Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000995 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000995
Unique NameTCONS_00000995
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1980

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000995 ID=TCONS_00000995|Name=TCONS_00000995|organism=Clytia hemisphaerica|type=transcript|length=1980bp
GGCGGTTTGATACTTCCttgatttcatgatttcatcactttttttaCACG
AAtccagaaaaacaaaatggcgtctccaaatgaagatgaaaaacgaGTTG
CTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAA
TCCTCAAAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATGAGGT
GGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATactaaaa
agaaatttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCCAAAG
CAAATGGCAATTcgtgaaaaagttttcaaaattatcacAGAGACATTTCA
AAAACATGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAGGAAA
CACTCACAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTTGAAA
GATCAAGGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTATAGTT
CTTGCCTTGATTTACCAAAACATTGAGACTAGCAAGTTTTCCATTTTCGA
ATATAACCCTATGAATGAAATAGAAATGACTCATATTCAAGCTCTTCTTC
ACAAGAAAAAGACCGCAAAATACAATTTGTAGCCGTTAGGCACCATTCCA
TGTCTGATAAGTCTTGTTTCCCTTGTGGTGGTTTTTAACATGCGTCTCCA
TTATCCAACTAATGAAACCTTTCGTGTGCGATTAACAGGTACCATTTGCA
CGGTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGC
ACGTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTG
AATTCTACCAATGTGATTACGATGTAGCAGGACAATACGACCCACTTATA
CCTGATGCTGAATGTGTCAAAATTGTagctgaaattttattgaaacttgA
ACTTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATTGGACGGTA
TTTTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCATCTGTTCA
TCAGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGTAACGAAAT
GGTGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGATATACGAAT
ATGTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTACTGAACGAT
GAGAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAAGATATGAA
GCTCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAATGTTTCGT
TTGATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAGTGATTTAT
GAAGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGTAAAACTGA
TAAGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGTTGGCGTCG
GATCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCATGTTCGAT
TCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACG
TATTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGAGAAAGCTC
GaattacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTG
GAAGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGC
AGAAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACT
GTGAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTG
GAAAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAACAGAATGA
AGTCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTGCGTCGAAT
AGATcaaccaaaattgaaattagatttttttatgcagtttttttaaatga
aaaaatatttatttagatATGATTTAATTA
Run BLAST on NCBI

transcript from alignment at sc0000007:405053..423361+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000995 ID=TCONS_00000995|Name=TCONS_00000995|organism=Clytia hemisphaerica|type=transcript|length=18309bp|location=Sequence derived from alignment at sc0000007:405053..423361+ (Clytia hemisphaerica)
