Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000991 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000991
Unique NameTCONS_00000991
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3241

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000991 ID=TCONS_00000991|Name=TCONS_00000991|organism=Clytia hemisphaerica|type=transcript|length=3241bp
gaaaattaagAACTTTCACTTTTTGCCGCGCCGAGTTTTCAAAGTCCGGG
AATTTTCTGTATCGTGGCGCAATACTAAGGAGGTAAAAATGTTTCGGGAA
ATTACCTTGAATATTCATGTTACCTCTCTAATACTGTACTCATACACCGC
CATGTCGAAACTGATGGACGCAAAATTATGGGAGTTGGATGTTGCCAGTC
GTGTGTAAAAGAACTGAGATTTTTATAGAATAGAAAGGAAACTTTACTAC
TAATGAATTTCGTGGTTTATGATAAGGTATATTGTACGGAGATTTGGTAA
TGAAGATTTAGAATAGAGATTTTATTTTGTCGAAAATAGAACTGAAGCAA
CAATGGGTAGCTGTTGTGGGAAGCCAAAGCAGCCTCCCTCACACACCAAT
AATACTCAAACTCAAATGACACCCCTGGCAAATAACCAGATGCAAGCAAA
GCCTCCAGCAGACTCTCCCTTTCCACCGCCTGCTCAACCTCTCCCTAACA
ACCCTTTGCCAGGAGCTGGGGGTGCTACGATATTTCAAGCACTTTATGAT
TATGATGCAAGGATTAGTGAAGATCTAAGTTTCAAGAAATCTGAAAGACT
TCAAATCATAAACACTGCAGATGGTGATTGGTGGTATGCACGTTCTCTGG
TCACCAACAAAGAAGGATACATTCCTAGCACCTATGTTGCTCCTGAAAAA
AGTTATGAAGCTGAAGActgGTATTTTGGAGAAGTCAAACGTGCTGAAGC
TGAAAAGAGGCTAATGATGAAAGGATTACCAACAGGGACATACTTGATCC
GAAAAGCTGAATCAGCACCAGGAAATTTCTCACTCAGTGTACGCGATGGG
GACTCGGTAAAGCATTATAGGATAAGAAAGCTTGATACTGGTGGTTACTT
CATTACAAGTCGAGCTCCGTTTTCCAGTTTACATGAGCTTGTACAGCACT
ATTCTAAAGATGCTGATGGTTTGGTTTGTGCATTAACTATTGCTTGTCCA
AATGATAAACCTGTAACAGGAGGCTTAGCAAAAGATGCTTGGGAAATTCC
AAGAGAATCGTTAAGGCTAACAAGGAAGCTTGGTGCTGGTCAGTTTGGAG
AAGTTTGGGCAGGAGTATGGAACAATACGACACAAGTTGCCGTCAAAACG
CTTCGTCAAGGAACTATGTCTCCATCAGCTTTCTTAACTGAAGCTGGTAT
AATGAAGAACCTTAGGCATAAGCATTTAGTCCAGcttTATGCCATCTGTT
CGGACAAGGAACCCATCTATATTGTTACTGAGTATATGACGTGTGGGTCG
TTACTGGATTACTTAGCTAGAGGTGATGGAGCAAATCTACAACTCCCCAC
ACTCATTGATATGTCTGCTCAAGTTGCTGCTGGTATGGCATACCTTGAAA
CACAAGGATATATTCATCGTGATTTAGCTGCCCGTAATATTTTAGTTGGT
GAAAATTATGTTTGTAAAGTAGCAGATTTTGGTTTAGCTCGTTTAATCGA
GGATGATGAATACACAGCTCACGAAGGCGCTAAATTCCCTATCAAGTGGA
CTGCTCCAGAAGCAGCTCTTTATAATACCTTTACAATCAAATCGGACGTT
TGGTCTTTCGGTATCCTTCTTACTGAGATAGTTACGAAAGGTCGCATACC
ATATCCAGGTATGTCAAATGCAGAGACAATTGCCCAAGTTGAAAGGGGTT
ACAGGATGCCCATGCCACCAAATTGCCCCGAACCACTTTATCAAATTATG
TTACAANTTAATAAATAAAGAGATGTAATTGTATATGAAATTACATAGAA
TGGCACTTGTTACTTTTATTAGTAAGAatattattttactttttctaatg
ATTCGTTCTTTCCAACTTTTTTCCTTACTGACTAGGGCCAGCCTAAACAG
TTACTTcagttaaaattctactttccaCTGACTTAAGTGGTATTAATAAA
ATGATTATTTACAATACGTTTGAATTACTACTATAACATTTTCCAAGAGT
TGaaacttcttttcttttttggtgGTACCAGTTTCTTGTGGCATTGTCTC
AAACATCCATTGAATTCTGGCCAGCAGTCTTTAAATTCATCAATTGATCT
CGAGCCTCCTAGACAATTTATCTTTTCTGATTTACAATTTGTTTCGCAAG
CTTGGAATTGATCATAAGTGTAGTAAGTTTTACAGTTTATTTGTGCCACC
AATAATACCATCACCATACTACACAGTAACAATAAGAAGTTCTGCATGGT
GTTCCTAAAGAAAAAACTTCATTATGATGaaatttgcttttatttttcta
cagagttaaaaatgaaaataatacagCTTGTAATAACCAAGAAGAAGTGT
GAAAGATAAAGCCAAGTCATAGAAAataaaagaaaaatgtcGAGCTCTGA
AGATGAAGATATAAATGAACAGCAACTGAAAATCACATTGGTTGGAGATG
GTACGGCTGGTAAAACTTCTCTTTGTACGCGGCTTGCTcaagaaaatttt
gacaaaCAATACAAACAGACTATGGGTTTGGACTTCTTCATGAAACGCTT
TTCTTTACCTGGAAATACAAATGTCACATTACAAGTTTGGGACATTGGGG
GACAGCAGATTGGTGGTAAAATGTTAGATACATATCTGTATGGGGCCAAT
GGAATTCTGTTGGTCTATGATGTCACTAATCAtaatagttttgaaaattt
acaagaCTGGTTAGAGGTCATTAAACAAACTTATGCCAAAAGTGAAAAGA
AACCATACCTTGGTTTGATTGGAAATAAAAAAGACTTGGAGCATTTGCGC
ACAgttaaaagagaaaaacatgTTGAATTTGCCCAAGAAAATGGGATGGC
AAACTTCTTTTTATCTGCAAAATCAGGTGATCaagtgaatttttgttttc
aaaaaattgcagCTGATATATTGGGGATCAGATTGTCAAAACAAGAGGTT
GAGCAATCTAATCGGGTGATTAAAGCAGACATTGTAAATTACAAAGAGAT
GGCCACACCTGCACTGCACACTGGATCGAGTCATACCAAGAGCTCACTTT
GTTCTattcaatgaatttttattacttcaaaaaactaaaaactataTATC
AGAGTGTGTTtaaattttaatcttttttaacTCAAGCACATCTTAATTTA
TTGATTTTAGCATTTTATTTCTTCTAGAAATGacaaatatttatttattt
tcaaccAGATTGATTAAAAGACACATATTCGCTTCAAACAT
Run BLAST on NCBI

protein sequence of TCONS_00000991-protein

>TCONS_00000991-protein ID=TCONS_00000991-protein|Name=TCONS_00000991-protein|organism=Clytia hemisphaerica|type=polypeptide|length=471bp
