAGTTCTTTCTATCAAATAAAATCATTAA GCCGAGCCATTGGGCTATTGTTATTGTAAAATGTCTTATTAGAATTTTAC CAAACGATCATTGCTTCAGTAGTTATTCCCCTCTCTGTACATGTAGGTAA AAAGTTGATTGTTTGGTCATTCTCTGAAACCATCTGAAAGAAGTGGCAAG CAAAGTACTTTCTTAATCATCCAATAATTGTTTCATTTCCATTTTGGTTG AAGTGTTTTTTCAAGTGCGTCATCTGTTCTGTGAATGGGATTATTTAATT GATTAGAAACtgtattttcatattttctgcAGTTGGGGGTGTCAAAGGAA GTGTTTCTGTATGATTCTGCAATTTCCAGTACTGGCTCCTAAACAATTCG AATAGCTGCGAATAGTGAAATTGTTTGATACTTTTCATCTTTACCTTTGA GAGATAATAGAAGCATGTTCTTTCGATTCGCAGATATTCGGGTTGGCTTT TGGTTTGGTTATCTATTTTTATTATCAAAGGGCGAAAGGAAATCATAGTA TATCTGCTTTCCTGAATCCTTTTCACTTTGAACTCGCTGATAAACGGAGA TTTTTATGATCTCTTTAAAAAAGACCAAGTTAAACGAATCGACTGGTTAG CTCTTTGCTTTGATGAAATCCTCATACGAAATTGTTTCATCTTTCGAATT TTCGTAAGGCGGAATTGTTTGGATATTGCTGGTTGTTGTTACAATTCATA TTTAAGGTGTCATGCAGCTTTCATCCATCATCCACACTTTCCCTTTATTN tatttctttttcttttcatcatgTACCATATTTGGGAGGTATTAAATTGC TCTTTCCCACGTCAAAGATATTTTAGTCCTTTGTTGGAATTACACGCATT tgagtaatttttgaaaatacgaAACGAAAACTATCTTGCGTAATTNATTT TTTCTTCaaaccaaaaagtaaaaatgttcGCTTTTGGGACTTACATCAGG CTTCCTCGGTTTCTTTTTTTTACGTTTACTCGCTAACTTGGTTATGCATA TCACACAGATGGCTTAAGTATGTACACCAAGTAGGCTTTTGAATTGTGGT TTCATTCTTTGATATCGCTGACCGATAATCCAATATCCATTGATGTCGAA TGAAGATAAGTAGGAGAAACTTCCATCCAAATTCATCAtttttgattact tttatttgtGGAAGGGGGTGCACAAAATTGCTAATGAATTGTCTAATGAC AgtgtattttgagaaaaaggAACTACTTTTTTCGATCAATTGTTTGTTCC attaaaatttccaacctttataaagattttttatttggaCAACTGTAATC TataatttattttcctttttttacagCAAATTGAAAGAAAGAATGCATAA CTCTGGATGCTGACCAGCCTACAACATCGACTGCCAAGAAGAGAAGGATG TCTTCAACAGCTTCCGCTTTAACAATCACACTTTTCGTTTTACACAGTAT TGCTATTACGCTTCATTGTCTTGGANgttttcttcattttgttgcaagaa cttttgaagaatattttggtTTTGGCAAGTTCGTTGCAGCCTTCCATTTT GTAACATTTTATGTTAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000584XLOC_000584Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001011-exon-sc0000007-1491911889:663051..663242TCONS_00001011-exon-sc0000007-1491911889:663051..663242Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:663051..663242TCONS_00001011-exon-sc0000007-1510915933:663051..663242Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:663051..663242TCONS_00001011-exon-sc0000007-1575043694:663051..663242Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:669838..669880TCONS_00001011-exon-sc0000007-1491911889:669838..669880Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:669838..669880TCONS_00001011-exon-sc0000007-1510915933:669838..669880Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:669838..669880TCONS_00001011-exon-sc0000007-1575043694:669838..669880Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:670217..670279TCONS_00001011-exon-sc0000007-1491911889:670217..670279Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:670217..670279TCONS_00001011-exon-sc0000007-1510915933:670217..670279Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:670217..670279TCONS_00001011-exon-sc0000007-1575043694:670217..670279Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:670521..670637TCONS_00001011-exon-sc0000007-1491911889:670521..670637Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:670521..670637TCONS_00001011-exon-sc0000007-1510915933:670521..670637Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:670521..670637TCONS_00001011-exon-sc0000007-1575043694:670521..670637Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:670782..670835TCONS_00001011-exon-sc0000007-1491911889:670782..670835Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:670782..670835TCONS_00001011-exon-sc0000007-1510915933:670782..670835Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:670782..670835TCONS_00001011-exon-sc0000007-1575043694:670782..670835Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:670945..671024TCONS_00001011-exon-sc0000007-1491911889:670945..671024Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:670945..671024TCONS_00001011-exon-sc0000007-1510915933:670945..671024Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:670945..671024TCONS_00001011-exon-sc0000007-1575043694:670945..671024Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:671122..671161TCONS_00001011-exon-sc0000007-1491911889:671122..671161Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:671122..671161TCONS_00001011-exon-sc0000007-1510915933:671122..671161Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:671122..671161TCONS_00001011-exon-sc0000007-1575043694:671122..671161Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:671250..671338TCONS_00001011-exon-sc0000007-1491911889:671250..671338Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:671250..671338TCONS_00001011-exon-sc0000007-1510915933:671250..671338Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:671250..671338TCONS_00001011-exon-sc0000007-1575043694:671250..671338Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:671451..671491TCONS_00001011-exon-sc0000007-1491911889:671451..671491Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:671451..671491TCONS_00001011-exon-sc0000007-1510915933:671451..671491Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