GGCGGTTTGATACTTCCttgatttcatgatttcatcactttttttaCACG AAtccagaaaaacaaaatggcgtctccaaatgaagatgaaaaacgaGTTG CTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAA TCCTCAAAAGACCAAACTGATGAAATAAAGCAACAGGTActgatttcaaa aagttttctttacTGTGTGTCTCTCTAGAACTAGAGTCAATGAGTGAAGA CAGTTCAAGACAATTTTAAAAGGGGGGTGACAAATTTTTCCcagacaaaa attttccccaataTATTATCACCCAACCAAATTGGTGGCTTTGGAGCTCC GCATCAGGAATGGTCAGCTTGGGAAAATATAGTGTGTTTTGTTTACGTTT ATCTTAAACTTAACTTATATGTNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCcccctggc ttcaaaaaaaattctttccccctatacgtccttttgacctcaaaacccat tccccccctgaatccagggggggggaggacactatgtgtACCGTCTgtca tcaactgctctaacttgggacgattggtcgaaacatgggactgttgcata tctggtctgtattttaatttactgtaaaatcgaaagagaaatcgtgtaat ttttaatacgccgtttgttaactcaaatcaaatgtcTTTGGAGATTCGGt aaaatggtggccgaattgctgtcccatgttttgtcagatagtcccaagtt agagcagttgacggtattgcTCTTGCGGCAATACACCTGTTCCCATAATT CAAACTTCTTGAAAATGTGCTCTCCattgttgtgtataaaattgtatGGG AGGTAAACAACGCGTTTTTACCTGCTGGCGAAGgcggggttagggaaagt gggttttaaCCTACCTACcatgagagtgggtaacttgcatcagtggaggc taacatgcatagccctcaaatggtGAAAGCTTCTTCGTAAaaacgaaaga catgtatctatttttcggatccggaatgcgggaatagtgtcaggacctgc aggcgacctggtagggttgggtatgggtgtggtttgggtgtggttacgta tcagattggctaggaatttggttattatcagttagggttagagttggagc tcgaaaaaagcactcttttgtgattttctcttaatacagtctggtctgta gtttgtacaatataaatagccgtcagaaacgcTCTTTCGgtatgaatccg tggcgcagtggataaggcattgggtttcaaaacatctgaactttgcattt agtgggttcgaatcccaccgttggcgatctgtcggtaagtcattcagggt gtcagtaagttagaaaacatagtaaataactcacacagaaccagaaagtc agaaaaactacgaacaagagactggaaagtacgaaatacgTCCAGATCTG TCTTACAAAGAAGCCACGAccccctcaaatgaatgacctggctggtcatt aaaataaactatattcagctcTGCTCACAggtctactctaccatttttgt tttgatttaactttctattttaatgaccatccaggtcattcatttgaggg ctatgcatgttagcctccactgatgcaattTACCCACTCTCACTGTACCT CTTTGTACCTATTTTTGGCTTTTGCTTGAACAGCTCATCCAACTCGTTGA GTCCGATGCTTCGACATTTCCTTGAGGCTGTTGGAGTCAGCTTGCCTAAG GTTAAGATAGTGGGCAAGCAGAGGTTCATCCGGAACAGTTGTGAAGAAGG TGTCTAAGTattttttgaatacttctttggGGCAGTTTGTCAAATCTCTT ATTGGTCTGGGAAGGGTGTTGAATAATCGAGGGCCTTCTTGGGAAAGACT TCCCCTCCAGATATCTTTGTGTTAAACGCTGACAGCTTTGAGAACGCAAA TTCTCCCCAATCTTGCCAATCTCTGACTTTATCTCGTATGACATTTAATT AANtccagatatttttgtgtttgatattgacagcttttagaTTGCAAATT CTCCCCAATCTCTGATTTATATGGCAGGAAATGCCTCCTTTACTTTTGTC ATTTAATCAAAATTCGGGACGTTGCCTTCAATGACGTACCAGGTATAAAT TATTTGATACCGCTCTCTCCGTCTTTCAAGGCTATACAAttttaatgatt tgagtttttccCAATAATTAAGATGTCTGAGGGATGGAATTCCATGTAAA AATGATTTCTGAACTTCTTCCAGTTGCTGGAAAAAAGACCACGCTTCCAG GGAGACCAGAGTTGAGAACAGTAGTCCAAATGAGGGATGGCTAGTGCTTT CCATAAAGTTAACATGGTTTCAATTTTCCTTGATTTGAATGTGCGATATA TCCATGCacttatattttttacttttttgatttgttcttgGATATGTTTC TCATAAGTCAACTGAGTGTCTAGGGTGGCTCCAACTCTTTAACTTTGTCT TTATTTTCGATCAACGTTGCTGTGTCAGAAAAATAGCGAGAACTTTGCTT CAGAGCGTCGTTTTTCCCGTAGGCAAGGTGCTCAAATTTAAGACCATTCA GCTGCATGTTGTTGTCTTCTGTCCACTTATAGACAGTGTCTAGATCATTT TGTAGATGATAAACATCCTCCAGTTAGGATATTTCTTTCGTCAAACGGGT GTCGTCAGCAAACAATGCCAAAATAGAATGAAGGATGTTGTTATCAATAT CTTGAATCATGATCAGGAACAATAGCGGTCCCAGCACAGATCCTTGCGGC ACACCTGAAATAATAACTGTTTCTGAGGACAAGGTTGAGTTTACTGAAAC TCTCTGTTTTCGATGAGCCAAAAAGGATCTGATCCATTCAAGGAGTTTAC CGTTTATGCCATTTTCTGAAGCTTGTGTTACAAAATGGTATGGTCTACTC TATCAAAAGCTTTACTGAAGTCTAAATAGATAACGTCAATGTTGTTTCCA