MGSCCGKPKQPPSHTNNTQTQMTPLANNQMQAKPPADSPFPPPAQPLPNN
PLPGAGGATIFQALYDYDARISEDLSFKKSERLQIINTADGDWWYARSLV
TNKEGYIPSTYVAPEKSYEAEDWYFGEVKRAEAEKRLMMKGLPTGTYLIR
KAESAPGNFSLSVRDGDSVKHYRIRKLDTGGYFITSRAPFSSLHELVQHY
SKDADGLVCALTIACPNDKPVTGGLAKDAWEIPRESLRLTRKLGAGQFGE
VWAGVWNNTTQVAVKTLRQGTMSPSAFLTEAGIMKNLRHKHLVQLYAICS
DKEPIYIVTEYMTCGSLLDYLARGDGANLQLPTLIDMSAQVAAGMAYLET
QGYIHRDLAARNILVGENYVCKVADFGLARLIEDDEYTAHEGAKFPIKWT
APEAALYNTFTIKSDVWSFGILLTEIVTKGRIPYPGMSNAETIAQVERGY
RMPMPPNCPEPLYQIMLQXNK
Run BLAST on NCBI

transcript from alignment at sc0000007:361577..393703+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000991 ID=TCONS_00000991|Name=TCONS_00000991|organism=Clytia hemisphaerica|type=transcript|length=32127bp|location=Sequence derived from alignment at sc0000007:361577..393703+ (Clytia hemisphaerica)
gaaaattaagAACTTTCACTTTTTGCCGCGCCGAGTTTTCAAAGTCCGGG AATTTTCTGTATCGTGGCGCAATACTAAGGAGGTAAAAATGTTTCGGGAA ATTACCTTGAATATTCATGTTACCTCTCTAATACTGTACTCATACACCGC CATGTCGAAACTGATGGACGCAAAATTATGGGAGTTGGATGTTGCCAGTC GTGTGTAAAAGAACTGAGATTTTTATAGAATAGAAAGGAAACTTTACTAC TAATGAATTTCGTGGTTTATGATAAGGTATATTGTACGGAGATTTGGTAA TGAAGATTTAGAATAGAGATTTTATTTTGTCGAAAATAGAACTGAAGCAA CAATGGGTAGCTGTTGTGGGAAGCCAAAGCAGCCTCCCTCACACACCAAT AATACTCAAACTCAAATGACACCCCTGGCAAATAACCAGATGCAAGCAAA GCCTCCAGCAGACTCTCCCTTTCCACCGCCTGCTCAACCTCTCCCTAACA ACCCTTTGCCAGGAGCTGGGGGTGCTACGATATTTCAAGCACTTTATGAT TATGATGCAAGGATTAGTGAAGATCTAAGTTTCAAGAAATCTGAAAGACT TCAAATCATAAACACTGCAGATGGTGATTGGTGGTATGCACGTTCTCTGG TCACCAACAAAGAAGGATACATTCCTAGCACCTATGTTGCTCCTGAAAAA AGTTATGAAGCTGAAGAGTAAGTAAAGTatagccagacggtgtcaatcga acgaatcgaacgccgaaacgaccctggacaccgccgtacattgtacggtg tTGTACGGTGGGGCTTGATTTAAATGTCCGGTGGGAATTAAAGGTTAACT TTGAAAACACTGTACATTTTCCCATACGGTGGGAATACGATTGCGAAAGA CAACTTCCGTGGTCAAACTTAATGtaccaaagaaagttttttcgaCTTAA AAGTTTTTCAGTAAGTCCGACCACGgttgaatatctaaaaatttGCATGC TTTCTGAAACTGAAATCAAGTTAAAATGTTTTTGGTACGGTGGTGAAATA GGTTAACTCAAAATCCACCGTACACCCCACGGTACAacaccgtacaatgt acggcggtgtcctGGGTCgtacgccgaatcaattgaacgcaattgaacat gaaatcaaataattgcaattcgattgtcaaacgcaataattatgttcgat tgatttagattttattcactTTTGTACGATactttaatagaccttttttc aaagaggacgtcctgttgaataattatgtagtcccgccataaaaacaatg atagagccatgcataattactgtatcatgcatattgtaataattatgcat ggttttatcattgtttttctgctggactacataattattcaacagggtgg actcttttgaaaaaaggtctataagtgCTCGGCcgccacgctaaaaagct ctaacagagtgatccaatttaatttaatcgcaatcaaactcatcaaacat aatcgtaatcgaaccaatggaacatagtcaactgttaatcgaaccaatct ttaaccttactcgaacgcaatcaaacacaatagaatattacccagaaaTC GGCCAattgattgagattcgattacgttggtcgtggcttcttcacaaaga cgaaagacagatagctggacttatttcgttctttccagtctcttgttcgt agttctgactttctggttctttgtgagttattttctatgttttctaactt actgaaagacttaccgtaagttggtctaatgtcgacatctgtcttctaat ttcgacatccttctttatagataggaataataagaaggtcgaaatcactg atagacttaAAGGTTTTTCCTTCATTgcgctaatcaaagtcaatcagcaa ttccgaccttcctcaatttctattgttcctatctctaaagaagggtgtcg aaattagaagacagaTGTTGACATTaaaccaacttacggtaccgacagat cgccacccgtgggattcgaacccactaaatgcaaagttccgatgttttga aaccaaatgccttatccactgcgccacagATTCATGCCAGGATAGCGCTT CTGActgctatttatattgtacaaactgcagaccagactgtattaagaaa aaatcacaaaagagtgcttgtttcgagctccaaccctaaccctaactgat aataacccaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNcccaaccctaccaggtcacctgcaggt cctgacactattcccgcataccggatccgaaaaatagatacatgtctttc gtctttatgaagaagcttTCACCGATTACGTTTGATAATCGAAtcacaat tattcgatcgcgttcgattatgtttgattggttcgattgcgatttttgtt caaagttgttcgattgacaccgtctgggtaTAGAGGGCGGCTGTGATTTT GTCTGCTGAATGTCAGATTACTTAGTGTTTAGAAAAGCCAGAcctgatca atcgaacttgtcaaaCCAATTGAACAATTGAACTCCATCAAACAATTAaa gttcgagttaaaaaatcaATCCAACTTTTAAAAAATAGTGAGTGTTCAAT TAAGTGGGGGGTTGcgatgctgaatcagcagaaaaataaaaaaagtaaat aaatgaaaattgtcgttttcggcaattattgctgtttttggaaataaaag ttgattattttattattgaacacgtggtattcgACACCCTCGCAATTAGT AGGCCCACTTTGCCtcgtttatttttgttttcaactggtttctCCCAGAA TGCAGactagcaaaatcgagtcatatgtaaacaaacttacaaCGGGGGTT CTGTTTTCTCCTTCTAGCTGTGTTTCGGCATGGATGCAGGATTATTTTAC