:671451..671491TCONS_00001011-exon-sc0000007-1575043694:671451..671491Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:671612..671674TCONS_00001011-exon-sc0000007-1491911889:671612..671674Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:671612..671674TCONS_00001011-exon-sc0000007-1510915933:671612..671674Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:671612..671674TCONS_00001011-exon-sc0000007-1575043694:671612..671674Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:671961..672043TCONS_00001011-exon-sc0000007-1491911889:671961..672043Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:671961..672043TCONS_00001011-exon-sc0000007-1510915933:671961..672043Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:671961..672043TCONS_00001011-exon-sc0000007-1575043694:671961..672043Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:672897..672986TCONS_00001011-exon-sc0000007-1491911889:672897..672986Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:672897..672986TCONS_00001011-exon-sc0000007-1510915933:672897..672986Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:672897..672986TCONS_00001011-exon-sc0000007-1575043694:672897..672986Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:673066..673191TCONS_00001011-exon-sc0000007-1491911889:673066..673191Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:673066..673191TCONS_00001011-exon-sc0000007-1510915933:673066..673191Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:673066..673191TCONS_00001011-exon-sc0000007-1575043694:673066..673191Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:673730..673851TCONS_00001011-exon-sc0000007-1491911889:673730..673851Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:673730..673851TCONS_00001011-exon-sc0000007-1510915933:673730..673851Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:673730..673851TCONS_00001011-exon-sc0000007-1575043694:673730..673851Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:673979..674104TCONS_00001011-exon-sc0000007-1491911889:673979..674104Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:673979..674104TCONS_00001011-exon-sc0000007-1510915933:673979..674104Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:673979..674104TCONS_00001011-exon-sc0000007-1575043694:673979..674104Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:674675..674743TCONS_00001011-exon-sc0000007-1491911889:674675..674743Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:674675..674743TCONS_00001011-exon-sc0000007-1510915933:674675..674743Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:674675..674743TCONS_00001011-exon-sc0000007-1575043694:674675..674743Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1491911889:677727..677968TCONS_00001011-exon-sc0000007-1491911889:677727..677968Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1510915933:677727..677968TCONS_00001011-exon-sc0000007-1510915933:677727..677968Clytia hemisphaericaexon
TCONS_00001011-exon-sc0000007-1575043694:677727..677968TCONS_00001011-exon-sc0000007-1575043694:677727..677968Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:663051..677968 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.6293 2.4415 4.19774 3.23484 10.722 9.1002 6.4404 6.97236 4.43534 3.26998 2.55385 2.64645 0.475644 1.66458 0.61536 1.38969 1.1148 0.334449 0 1.31978 0.837351 2.58458 2.25929 3.41875 3.6154 3.50819 2.29158 2.10767 1.08333 0.00840669
Blast
BLAST of TCONS_00001011 vs. Swiss-Prot (Human)
Match: ZMY10 (Zinc finger MYND domain-containing protein 10 OS=Homo sapiens GN=ZMYND10 PE=1 SV=2)

HSP 1 Score: 364.385 bits (934), Expect = 8.102e-120
Identity = 194/432 (44.91%), Postives = 291/432 (67.36%), Query Frame = 2
Query:  116 VLLSTEAELLVKALDVSSLEKVGDKRWWNRHDMLEKLNIQSIMNIP-SNSCFITENLLTHGKISLVINELITSEIWSERIFPILYHEMSQKDQSTLPVYMTLFHEATVAGLVESVFYYKEVSEEAGDFLLDLIDYAYRKLTKLISKQHCESITQ------KDPKNDLLKQNEDIQFTIAMKCISIIKYICDAMDSITLSAITRILNTHDFPYLLSQLIDLAPWKKRKENGEVEIFTDNKWVIVPKDETHLLPKIEGQVWLTLYQLLLHPEAQRKYEYNLHRKTQXXXXXXXXXXXXXXXXPYLSEVQRFLENLSVMDPPPSKQDLIIEQIPEVRNKLERMYEGRWNKIAKTQLQQNFTMSSKDMKEHAQRLAATYDLDILESLIDEAPTCSNCQNEATKRCSRCQNEWYCSRPCQVKHWSKHKELCNILSAK 1390
            +LL  EAE+LV+ L    L ++G + W  +H+ LEKLN+Q+I++   S    I E L+THGK+  ++ ELI  E+W +++FP+       K Q+T P+YM + HEA++  L+E+VF++KEV E A D +LDL+DY +RKLT L+++  C    +       +P  +L KQ E ++F IA+K +S+++YI D +DS++LS ++R+L+TH+ P LL +L++ +PW +R E G+++ F  ++W  V   E   L K++GQVW+ LY LLL PEAQ +Y      K +LLKLR +L + LLDQLP L+ +Q FL +L++ +  P K+DL++EQIPE+  +LER   G+W  IAK QLQ  F+ S +D++  A+R A TY LD+LE++  E P C+ C  EA+KRCSRCQNEWYC R CQVKHW KH + C +L+A+
Sbjct:    6 LLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRR-EGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTC-VLAAQ 435          
The following BLAST results are available for this feature:
BLAST of TCONS_00001011 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZMY108.102e-12044.91Zinc finger MYND domain-containing protein 10 OS=H... [more]
back to top