TTCTCTAGGTAATGGATCAGTCTTTCAGTGTGTTGAAGTAATtgatttca ttcattcattcctgCTTAGCATCTACTAATCTCTTGCATTATTTCTGAGG TTTACTCAATACTAGGAaggagttttattttattttattttgtatatcaa taaaaatttttacctagcacattaattcatttttcatatcactTTTCTTA TTAAGTACTATAGCCTTAGTCCCTTTGTTTAACTCTTGCTCTAGTATTTA TATTCTTTCCCTTAATTCTAATAAAACTTGTACATTATaacaataatatt tattttaaattttaaattttatatgtgGCGAATATAGGCCTAATGCTACT TAATTAATTTGGTAAAAACATTGTGGCAAATAtggcaattttgaaaaata agatccAACAACGGTATCATTATTTAGTTGACAATATATATATTTCGATC AATTTGATCATCATCAggtctaaaatcaaaaataaaaagNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNtttatttttgattttagaccTGATGATGA TCAAATTGATCGAAATATATATATTGTCAACTAAATAATGATACCGTTGT Tggatcttatttttcaaaattgctacttaattaaatagatagatagatag attgaCTAAGACATGAGCGGCCTTTCCTAAAGCCATGTTGATTATTGTTA TACAGATTGTTTTCTTCTAGATGATTCTGTATCTTGGCTCgtacaatctt ttcaaagaccTTAGAAACGTGGGATGTGAGGGCAACGGGTCTAGTTTTCA GCAAGTCCTTGATTCCCTTTCTTGGAAACTGGGGATATATGTccagtttt taaaagttttggagtGAGGTAAGGCAATGTTATCTTTAGTTTTTAGCAGA AGAATAGCTGGAAAACCATCAGGTCCAGGTGCTGAAGTTGGTGACAGTGT ACCAATTTCTTTGACAAAGTCCTCGATAGTCAGATTGATATCTTCAAGTG TTGGTATTTGTGACTCAAGCGGATGAAGGTCGTAGTTTTGAAGAGGTTGG GTGAAGACAgacttttgtacaattattgtcacttttttcttattttcatc tgatgttaatcattaggtaggtccattcagcatgttgcttgtttacttTT CTACTGATTCCGACTGATTCAGCATTGcattgttgaaaaaattgcctttt ttgGCAACAataattgttatttttatcTTAAATACCCAACTGTTTTATGC CCTCTGACAGCTGAAAATTAGGCTAGGCTAGACTtacctcttttctcttt tctattCTAACAATAAAATGCTTACATAGTTGACACATAATCACATAATG CACATTGACCAAAGTATTCCCCATGCAatgtttatatcaaaatctgcaat aaaaacaaaagttgtTTCCTTCTCAGCAGCTTCCTTAATTCGCTCTATCG GAacgtcttttttttaatttcagccAATAAGATTGCCGAGTATGATGAAG GTTAAGAACCGGCCCTTTTTGgcgctacatgttttttttataagcattgc gcttataagcatatctaggctcatatatggcaaaattttaaacatatgCT AAACATTTCTTTGagccttcattttcagaatttgtttgtttttggctgga ttttcgaaatttctctaaaattttgcttaggatataagcattcCTCAAAG CATTTTTAAGCTTTGTAAATCTCTTGATCTAAGCATTTCCGAGCCAGCTT TGGgctttttgtatgcttataaaaaaacatgtaatggcTTTTCAGCGCCT TGGACGACAAGCAGTTGTATAACCTTATTAATTTTagggaaattttttaa attaacaATTTCTAAAAACTTATAAAACTACTCTTGGGTAACTAATAGCC AGTCTGAGACAGAATGTTTGAAACAGTCCGTGGGTGAACCCTTGTtaaca gactttctgaactttggaaacccaggcagaaaCGCAttatcaacttacca taaaaactctttaacATAATgttgggtttccaaagttcagaaagtctgtt aACAAGGGTTCACCCACGGACTGTTTCAAACATTCTGtctcagactaatc tacctgcaccaagctctataataaGGTGATTTTTGTTTGTTATAAAATGT TGaacttggattcccaggctaacttTTCATTTAAATCACAAAGCTGACTG ACCGTGATTGTTATAATAATTATACACCAATTATTGGTGTTCCATTATTC GAAAAATTGATCAACTATCTCGTGTGACAAacaaaatattctttgaagTC ACCTTACTTAGTTTTCTCTTCAAGACAATTTTATAAACTtaattataatt attttcattttgaataagtGTGAAATTGAGATTCTCAAGGGGAGCTTATG TTTTGCTGTTTCTTTCTCGAAAAATCTTTACGCATATAGGGGACATTAAA AaaggagtctgctaaatgacgtggCCTGCATACCCACGTGCCTAATTTTT TCACTTGCCTGCGTGCCCTCGTGCCCTCTGAAATTTCGCGTGTCCACGTG GCCTCTAAAATTTCATGTGCCCACGTGCCCTCTAAAATTTTGTGTGCCct taaatttttttagtttttggtaTTTCTATTATGTGGTATTATTCTATTTC CTCTTGAATAAACTCTTGATCTAATCAAGGTCATTAGGCTAGTACACAGT TTATAAATGATAGAAGATTGCTCAAAAATAGACCTTTCCCGAAACCCACT TAAAAATTAGCTTctgtaaaatgtaaattttgattaATCTAATATGACGG TTCAGTTTGTTTTCGTCTAATGACAAAACccctgaaaatttttgttacat ttAATCTACTAGATTAAAAGatatttcactttcgttttctataaAATTCT TCTTATTTTGTAAGCTTCTGATGATTTCCCATACCCCGCCTTGTTTTCAT gtaaacttgatttttttaaacctttattgTGAAGCAATGAGAAATTCTTT TAACTTTAACTGGTATTGAAAGTGTCGGACTTGTGAGATGTACCCTAAAT