Atcttattttaaaacttttcatgttattgagcaatgaaaaattgaaaaaa tcactttcaaaGATCTGGAAAACCTTTCCCTCAatataattttacatttt tcaaacacctctggacatctttgcccttataaGGACAGCACATTTCTGCT GAATCgacatttcatcgttaaaataATTGCTGTTTTCGGCAATAGTTggc gaaaagagcaataattgccgtTTTATCTTTTAAACACCCAACTGATAACC CAGTGGTCAgaaaatcactgatagacaaaagatttattCCTCTCTAATgg caaagcaaagaaaaatagtttcaattGGTGATTTCAACCTTCtcattatt cctatctctaaagaagggtgtcgacattagaccaacttaaggTAGGCAGC ACAGGGCAGCAAAACATCATGTTATGACTCCAAAAAATATAGCCACATGA TGACCTGATAGTAGTTCAATTTCAACTGGTTTAAATTTTCATCTTAATGT GTTTCTTAATAAGTGATGCACCATGTGCAGTTGCATTTAAAAATGAAGCT TACCAAGACCATGTcttaccgtgagatcgggtaacttgcatcagtggagg ctaacatgcatagccctcaaatgaataaccaatcaaagcagcaatcAGCC ATTTAGATTTTTTATTCCAATCTCTAAAAAGGGTGTTGAGATTAGATGAA TTATGTTGATAATAGACCATACTtactttttgatactttttgaaaagtat gtaatattgattaaaattaaaaactccagcctcaaaacaatgacatactg taccgtcaactgctctaatttGGGAAAATTGGtagaaacatgggactgtt gatatctggcctgtattttcacttactgttaaatctctttgacaaaaaat ttgttttgataactccactaagtttatcaatcatactttctgtcataacc tGTCACAAatactttcactgatagcgcggtgttcttaacttttttgtttt cattcaaaatgactggacgTCAATTGGAGATTTAGAGAATGCCCGCTGCC TAACTGCCTacccaatgggattaacaaataacaagtgtgtaacttgccgc gcgagtgacgtcaaacgctccaacgttttgccactaatttggtcttcttc cttccagacatttgcgtgtgttccactacggatttttttcatatttcgat ttaaaagcctactcggtgctaaagaaaattgtgtattttttaatacgatT TTTGTCAGAtaatcccaagttagagcagttgacagtaatGCATAATTATT CTGAATTATTACATgctagagtttttaattattcaacattaaATATttac tagcaaaaggtctatcgacaggccatttttcatgcccttttagcgtccgg tcatcggacgctgcccctcctgaaatcactaaaattttgataaaaacagc CCTTTcagcagaaaaacacaagaaaaagtgccctttttggccaccaactg acgctgccctgcctttctaaaatatcgCCTGATCGACAATCTCAATCTCT TGTAAAACACTGTATAATTTTATTCAAATGTTGAGAAAGTCTTTCACTCA ACCGGTCTGGGCTAAAGAAGGTGCTAAACaccaaaaatgcaatattttcc TTAACTATTCAAGAGTTGCAACTAATGTTGGGAAAAACTGTTAATCGCAA TTCGCGatgcatttttgctaaaaattgaaaattgatccattttaggatgc aaaatcatgcttaccaaaaaattgcagtGCATGGAAAAGTACTTTTTTCC ACCCCAAGAATGAAAAAATcccaattttcattcattttgtaAGCCTGGAA TTGTCAGTAGCCTCTGTAAATGTAAAGTGACctgattttcaagattttta gagGGTCTGCTGTCATaattgcaaattttcaacatcacCTGCCTGGTTCT TAGAGAATATGGCTCTTAAGTATTTGGTTTACCGATTTATATTGAAAGAA AGTTATTCTGTAGAGAAACTACAAAAACTAAGAGAATTAATTCTaaacaa ccccccccccccccgagatATCTTAAGTGTATATATTTTCGTGGGCACTA AATTTTCCCGTATTGCACAATTTTTTTCGAGAAATGTGTTCGCAAATCAC TAAATtgggtttttaaaaaagatgattttaaaacaagaaaaagactgCTT TTGCTCAAAACACTACATAATAAATGCAAAAATAGTGTCAAAATTGGAAG AAAATGGTGACAAAAAGAGTAAGACATTACATAAAATgtatattttgaaa gttttttgtgtgtatttaatttgtgtttttgagaaatttaaacAGTACTA AATTTTGTGAAACGTAAACACGTGAAATTTTGATATACAAGAAAATATAT ACACTAAGGTatacaaaatcacaaaatatttcAGGGGCTTGAATTTATAG GACCAAATTGAACCATGTCGCACGCAATCCCTCAAATGTGACAAAGCCCA ATTtacgaaaaattaaaattaaatNGGGGCTTGAATTTATAGGACCAAAT TGAACCATATCGCACGCAATCCCTCAAATGTGACAAAgcccaattttgaa aaatgaaaattaaattaagtttttacttattttaaataatgactttttgg tcaaaaatgtCTTCTCCCACCACTATAAATTCTTGCCAAACTTGATTTTT CTGCCATCTGCAAAACAAAATCCCCTTTACAAAACGTCCCTTGCAGCTCT TGACAAGTCATAGCTGTAAACCACAATTTCTAGCTCTATTGCCACGTACT CTAGCTCTGTTTCTATTTACAAAATGGTTGAAACCAATGGTGCCATTATG TCAAACTCaatcttattttctttttttagctgGTATTTTGGAGAAGTCAA ACGTGCTGAAGCTGAAAAGAGGCTAATGATGAAAGGATTACCAACAGGGA CATACTTGATCCGAAAAGCTGAATCAGCACCAGGAAATTTCTCACTCAGT GTACGCGATGGGGACTCGGTAAAGCATTATAGGATAAGAAAGCTTGATAC TGGTGGTTACTTCATTACAAGTCGAGCTCCGTTTTCCAGTTTACATGAGC TTGTACAGCACTATTCTAAAGATGCTGATGGTTTGGTTTGTGCATTAACT ATTGCTTGTCCAAATGATAAACCTGTAACAGGAGGCTTAGCAAAAGATGC TTGGGAAATTCCAAGAGAATCGTTAAGGCTAACAAGGAAGCTTGGTGCTG GTCAGTTTGGAGAAGTTTGGGCAGGAGTATGGAACAATACGACACAAGTT GCCGTCAAAACGCTTCGTCAAGGAACTATGTCTCCATCAGCTTTCTTAAC TGAAGCTGGTATAATGAAGAACCTTAGGCATAAGCATTTAGTCCAGGTAT GTAGAAAAGAAGATGTTGCGCAAAGCTTTTTTTGTCTAATTTGGAAAATT CATCAGAATTGAGAGGTGTAGAGACTGTGACTATGATGATAAATATAGCA CTGTACCCTTTTTGAAGGAACTTAGTGTTCTCATCAAGTTAAGTCGAGTC TGATTCTAACTAATCTACAAGAATCTTTAAActgatttatcttttttttt tatttagcttTATGCCATCTGTTCGGACAAGGAACCCATCTATATTGTTA CTGAGTATATGACGTGTGGGTCGTTACTGGATTACTTAGCTAGAGGTGAT GGAGCAAATCTACAACTCCCCACACTCATTGATATGTCTGCTCAAGTTGC TGCTGGTATGGCATACCTTGAAACACAAGGATATATTCATCGTGATTTAG CTGCCCGTAATATTTTAGTTGGTGAAAATTATGTTTGTAAAGTAGCAGAT TTTGGTTTAGCTCGTTTAATCGAGGATGATGAATACACAGCTCACGAAGG CGCTAAATTCCCTATCAAGTGGACTGCTCCAGAAGCAGCTCTTTATAATA CCTTTACAATCAAATCGGACGTTTGGTCTTTCGGTATCCTTCTTACTGAG ATAGTTACGAAAGGTCGCATACCATATCCAGGTATGTCAAATGCAGAGAC AATTGCCCAAGTTGAAAGGGGTTACAGGATGCCCATGCCACCAAATTGCC CCGAACCACTTTATCAAATTATGTTACAANTTAATAAATAAAGAGATGTA ATTGTATATGAAATTACATAGAATGGCACTTGTTACTTTTATTAGTAAGA atattattttactttttctaatgATTCGTTCTTTCCAACTTTTTTCCTTA CTGACTAGGGCCAGCCTAAACAGTTACTTcagttaaaattctactttcca CTGACTTAAGTGGTATTAATAAAATGATTATTTACAATACGTTTGAATTA CTACTATAACATTTTCCAAGAGTTGaaacttcttttcttttttggtgGTA CCAGTTTCTTGTGGCATTGTCTCAAACATCCATTGAATTCTGGCCAGCAG TCTTTAAATTCATCAATTGATCTCGAGCCTCCTAGACAATTTATCTTTTC TGATTTACAATTTGTTTCGCAAGCTTGGAATTGATCATAAGTGTAGTAAG TTTTACAGTTTATTTGTGCCACCAATAATACCATCACCATACTACACAGT AACAATAAGAAGTTCTGCATGGTGTTCCTAAAGAAAAAACTTCATTATGA TGaaatttgcttttatttttctacagagttaaaaatgaaaataatacagC TTGTAATAACCAAGAAGAAGTGTGAAAGATAAAGCCAAGTCATAGAAAGT AAGTATATACCTTTAAGTTGGTTTTGAAATTGTTTGTCTTTCCCTCCTGG TATTTCGCTtagtgttttgatttgatttcctTTTTCACACATTTTAGGCT ATATATTCGTTCAAAATATTATACATTATTTAATTTCTAGCAGTTTTTTA TTGTGTGTGGGTTCTCTTAGTCTTAGTGGGAAGTTCTTTGTACCTTTGTT GTGAGATTTACTAAAGTAAAAAATCCTTTTTGAAAGTgtaaatttttcca tttttggaGCCTATTTTCCGAGAttgggaatttaatttgtatattttatg AAGACATTTTTCGTGACGTCATTATGGAGTAATCTCCGGTTTTCAAAACA TGTTTTCCTTAGGGATATAAATAGGTGAGACGGTTGTTTATTATTCAGCG AAACTTGTAAAATCTTCCATATCTACTAAGAAACATAATTTTCATGGATA AAAAAAAGCCGGttaaaaaattagaaagaaCGTGAATTTCCGAAAACTCT TCCGTTATCGTTACGACGCGTGACTTTGGATGAACCTTATCAGTTTTGAG ATTATCCCTCTAATAATACTCGAGGCTTGAGGTCATAAGCCTTAGCCTTT TCAATCGCTTCTATTTCTTCCGTGACTGAGTCTATTCGCTGTTATAGTTC TTATTCCTACAAGATTACAATATTTATGAAGTAATGCAAGGGAATTTCAA AGTATTCAAAAGGATTTAAAAACTTTAGAGAAAATCTTAATACTTGTGCA CTTCAAAACTGCTTTATGGTTCgaatggaaaaaatgaagattttcacCGC CTTATTTACCAACATGTTTCCTGTGTGTGATATTTTAGCATGATGTCTCT GGATGTCTTGGGGATCTGCTGCCCTCTTgagattttgaaaacatttcaca CCTTCATTCCCCTCCACAAAGCATACGAAATGCCATATTTTACCAGACTG CCTGCTTACCAAAGAATCTTTAAAAATAAGCCCTCCAACcttgaaaaata tgattttgatacAACATTTATCTTGTTCCTACTACTTAAAATTCGTAAAG CTCTTGCTTGgagcatggaggtaataaaaatatagatggagatatCACTC CTACTgtattctattgtattgtatcgttgatagcaaactgttgctttgtt gctttgggaaaaagccattaattttTGCTTTCGCTCATGGGAATACTTCA GTCTGCTTCAgtcgaagagaatttgaataaaatcacgctacatttttaat ttgttcattgtgtgatgacagttctgtttataaaacataagaaaaccttg caagaataagcacagaacatcgaatttaaaatgttcgctgctcagggaat cctcggcaatttttgtcaatttttacatatttactaatgccaatctttca actatattctatcaaaattttgaggcagctgctcttttagatctaaagat atttatagcaaagaaccttccacgaacaacaaagaattcgcaaaatttga agaagtttacctctcgaaagtttcccgataaaataaaaacttcttttaaa actataaagaaattattactcgaaaaaaaattcgcatttcacctaaaaat acgaggtttcgttggacagaataactttactttagttcttataatctata tcttgactgatttttgctatcaaggattggtaatcaaaggaggNNNNNNN NNNNNNNNNNNNNNNNNNNAATCAAAGGaggccgatttgaaagaaatttc taaagagttttatgacttctctggctattacagaaaagttgttactccat ctattttttattacctctatgCTTGGAGTGAGTGCAACAAGCTGCACAAA ATATGGTCTTCAAAACTTCTTGACTCTTAAAATAAAAGTCAAGTTTTTGA TCTGCCGCTGAACCTATTCTCCTTTACGATTCAGAGACCTGATCATTGAC AAAACTATTCTATTATAAAAACAACTTGATGGAACTTATACCAGACTTTT AAGAAGTTTTAAAATCTATATCTGCGTGACCATCCTACGAAAGCTTTGAT ATGTGATTCCTTGAAATTGATCTCTCGGGTTTTGCAAGCTAGGCACGTTA AATTCGCCGGGTACTGTTTCGAGATCACATCGTTCTAGAAAACTTACTTT TTCGGACTCATTGAGGGACACCGGACTCAAAATAAGTGATCCTCCATGAG AAACTGTGACAGATGGCGTCAGAGGGTGCAATCCGTTGTCTCGACTACAG TTGAGCAATGATGGTCATGTTTCTTTTACAGTATTTTAGGACTCTTCGTG CAAAAATCACACCCTTGCAATCACTTTCAAAtctaaaacttcaaaaaagt cttATGCATATCGCATAAGGTTGTTTATCCGACCATTTTGTATTCCCACT ATATGGTAAAAATTTAGCTTTAAAATGTTTGGTGGGGTTTTCAAGCAGTA AGTTCCCTACATCGAAGAGAGCAGTGAAAAAGGCCTAggcatttttttaa aagatgggGATAAATTGGGAGTGTTTTAATAAACATCGGTAAattggaat tttgaaaattctccgAGTTAAGAAAAATAGGAACCTAAGACCACACCTAC CTAACGACTTAATTTCCATTAAATGAAGATAATTTGGAGCTGTGCCACGT AATAtatgaaaaaattgtttttccttGACTCCTGAAAAACTATTTGTTTT AAATTAAGCAACCTGGTCCCAGTctctcaaaatctttaaaattggCACAA