GAGGGCATCAAAAATGGTTTAAGTGGCATTGgttactaaaataccaaaat agaTGGTATAAAGTGCAAGAAAATTTTCCCTTTGAAGTAACACTTTCgaa gtcaaattttttttcaaaaaatatttctcaaataGTATCATAGTATCAAT TTGACATTTTGAGGAAAGTTGGTCTCTTCATAAAAATATGGCTTTCTTTA TGCAGTGTTGCAACTTTCCCGTCTGTAGACGGATATCCGTCCAGTTGAGA TACAAATATATCATTTCCGTCTTGCCAGTAAGAGGGTTTTTGGTTTAAAT GACCATCTAATCCTAAGGTTTCCGTCTATATTCACAAAACCTAGTTGCAA CACTGCTTATgacaaaatatctcaaaaaattTTAGTTTAGTACATTGTAt agtaaaaacattttctcataATTGAGGCAGGTGTACTTGAAAATTCTTTC GATCATCACTATTTGTCTGAGATGGNATAATTGAGGCAGGTGTacttgaa aattcttttgatcATCACTAtttgtctgagattttagtattGACCTCCTC TTGCTTGACTTTTGGCAACCAACTAAAGACTGTCTTGGCAACTTGTTTTT CGAAGAGTTTACaactcctttgttttttttcttgtagagaaaaaaaaaaa taataattatgaaTTGTAATATTGTATTGAAAACTGCAAGAAATATTGTG CTTCGAAAAACATGCTGTCAACATGTCAGATTTCTTTCAAATGAGGTATG AACCTTGTTTCATCTAATGCTTATAAATCATTGGGACTTCACCCGCAATG CTCTGCTCAAAAACTCTCTTATTTATAGGAATTTTAATATGCGATTTCAT TCTTTAGATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCACAAC TGGGAGGGAATAATactaaaaagaaatttgtcctCAAAACACCAAAAGTA AGTTTGAAACAATCTCAATCTGTACAACTATGATTACGTGTTTACCTATT ATCTCCAAAACAAAATTATAGATTTTCTAGGATGTCAGCATATGTAGACC ACATCAATTCTTTCTCTATCAATTCTTCAGGGAACACGAGATTATGGGCC AAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatcacAGAGACAT TTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAG GTAATTTCACTTGAACTGTACGCTTGGAATTAATTTCTTAAAAGTTTTGG TTCTTATATTAACTTGTTAATTTAAATGCTCTAGTAAAGTATATTTCTTT TGAAGTGAACTTCTTACTACGTTTTTCTTCCATAGGAAACACTCACAGGA AAATATGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAAGGAGG AGAGATACTTGCACTGCGTTATGATTTGACGGTATAGTTCTTGCCTTGAT TTACCAAAACATTGAGACTAGCAAGTTTTCCATTTTCGAATATAACCCTA TGAATGAAATAGAAATGACTCATATTCAAGCTCTTCTTCACAAGAAAAAG ACCGCAAAATACAATTTGTAGCCGTTAGGCACCATTCCATGTCTGATAAG TCTTGTTTCCCTTGTGGTGGTTTTTAACATGCGTCTCCATTATCCAACTA ATGAAACCTTTCGTGTGCGATTAACAGGTACCATTTGCACGGTATGTTGC AATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCACGTGTATACA GAAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAATTCTACCAA TGTGTAAGTAAAACAAGCTATGTACCTTGGTCTgttatttcatattttac taTTTTGGTTTTTACCTtatctttcaattttgaaatgacAAATGATTTAT TCTAAATTATAACAGCTACAACATGgctcgcaccccccccccccccNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNaaatgaagacattctattgcattctctaaaagtgca cacacatgtaaatagagctttgtgaatgccataaaacttttcccctatac tgggacctaaaattttattagaCTGGGGGAaccttgttctcaggggggac ctagaaccccagtcggagccatgtACAATGTGATGACaccatcaaaatat tttctggaCAACTCGTATATTTCGTTTTGCTCTGTTTTAGGATTACGATG TAGCAGGACAATACGACCCACTTATACCTGATGCTGAATGTGTCAAAATT GTagctgaaattttattgaaacttgAACTTGGCGATTTTGTTATTAAGGT ATTTCTATTCAACTAAGATTAATGTGAACAACCTAGCATTTAAGTATGTC ACTTAATTTTTTAGTACCACACGGGTACAATAAGGATTTTTTAATATACC ACCACATCAATGAACGTTACTGAAactgagattttagtactgaTTTAGAG TAGTTAGTTCTTTTCTACAACTTATTACTTCAGGTCAATCACCGCAAAGT ATTGGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTA CCATCTGTTCATCAGTCGACAAACTGGATAAAGTATGTATAATGCTATGT TTACCAATGATACTGGTTATATTATAACAAATGTGACTCGAATAAATGCT GCTTAGTACATCATTCCTAACATTTGTCACTCGCAAATAGTTCTCTGTCT CTTCGCTTTAAAGCCAGTGCTTAAAAAGGACACATAAATTCAGTCCCGAT CACAATTTAGATTcaaccttttttatttgatttttgcaGACACCATGGGA AGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAG CTGACAAGATATACGAATATGTCCAATATAAAGGTAATTGAGGTACCTAT CTGGAATCTGAAAATctaaatcactgaaaaaagtTCCAGTCTAGTCCTCT