CCAGACCAGACCATCGTAGAATAAAAAGTGACCCCCTTTTTCTAACGCAG TATTCCATTTTCTTTGCGTCTAaaccaaaatcaaaatgtaatttttcaac aaaaattacaaaaaagagaCTGGGTGcgattttcagaaaataagCTGTTA GccctaaaatcttttttcctGGCTTAAACCAAATTTTTGCcctttgattt tcaaaattgatcTTTCCGCCCTTCGCCCTTAAATTTAGAAGCTACCTTCT CATAGTTTGGATCAGGCCCAGTAGGTAGAAGAATCAGTTAACCTCAGTTT CTAATTGGTCTTTCCTAATAAAGTATCACAATAAAAGtattaaaaaatta caataaaataTTCCGAAACGCAAAAAGTAATATACACTGAAAAAATGCCT ATCAAAATAGTCTGCTAACGTCATTGGAAGTAGTAATCTTCATAATTTGT ATGCTGTCGGTAAAGTTCATCTTTCATTGTCCGTTTTCCGAGATGTTTGT CTTTGCAATCTTGGTGACATATCAGGCCAGCATTACGACAGAATTTGAAT TCGCTCTTGGTGTAAGACGTTGATAGGCATATGAAATGATCTGACGCACA CTTCATGTTGCATCGTCTTAGCTCGACATTTTTCTCTGCTTGTGTGCCGT TTATTAGCATGACCACTAGTAGAAGTGTTGCCAACATCTTCAGTATGGTT CGCGTAGATGAAGGTAGGCTGGAGAGAAGAGGTTATGTTAGAGAGTATTT CTGAGAATAGTTGATATCCGTCACACGTCCCAAGTTAAATAAGAGCGACC TGTCTGAGAGGAGATTACCTTGTTTTGTAAACAGAGAAATTTTTGGATTA CTGGCTACTCCTCTTCAAAAACTTATCCAAAAACTACTGAATAACAAGCA AGTCGCGAATCCTTCGAAATGGATTTAGGACGATTACCTGTGGTTCTAAT CAGGCCTTGTTGCGAAAAGTGTATGATAAAGATTACACTGCTTAAGCTAC GCTTCACAATTTCTAAAATTCCGTCAGCGTTAATCACATGAAATTATCAC GTAAAGTTTGAATAAATCATGATCGAAAATATTGGATTAAGATCACCTTA CCTTCGAATtatttccattgtattttccgATGTTTGATGGTTTCCTCTAA TTCAGTGATGTGTTCTCTTTGGTTTCTTAACTTTAACTGACTTCTTCCCC TATATTTATGCTAATCAATCTTGTATGAAGGGGTCCCAAATAAAGCTTTA TGTTcatgttttattattttattatatttgtattgttttcattttttcat caaaagttcTTCCTCTTCGCAATCTGCTTTGAATAAATAACGCAGTGAAT AAAAGACGTCGAACAAAGCGTTGGCATTATAACATCTTACATCTTTCTTA TCGTAGGATACGAATCGAACCCTATTGAGGCAAGGAAAATATGTTAAATT TTAATCACCATTTTTTGATTTGGTCTCCATTTTATGAATCGAAACAAGAT AGTACGAAATGACTAAGAATAACCCCACTTGAAACACCCCGATCTTGATC TCCGTCCAATATACGCCTGTTACGTCATATTACGAATAGACAGATTTTTC TGAATGGAAGAAGAGGAGAAAGAATTTTCTAGAAAGGGGCGTTGTTTTGA GGGTATCTTTTCAATCAATCTCGTTTCATCCTGTGGAAGTGTCTACTTAT TCACTCTCGTGACCCAATTATCGATGAGAAACGAGAAAAATGTCACACTC TTGTGAAAGTAACTACCCCTGGCATTCGGGCTCATAGCTAGTTATCAATT AACCGTTTGACTTAGTGTGAACTACCCCTGTCACTAAAGATCTTCCACAT CGGTACTTTTTAACcagatttataaaaaattcgatttgaatacacgtttt ttttataagaacaaactatataagaacataaggcttcgagacccaaaaat ttaagaacaattctaagaacatactaaggctttgtttggagactttaaaa catgcaattttttaagaaattacatcaaaatgctcaaaaaatgctgaaaa taagaacattttaagaacatttttaggcttcaaatccaaaaaactaagaa catccgaaggcttcgaaaatttttgacgttcttataattaaaaaaaaacg tgtagtctaaTGTTTGTTACAAGGCGccgtttctttcaaaataaaattaa attaacaaAGCGCTGCTTCTTCAAAAACGGGCACACACAGCgacatgcta atgaaaggccatGCTGGGCCAACAACTTAAAAACAAGCTACCATGTTTGT TTTCTCTTACCTGACCCGAGTTTTAGCTTCTCTTTGTTAGCATAAGAGGC GCACACTTGCATGTACATCTTGTAATAAAACTGTGTTATGTTATGAAAGA TGGCAGCCAcgaataaaataaatatttagagATTTgaacaaagtttaaaa aagaaacTGAAATGAAGAATAGTCTGCAgtattcaattttgaaaaatgca ggAATTAATGGACTCCAGAGCCTCTATCAGATCAGCTAGGTACCCCGAAC AAATTGTTGAATTTTAACTCTTAATTAAGCACTAGGTCTAGGTCTCCGTT TGAAATCTGGGGGGCTGGAACCCTGATAACGAACAGATTATGCCATAATT ATgagaaaaacattgaaaaggaTATGAGATATGAAGAGCTGTCCTTTAAA TATCGATTATTAGTAAATCATCACAATTCTGTTAAAGTCACTTTTATACT CAGCTCTTTCAAGAGTCACAATATGTGTTCAAAGGAAGTTCTACTCAAAA TTTTACAAggacaaaaattttcacagtaaCATTCACCGAAATTTAGTTAA CAGTTATGTTAATTAATAGCAAAATTTCATTTGTTAAAAACTCGtttcaa tgttttcaaaaagtACTCCTACATGCCGGGGGGGCTCATAGGGTCCGACC CTCGgcatgtgccacccttaagggtaggttttttaagaccctcgaaatgc actctaagggtgtacttttgataaagtgcactacaagggtcttcttttac ACTGTACGGGTTTGTTTAGGGACTGCTAAATTGCAAGGTTGTCAAAAAAT CTGATGTATagtctttatagttttgatttgcacccattttgatcaatttt gcacattgtgtcgaTATCTCAGGCTCATTTCCAGGTggtttcagcaaaat aagatatgaaatcaaactacactgtatgggtcagaaacgttcggtaaaat gaACTGTAAaggtaccttttcactgctcaagggctGTACTgcaagggtcc gattttgaaagcaatttttttttggcggCGCATGCCGTCGATTAGAAATC GATTGCCCCATTCCCCAATTGAAGAGGTTAACCACAACagatttttgaca aatttttgagATATCCATGGAACTTCGTCTAAGTTTCGGAGCCCTTAATA TTTACAGGTTTTTTAGGGTTCCTTGCTGGACGGAAAATATAACCACCTCA ACATGGGCAACATGGGAGGTGGGAGGCATGCTGTTAAAGCCTATTGGAGT TTGAACTTTTTCTGAGAAAGAGGTCAGAGAATTCTTAGTTTGAGAGTTGG GACGGTTTCAAGAATATCATCTCTAGGAGCTATACATGATGAAAGAAAGT TGGCCGACATATTTGAATACCGgactttgttttattttgttttgtttatt tggaacACAATCACTggtttttaaagtattttgcTAAGTGAGGGATGAAT