AAGATATAAAGTTCTCTCTTGCTTTCCTTTCCAGGTGGTCCTGAACTGAT AGAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAG AGGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGA TGTTTACAAAATGTGAGTCTTTTTATCTTCTTCACCTTTATTGAGTTTTC TAAAGAATAACATTCAGTCCTTATCAATTCTGGCAATGACATTGAACTGT GGTTATTTTCTCCAAAGGTTTCGTTTGATTTGAGCTTGGCACGTGGTTTG GACTATTACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGCCCAA AGAACTCATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAAGAAG GTAGTTGTCACACTAATTCAATTGATCTCGTTTTCAGGATTTATTGTCTT GAGGCTGTTAATACTTGTAAATTCAACAACTTAAACAAGAGTCAAATAAT TATCAGCTCTATTTTGAATATTGATCGTTACTTTCTATCCTTCTAGTCTT TATTGcctcatcaaccatttcttttCTACAGGTGAAGATGAACAAGTTGG CGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCATGT TCGATTCAAAGGGGAAAAAAGTAAGAGTCATTTTTGCTAAGTTTCAAAGA TAGCTAGCTAACTACTTAAATTGTAACAATCTTCATTTGGACTCTTCCAA ACTTGAAAATGCATCTGACTAAAACCTCTGTAATATTCCTGGTGATTGCA CTTGGAGAGAATTTGGTTTGTCTATTCTAATGCTAAACTGTGATCTTAAC TCAACACTTACTCGTCATGTCTCCACTCAGTGATGTCTTAACCTGTGTTC GAGtgtaaatttcttaaaatcttgCAAACGAACTGGTGATCTTAAAGATT CAACGCCAAATATTTTGATTCATTTAGAGCACTTTTAAGATTCTGCCTTC TTGGTTGGTTATCGACCGCCGAAGGCGGTTAATTTTCCGAGCTGTATACG GGTAAAAaagttggattcaaaatttgtcacaactgtgctatccttttgaa tattttaaaatttgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTAGGGAGATAAatgttaagtaaataaaaaaactta aagtatttatcagcttctgattcaaaccacaagtgattaaacAACTCAAA ATATACTATACTAGCTCATCGAAATTAGAGACTCTGTATGGCATCTTACA tatgtttttgtttataagcatacaagaatcagaaaacaggctcagagatg cttaggttcaaagcttaataaggctgataAATGCCTGAGCGGATGCCTAA AAGCTAAAACacaaatttagggaaatactgaaaatccgcaaaattccagc caaaatcaggaaaaaaacatttttcgtaggctcaagtaatgtttgccata tgcttaacttttccccatatctgagcctagatatgtgcaatgcttataaa aaatatccatattttcaagttaaatcacgAAAACGAGAGTGTCGAAGTGG ATCATTGTCTAAACCGatgaattcttcatcaaatttaaggCGGTCGTTAT CCAGTGATGTGAGCACTGTTCTAGTATCTAAATCACTTCTGATTTCCACA GGAGCTTTCATGTTTTGATAGTTGACATCGTTATTAATTctgttcttaaa ttttattttgaatcttcatcttttaagaaaaaaacatctAAAAGTACATT ATGTGTAATACTGTTCTTAAGAATTAGTTGACTACTCCAAAAAATTAGTA ATTGTCTTGAATACAACCGCCAATTTCTTTAATGATGTTTTCCACTGATT TGCAAAGGTTTTTTGTTTCGCTTGAATTCATCACAATGAATTCAAAGCTG TGTTTACAATTTTATTGTAAAATAATATAAATCGATAAAAACATACGTTG TTTATCGATATAAATGAAcgagagctttcaaaaagcgtCTTCACTCTTCA GAAACTTGTTCCTATCTGATTTGTTAATTAAAAGGCTagtgaattttata ttttttctgacgtcaaatatatttgtaaaatatactACGTCGATTCAACT cgtcaaaataattattttgtcaCGTGACACGTAATGTTAGCTTCGGTTAT GGAAGGAGTGTTCAGGGAGAACAATCCCACCAAGCNCACTCAGTGATGTC TTAACCTGTGCTCGAGTGTAAATTTCTTCAAATCTTGCAAACGAACTGGT GATCTTAAAGATTCAACGCCAAATATTTTGATTCATTTAGAGCACTTTTA AGATTCTGCCTTCTTGGTTGGTTATATCTAGAAATCACTTCTGATTTCCA CAGGAGCTTTCATGTTTTGATAGTTGACATCGTTATTAATTCTGAAAAAA ACATCTAAAAGTACATTATGTGTAATACTGTTCTGAAGAATTCGTTGACA ACCGCCAATTTCTTTAATGATGTTTTCCACTGACTtgcaaagatttttta tttcgctTGAATCCATCGCAGTGAATTCAAAGCTGTGTTTACaattttat tgtaaaatattataaatCGATAAAAACATACGTTATTTATCGATATAAAT GAAtgagagctttcaaaaagcgtCTTCACTCTTCAGGAACTTGTTCCTAA CTGATTTGTTAATTAAAAGGCTAGTGAATTTTATATcttttctgacgtca aatatatttgtaaaatatactACGTCGATTCAATTcgtcaaaataattat tttgtcaCGTGACACGTAATGTTAGCTTCGGTTATGGAAGGAGTGTTCAG GGAGAACAATCCCACCAAGCtgtcaaattttctcaaatttccgtCATACC TTAAAAACGAAATTCCACCGCAATTGTATCGAATGTTAGGATTTCAAACG TAATGGCTTGAAGTCACTTATCTCTTACACAAGTTGCGCAGCCAGTGTGG