GTCGGCAAATTTAACTGAGTTACAAATCATttgaagctttcaaataaaTC TTTGATTAAATTGGAGACATAAAAAGATCTATAAAAATCTAAGTTGAACA TGTGGGTGTACATAGAAGGAGGAAGAAAAGGGAAAAGGGGCAAAGTTGAC CATTTGTTACGCACCCTTCTGTTTTCCCATACCCAGGCCTTTCCTATCTC TTTCAATAACTCTCCTCTGATGTTTTATCAGtttgaaagtttctttttta GCCATGATAAAGATATAGATATATGCAATTtatctttgaaatttatttta atcTCTTCCCTCTTCTTTGAACTGATCGATTTATAGAATGATAAGGAAAA ACTTTAGCTTTCGGATATCTAGAATTGACGTTTTTTAAAACTTCAATTTA TTGTTCAAAAATACCAGAAAATTAGGGATGCAAGCATTTTATCAGTAAAT CAGTAAGTCAATTTTTGTATTTATACAAGATATATGTGACAAGCAACTTT AAACTTTaatcaaataattttaaataaatgtaCGTAAAATTCTATAAGGT CTAATTTCTAAAGATGAAAAGCGAGTATAAACAGAATTTGATCGGGAAGG CATCACCAGAGTTGTTCGATGTCGTTGTTGTCTCCATCAGCGACTTGGTA CCTCCTGCGACATTCTTTCATACAGCCACGCTGCTTTTCACTGCACCCCA TCCATTGTTGGAGATTGTCCACACTGTGTCTGCACACTTCGTTGATCTCA TTACACATCAAGCCACAATTGTTCATACCAGCTCTTGTGGAGGTGATCAG CAAAATGACGGTGAAAATGACTGCTAGAAAAACTTCTTGACGTTGCATTA TCTAGAAAAGTAAAAGGATGATTATAATTCGGTATTTGTACCTTTCTAGT GAGTGAGAGAGGTTAGAAGAGTTTATTGGgtaaatcttcaaattttcttt gaactTGATTTTTTCCTGGAATTTCATTGACTTGGTCTTACCTTTGATTC TCGGGTTTGATAAAGATGTTGGCTTGGATTTGATATGGTATAAGATGATA TGATCTGATCTTTATAACCAACACACTGTCTACTGAACTTTCCTTGTTAA CACCTTATCTGCTCATATGTCCATATGTCCACTGGACTAAATAACTataa aaactttcattttattttttcattgaaattgataATATATTGCCCGTTGT CTGTTTCCTTTTGTATTAATAATAACCGTCCAATCAGATGACTGCTCGTA AGTTATTATTGCATCCTACAACCAGTTTTATTTTCGTTCCAAAAAGTAAA TTTATTTTAGTCCAAGATAAACTattatttgtttcattttctaCTCAACG CCTTTGTCTCAATTTTCACAACAAACTGTATTGTTAAAGGCGTTTTAAGC ACCAGCTTAAATTAAGGTTGATGAAATAGGTCTGATAGCTAATCTAACAA GATTTCTACCCCCTTTCTTGTTTGGTTTCTTTtggcttgaaaaaaaaaga aaacattagcTACCTCTTTTTCCTGTAATATAATCTTTGTTTTTGATCAA TGAAACTTTAATGTTACCGATATCTTCTTCATTTGCAATaagttcttttc attttttaatatcAAGAATTATGTTCCGATTACATAACTTACAGGTGATT TTTTAGGGAAGGGCCCAGGGCCAGGTTAAGGGATATCAAATACTacacac acccctgtctcatttcAAGGTAGGGAGGTACTAGGGTTGTGAGATGACGG GTTTGCGCCGCCCCAGGGGggtggggtacttaggcaaatgaagggtacgg tatgtgcccccctaagggtaccttttttggacatCCAAAGTTCCGCTAAG gttcggaaaaatcagaaaatcaaatttcagtcccactaaggtttggaaaa ataggaaaatttcaactttttaccccctgaaagatcgaaatttggtcaaa attggtcaaatttgtcccgctaagggtcgtaaaattcccataattttccc ggtaagggtccaaagttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcccccccccccccatcagct cgcaaccctagtaccccccggggcgCCGCCGGGCCTTCAACCCTGTGACC CTTAGCGAAACTAAAAGGGAAGGAAAGGgaaaatttggtgatttttacGA CATGTAATTACTGTTTCCCTAAAGTCGAGGCTCAGAGCTAACATAAAAAG CAgacttttaatgttttaatttttttctattcgTTGTTTATTTTACCGAA AGCTCAATTTTATAAGCGGAAAAAACCTCTTCACTCAATGTACCAGATGA TGTCATACACAGTGTTACTGTCAGCTTTTCATGTGTTTGTTCCTGCTGTT CTCTGAGATCTCTTTCAAAGGGTGTTGATTATGATGGGTGCCTTTTGAGA TAAAAAGTAGAGGTTTTATTCATCTGCAAAAGCTGCGCGACCGGAACTAC TTTTCACCACATGATAAAGAGGGTCTTTTGATTGACTCTTTCTGAGTAAA TATAAAGAGAGAACATGTTATTGCCACTAATCTTGCTCTATTGTGCTCTA ATTGGATGCATTTGATCACGTGGTCAAGGAAGGATAATTGTCTCATCTAT AATCGATGATTAAAGAACGGTTAGCCAGCCTGCTTTGTAAATAGTTGACA TTATGTTTTACGAAAGTGCAGACAACTAAGCAGggaaattgaaagttttg ttttcgGTCGGAAGATATTTTTATTGGACAGAAATGTTGCAACAGACCTT TCTAGTTTTGTTTGTCCTGTTTTTCAAAGATACTTCTACCAAACCTTTGG CTGTATGTCACACAAAATGTCGTATGATTTTTGAACATTGCAATTTTTCG AGTACGGAGGTGCGAAGTTTTCGGACGTGTCACGTGAACAAAGAAGAATG TATACAAGCATGCAGTTACACTTACACCAAGAAAGAGAGGAGTAAATGTC GCAAAAAGATTGACCACTGCTTTGCAAAATATCATTCTTTCCCTAAACTC AGTAATTGTGTGAGGACGGCCAGTTTCTCATGTAGGATGTTCGTCCTACG GAAAAAGAAGAAACCCAATGATGGTTGACCTCGTCATTTCTTTtgtagtt ttttattttgaaatatttatttgcagttttacgttttttatatttccaaa tttttatcttcttttttttactaACTGAatactttttgagaaaaaaataa cacTGGGTCACCAGACAGAATGCGAAGAGAGAAATTAAGAACTACATTCG ACTTTATCCTTAATAATCCTCATTATTTTATTTGTGCTTTAAGTTTAGAT GCAACTTCCTCGTGTCGCAATGGTCTAACTCTTTTCCGAACTTAGAATAA TCGGCAAAAACTATTGTCGTTTCCAATCTTGAAATGCGATGAAAGTAGGT TGTTCTCTTAACATAACacaaacaaagaatttttcttttctctcttgtaa tatttcataaaattagTGCATCTGTAACATTCATTTACAGGAGAAATATA CGAACTTCTGAAGGTCTCCCTCAATAGAGTAAAAGGGAATCTCCTACGTT GGATTTGGAACTgctaaatcctacctaagttgcgcggccttgagtgGTCC GTGCGGTTTTTTCCAgatataaagtaaaatttttcgctagatttaaaaaa ataccactcaaaaatatagaaaaaaattcaatccgtcgtcaaaaatatgA CGTATATAttctaaggcttcactttttcttgcctgagaaaggatAAAGAT TCGCTTATGGCCCTTCGGGCTTTTTACTTCATTGGTGTCCCTCCCTTCAA TAAAAACTCTTCCTAATGAATGACTTGGGAAACAGgtactattttctttt gttgctGTTTTGTTAAGATGTATCTTTCAATTTGCAAAACAGTGACGCGT AGAAataaaccatgtactgaaaacacgGATTCTATGAAGTAGGCTTATCT CACGAGGAAAACGATTCTCGTATTCTAGTATTTTACAACAAACAAATCAT TCGTATGTCTTAAGTAAGATCATATTTTTGCATTTctaaagaaaatatta ttatCCCTTTTCCCTTCAAAATGATTTTGGTAGAAATTCTGCTTTCCATG TTAGGCCTATTACGATATTAGATTCAGCCAATCGGAAGTAAACTTTGTGA AGTTTTTTCCACTCCGATATAcctcaatcaaaatttttgagctttttcat GATCGCCCAATTTCGAGAGAATTTAAGTATCATTAATTTTAACTACAGTT CTTTGCGGTGTTTTAATGATTCCCGGTGACAGATGTCCTTGAGTAAAACC GTTTCCTTTATGTATatccggggggggtactagggcaaaatgggttacgg ggatgcgccgCTGTTCAAGGTACCCTTTTTAACCCAGgcagggtcgcaaa aacaccaaaatagaaaaatcagtctttCGTAGGGtggcttttttggaaaa tttggggaaaaagtagataATTaggcaaaatctttgaaaaaacaagtccc acgtagggtccatttttcaaacatcagcggagcacccccgtcgatCGGCA ACGGTAGTACCCAACCCCCGGATGTATATGTGCAGGTACATACCTGGAGG AGTGTACGTACCCATAAAACCAATTTTGCAGAGAGTGCAATCATTTGCGC TGGAACTACTTCTACCTCTTGTTTTTCGAACCGGAAGTTTCACATGCTCT TGCAAAGGACCAATGCTGAGGCTTTCAAAAGCATTCATTAATTTATTGTC TCGCTATCTCGTCATCAATCCTTTAGACCGTTGACCCTTTCAAAATATAT GCTTGCTTTTTAAACCAAAccatatgatttttttttgcattttgcaCATA AGAAAAACTCCCCATGATGCAAAttcaaataatcaaataatTCGTCACGA TACCTAAAGCGCTTCCGAATTATATTTTATTTGCAGTAATGCCGATATCA AGACATTATGTTTCGATTACATAACTATACCTTGTTTATACataggtttt tttttatcaaataaaaaatccgTTATCACTAACGTATACACTTCCAGAAT GGGAAAATAGGTTTCACTAGTTAGGGAAACTAACTACTTTCCCAAACTTA GAAACCCATACTAATGTAATCGAATGATAAATCCACATCTAAAAATCAAC AAACTCTAGGCTAGAGAATCAACAATTTTTATCTGTTTCATCCATGGATG TGATATATCAGGGTATTTGTTTATTCGAGGATAACAGATTAAATTATGAA ACTGTTCTTTGAAAACCTCCCAAACAAATATCTACTTTAACACATTATAC CTTGAAAACGGCCctggccgaaacatgttggaaatttctagcatctaatg gtatttttgtctcgatcctccgtccgataTACTTTAACACATTGATAGGA AGATGAAATTCTAACCGTTTTTATTTTCGATTACAAATCACCACAAGTCG ATTACTTTCATATCATTCGGTCATTAAATCAGTTTATTTGGATATCAACT CCATATTAACCCGTTAATCTAGTCCAATATACAAATTCAAAATGTGGATT GTGAAATCCGTTCACATAGTCATATGAAATGTCCTTTTTTTGACATTGGT ATTACAAAGACGGAATGAACTAAAAGAAGCGAAATTgtttctaaagtcta ttcacgataagtgtgcactcttttttcttttacttataacttttgaagga attcttcaatctttataaatttggtatcgttggagagatatttatgagtg gaacaatttgaaataaagaagtctttaaaaaattctaaaaacgaagatga aaatgaagaagaaaaaaatgaagatcttttagagtagtgctataactttc attttcactggagagattctttgatcttaggaggtcatcactgtgaagaa atttcactaaaataattattcaatataaagttatgatgcaaagttaataa gtgattgaccccaaaaaacagcagaaaacagcgtttttagacgtcaatca gcttataactttgtttgatatctttttactgaatgattattttgcagaaa ttttttcacactgATGACGTTCaataatcaaggattcactccagtgaaaa tgaaagttttagcatttctctacaagatcttcatttttttcttcttcatt ttcatcttcgtttttagaattttttcaaagacttttttattttaaattgt tccactcccAAATATCTCtgcaacgataccaaatttataaagattgaaga attccttcaaaagttataggtaaatgaaaaaagagtgcacacttatcgtg aatagactttaattccTTGGTCCTGTTCAGATATGGCATAGGTTAGCCTC TcccctagtctgaatcgcagacctctatagatatacttcatATAAGAAAc gtttttcgctagaggatgagcagaaacCTACCTCTCCCCCACGTTCTAAC GTTATCTTAACCCACTTAACAACTTTATCCCCCATAGGTGTACATATTTA cacttttattacaattttattaCATTTCTATTACATACATAGACAACCCA ATTATAGCCTGTTACCTACACGACCCTGCCGATGCACCGGACACAAATGT CCGGTGTCAAGATCGAATACTTTTGAGCGCCGGATAATGTGCGCACCGGA CATCTAAAAGTCCAGTGCGTCCGGTACGCATTTGTACAAGGTTAGGGCGT CTTAGTAAAGTTACCACCCTCCCCCCTAGGCGGTAATTTTTCGACACCGG ACATAATAGCGAAACGGCAAAAATGACAACACCTTATCAGATCGTATATC TCACACCGGACAATAATGTCCGGTGCATTTACAGAATACTTTTCTCCACC GGGCAAAACAACGGACAATCCGGTGTGTCGTCAGGGTCGTTTACCTACTT TAAGCTTGTACATTTTCAACTAGCTGAATTTGTAAACTACTGTAGATCAT TTTATGAATCTCCTGACCATGGTATCATGACGGTATGAAGcccagaaaaa taaaaatatccaATATGACATGGCACACTTTGACACATTGTGCCAACGCG TAGTTATGTTAACGCCTACTGCAATCTTTTTATTCATGCCTGcttccttt ttcattttcttgaaattctaAGCCAGCAAATACCCCTGTCACAATGAAAT CCAACAGGGGGGGTGCTATAAAGTAAAATCTCAACAGGCCTGATTCGAGG TCTCAAAACCTCACTGGGTAAGAATTTTATCCTCGATTTTCCCCTGGGTA AGAAAAGTGAGATTTTTTAATTGAGGGTTAAACTCATCAGTGCCTGAGTG TTCGAGTGTGAGTTACAGTTgactcaaaacaaaacaacaacggTAATTCG AAATCGATTTGGGAAtcttttttgttcgaattacagagagattcgaacta taaaaattattttaagagggtttcttcTTGACGGGAACTGGAAACAAGTC