TTTTCGCGTAAGTAACGTTCACCGCCAAATTCTTCGAGCAAATGCCAGGC AAAAAGGCTGAGTCTTTTGCCTATATGATATTATAGATTTTCTTTATATC GTGTTTATTTAGGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACGTAT TTTTTCGATCATGGAAAAGAAGCAAGAGGTGAGTTAGAATGAAATATTCA TCAATTTGTCTGAAATGTTAAGCCTTGTGATGATTCAGAATGCTATTAAG CTAACTTGTCCCACAAAATGGGATTGGACGTGTAATGCGTATTTCACTTC GCAACGGGGTGCTCGAAATAAATGGATTAGAAGAGATCCACCTCATAATG ACTTCAACTTTCAACGGATTATTTCTCTCCTTATCTCTAAACACTATTGT CTACCAAGGATTAACCATTAAGTTTAAAATCTTAATTGACTTTACTAATG GTTTATGTGAACTTTTCTaaacaaaacagtttttcaaaTGACGAATCATC AGCTGATTAAATTCTTTATCTAATCCTAACTAAACGATTTGAAGTATGAC TCTaattttctcaactttttaCACACCTCGGAATGCCTTTGTAGATTCGG CAATGTAATTTGCTtggtattttaaaaatgtcacCCGAGAATGAATCTAG GTATTTTATCGTCTCTTTGATCTCATCCATCGTTTCTAACTGATACATCt tcattttttgtgttttagtTATCGGAAGAGAAAGCTCGaattacgaaaac gaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGATTGA AATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGTAAAAATACCCTCT ACCACCTACTCTCCCTCCCCCAAATAAGCAATGCGCAGTTTCAAGTGCCG TTCCAGGTCAATTTTTTCCCtaaaacaaattcaacaaaaccTTCAACCAA AGGGAATTTTGGATAAATCACTACATGGTCATGAGGTCTCCATTACTTTC AAGTTTGCTTAGAGAATTTAAATTATTGACCAATGAAATTGGTGCGTGTC TCGATTTAACATGTTATCGACTCTTAGTATCGTTTTCTTTGCAGGCAGAA GTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTGTGA AGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGGAAA AGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAACAGGTATAAATG CATTGCCTCTGACTAACTAATTTTTGGAAGAAATGGTAAATTCATTCTTT TCTGTTCTGCACTTCACGCCATCCTTCTGTCCTTATTATGTGTTACCCTT TGAATCAAATTTGAACACTTTAATGGGCTTAATTTTCGCGGAGACTAAAT CTCGCGGATTCCGCGGATTTGGGCGAACAtaaatcccaatggaaatttga aaagttgATAAGGTTCTCCCTgcgaaacctttttaaattaaattccaata aatgtcaaaaaacaattttaacatGTTTACCGCCATCAAAAAAGGGCTAA TAATGCGTTCCTTTATATTTATAGAATGAAGTCAAACGTGACGAACTTGC TGAAGAAATTCGAAAACTTTGCGTCGAATAGATcaaccaaaattgaaatt agatttttttatgcagtttttttaaatgaaaaaatatttatttagatATG ATTTAATTA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000579XLOC_000579Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000995-exon-sc0000007-1491911889:405053..405238TCONS_00000995-exon-sc0000007-1491911889:405053..405238Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:405053..405238TCONS_00000995-exon-sc0000007-1510915933:405053..405238Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:405053..405238TCONS_00000995-exon-sc0000007-1575043694:405053..405238Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:414410..414499TCONS_00000995-exon-sc0000007-1491911889:414410..414499Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:414410..414499TCONS_00000995-exon-sc0000007-1510915933:414410..414499Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:414410..414499TCONS_00000995-exon-sc0000007-1575043694:414410..414499Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:414633..414752TCONS_00000995-exon-sc0000007-1491911889:414633..414752Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:414633..414752TCONS_00000995-exon-sc0000007-1510915933:414633..414752Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:414633..414752TCONS_00000995-exon-sc0000007-1575043694:414633..414752Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:414888..415355TCONS_00000995-exon-sc0000007-1491911889:414888..415355Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:414888..415355TCONS_00000995-exon-sc0000007-1510915933:414888..415355Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:414888..415355TCONS_00000995-exon-sc0000007-1575043694:414888..415355Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:416093..416200TCONS_00000995-exon-sc0000007-1491911889:416093..416200Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:416093..416200TCONS_00000995-exon-sc0000007-1510915933:416093..416200Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:416093..416200TCONS_00000995-exon-sc0000007-1575043694:416093..416200Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:416386..416484TCONS_00000995-exon-sc0000007-1491911889:416386..416484Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:416386..416484TCONS_00000995-exon-sc0000007-1510915933:416386..416484Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:416386..416484TCONS_00000995-exon-sc0000007-1575043694:416386..416484Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:416692..416785TCONS_00000995-exon-sc0000007-1491911889:416692..416785Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:416692..416785TCONS_00000995-exon-sc0000007-1510915933:416692..416785Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:416692..416785TCONS_00000995-exon-sc0000007-1575043694:416692..416785Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:416887..417014TCONS_00000995-exon-sc0000007-1491911889:416887..417014Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:416887..417014TCONS_00000995-exon-sc0000007-1510915933:416887..417014Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:416887..417014TCONS_00000995-exon-sc0000007-1575043694:416887..417014Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:417120..417252TCONS_00000995-exon-sc0000007-1491911889:417120..417252Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:417120..417252TCONS_00000995-exon-sc0000007-1510915933:417120..417252Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:417120..417252TCONS_00000995-exon-sc0000007-1575043694:417120..417252Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:417434..417522TCONS_00000995-exon-sc0000007-1491911889:417434..417522Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:417434..417522TCONS_00000995-exon-sc0000007-1510915933:417434..417522Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:417434..417522TCONS_00000995-exon-sc0000007-1575043694:417434..417522Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:421765..421830TCONS_00000995-exon-sc0000007-1491911889:421765..421830Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:421765..421830TCONS_00000995-exon-sc0000007-1510915933:421765..421830Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:421765..421830TCONS_00000995-exon-sc0000007-1575043694:421765..421830Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:422371..422487TCONS_00000995-exon-sc0000007-1491911889:422371..422487Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:422371..422487TCONS_00000995-exon-sc0000007-1510915933:422371..422487Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:422371..422487TCONS_00000995-exon-sc0000007-1575043694:422371..422487Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:422747..422893TCONS_00000995-exon-sc0000007-1491911889:422747..422893Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:422747..422893TCONS_00000995-exon-sc0000007-1510915933:422747..422893Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:422747..422893TCONS_00000995-exon-sc0000007-1575043694:422747..422893Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1491911889:423227..423361TCONS_00000995-exon-sc0000007-1491911889:423227..423361Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1510915933:423227..423361TCONS_00000995-exon-sc0000007-1510915933:423227..423361Clytia hemisphaericaexon
TCONS_00000995-exon-sc0000007-1575043694:423227..423361TCONS_00000995-exon-sc0000007-1575043694:423227..423361Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:405053..423361 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 0 1.09525 0 0.36527 0.36821 0 0 0 0 0.639902 0.554288 0.515338 0 0 0 0 0.39063 0.35423 0 0 0 0 0.748548 0
Blast
BLAST of TCONS_00000995 vs. Swiss-Prot (Human)
Match: SYHC (Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2)

HSP 1 Score: 504.212 bits (1297), Expect = 1.020e-171
Identity = 244/394 (61.93%), Postives = 308/394 (78.17%), Query Frame = 1
Query:  730 D*QVPFARYVAMNKVEKIKRYHIARVYRRDNPAMTRGRYREFYQCDYDVAGQYDPLIPDAECVKIVAEILLKLELGDFVIKVNHRKVLDGIFAISGVPECQFRTICSSVDKLDKTPWEEVRNEMVKEKGLSEDIADKIYEYVQYKGGPELIEKLLNDEKFTNNKSAKEGVEDMKLLFKYCELFGCLQNVSFDLSLARGLDYYTGVIYEAVLTGLPKELMNXXXXXXXXXXXXXXXXQVGVGSVAGGGRYDDLVGMFDSKGKKVPCVGVSLGIERIFSIMEKKQELSEEKARITKTKVLVVSGQKKMLEERLKLVNELWSQNIEAEVTFKANPKLLNQFQYCEDNAIPLCAVIGDSELEKGVVMLRNMKTREQNEVKRDELAEEIRK-----LCV 1896
            D  VPFARY+AMNK+  IKRYHIA+VYRRDNPAMTRGRYREFYQCD+D+AG +DP+IPDAEC+KI+ EIL  L++GDF++KVN R++LDG+FAI GV + +FRTICSSVDKLDK  WEEV+NEMV EKGL+ ++AD+I +YVQ  GG  L+E+LL D K + NK A EG+ D+KLLF+Y  LFG    +SFDLSLARGLDYYTGVIYEAVL   P +                 +E +GVGSVA GGRYD LVGMFD KG+KVPCVG+S+G+ERIFSI+E++ E  EEK R T+T+VLV S QKK+LEERLKLV+ELW   I+AE+ +K NPKLLNQ QYCE+  IPL A+IG+ EL+ GV+ LR++ +RE+ +V+R++L EEI++     LC+
Sbjct:  130 DLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQ---------------AGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCI 508          

HSP 2 Score: 177.948 bits (450), Expect = 3.750e-48
Identity = 92/137 (67.15%), Postives = 110/137 (80.29%), Query Frame = 1
Query:   91 KRVALQEKIKEQGEVVRKLKSSKDQTDEIKQQIKDEVAKLLELKAQLGGNNTKKKFVLKTPKGTRDYGPKQMAIREKVFKIITETFQKHGAVEINTPVMELKETLTGKYGEDSKLIYDLKDQGGEILALRYDLTV*F 501
            +R AL+E +K QGE VR LK  K       + I++EVAKLL+LKAQLG + +K+KFVLKTPKGTRDY P+QMA+REKVF +I   F++HGA  I+TPV ELKETL GKYGEDSKLIYDLKDQGGE+L+LRYDLTV F
Sbjct:    3 ERAALEELVKLQGERVRGLKQQKASA----ELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPF 135          
The following BLAST results are available for this feature:
BLAST of TCONS_00000995 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SYHC1.020e-17161.93Histidine--tRNA ligase, cytoplasmic OS=Homo sapien... [more]
back to top