TCTTTTCTTAAGGCAGAGCTTCTTCTTTACAGACCGATTCCTTTGTGATT GTGAAGTCATTTTCACCCACAATCTACCATTTTATCGAGGAATAGCATAA AAGATATGCACAGACGGATTTAGTTTACACCTTGCTTGGTCAAGGTTATG AAATATTTCCCGTCGGACCTACCTGTTGTACTAAatagttttctcaaaaa tgctttAATTTCAACATGatgattataattttttttaaagtttctaTAAA GTATCCCTGGTTTTCTTGTTTGTTTCTTGGACCGTGAAATTATTATGTCA GTTAAGTATTGGCAGCTTTGGTTTTGGTTAAAGGTTGTTTCCAATACAAC AGGATTTTGTGGAATAGGCTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttttgacca aaatttggtgacaatcaaaccaaaatttggaaaaaatggaccaaaattta ggaaaaagtctctcaaagggtcccaaaatcaccaaaattttgtctcttaa agggtcgattttcgattttcggctcggacatacctgtcacctcgcaaacc tagtacccccccccgggaataGGCTTGAATAGGTCTAGTAAAATAAAAGA GGAGGATTCGGAGTTGGGGCGGACAGTGGTGGTGGCTCGATGTTGACCGA GAAAAGGCGTTGGCGCTTTACAATCGTTCTTCGTGCTGAAcagctttttc aaaattacccGATTTCCCCGAAAATATATTGACGGGCAACGTGGATACaa gacaacaacaacaaaaaagaagaaaggaaGATGAGTActtttgacccaaa tttttcGCTTTATTTTATGGCTTTCTCAACCCACCTTTCGAGCAGATTTA TGGTATAGATTTAagtattttctttctcattactCTAACATTCAAGTAAA CTTATTGACCAGATGgcgataaaaaataaaaaatttctgtgTTTCTGTGA AGCCTTTTTCTTAAGAATTTCTGCATGCCGGTTTTTTATCTCTtatagag tcccctgcccagttggcgactggtctagttggcgaccgaacgtctttgaa cccagaaaagtcatacaaaaacaaacctctggagaatttcttttggtagt tatctgccttgacctatttcccgtagctactgtgtaaaaaaggttttaga aaaaaacgagtagaatccgaaagatccaactttgcacacaaaaagccgga tttttcaaaaaaaataaaaaatggctacctgtggacaaaaaagctttgta agaaaaaacgcttcaactaCAACTCCCAcgccaaaaaatacttgtccaaa acaatgagttagaaagcatttctgtaaaaatcagctcgatacagtttcct tcgtgtgaaatattgataaaaaagttgatgcaatcagcttcgaaatatgt cgtccagtctgcgaccgaccaaactcaaaaaatgaaaaagaagactctac attgcgatcaaaacattccagacgcgaaaagaaaaaaacaggcataaaaa attcccgcgtttttatcaaatgaagactctccatagaccgccactttcaa aacaaaacaaaaacaaactttagaaaaaaatggcgacttgaagaaaaatt ctgaaaaaacatgcagaagggaaatgtaagtgagctattttaaaacaaaa gaacgagtgtaaataaatttgatacgggaaagcttatgagtatttttatc atcctgatcaattaatatgaccttacctgcaagtacagcactgattttct ctttttaacgatcagtcgcagactggtacgtcggtcgggaactgggcact agtaccgctcgcttcgaaagttttttattctaagaagatcgcctcaaata aaaaatcaaaacaaacacgaagaacaggttaaaagttgtctaaccgttgg ttgaaaaggattttcaaaaataagttaaaagtaagtgaaaaatttgaatc caaaaatttcggtcgccaactgggcaggttACTCTAGCGCCTCTAATTTT CACGCCTCTAATAGGATATTTGCGCTCCTTCTCATTTTCACAGATTATga aatttccggcatattttctGAGTGTTTTTATGATGATTATAGGTAAAGAA GGGCAAAAAACACATAAAATCAGAAGTTTAACTCAATCACTTTACTTTAG GTGCCATCACCAAGAATATNcaaatatggctaattttgattgttcaattg ttttacaagtttgttttggacacgtgattttaattgttctttttaatgat ACGTGGTTCGcgtaatgtttacattttactactgtaatgtccctttaaat ctGACAAGTTAAAGAGATGCGGATGCAACGTTTCAGGATAatataatatg aaaatttgtaatttgtaaGTACTCTTGATTTGGAGAAAACCCTGTTATAG TGTTTCACGTTAGTTCTgtttagtattttgttaatattttatcagtattt ttgttaatATTAGTGTTTGATTTATTCTACAGGTGTTTTTAATTAGGTCT TAGATCAGCTTCTTGAGCATTTTGAAAGTCTTAATTGAGTATCTTTAAAG TGGCAAAGACAAATAAAACTATAACAGAAAGTatattgttaaaatattat cttcTATTGTCTGTTAACATTTTATCATTTGAATTCTATCTTTTTCTGAT TTCACTCCAGATTTTGTTAATATGCAAACAATTGGTCATTTTTAACCATT TATgtcaattttgataatattttaNAATAATTTATTACTATGTTTAATTT AGCCATATattaaatatttacaaaatttatcagagcgttaacaaaatatt gataaatttgTAACACTATGGTACACTCAGAAAATTACGAAAATGGTTTG CTGCCCTTGGAACCTAGCAAATTAGATTTTAGACAATTTCATGAGAAAGT GAATTTATCAGATAGAAATAACGATTGTTGCATGTATTTTGGacacaaaa atgataaatttttaacaattttggcaaaaattgaacttaatcttagcaag gaaaaaatataagatatcaaGTTTTAANNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTGTCTTGATTTGATCGTTGTGACACAGGACCTCAA CAGTGTTAaagatttatcaatttttgaagataacataTCCACTGATATTT GTCAATATTCACTATgtttaaataattgataaaagtttaacacaTGGTAT CAATGTCCACAAGTAGGCCAAAATTGGTCTCATATTATTGATCGTGTCCA TATTCTTGCCATCACCATCAGGTGCCATTTAAGCTAAAAATTTTACATCC CAGacagtcagtcagtcaggagtttttgcctaattaggaaagtatagacc ttttttcaaagaggccaccctgttgaatgaataattatgtagtccagcta gcagaaaaacaatgatacacccatgcataattattacaatatgcacaaaa cagtaattatgcattgctgtatcattgtttgtatggctggtagttagtca cactagcgtcccgcgaagcaaaaaaatgcgccgcaaaacttctaaaggga ttcatgaaaaaataacccagggctttttaatgaaattagcagtccatcac aaactgccatataaacaaagctcaacattctcacaaaagttgtctttttg atttcccaaattTCGTCGTAAGCGTTCACTTTCACAATAataacaatccg ggggtaagtggcgaagcaacacatcagattattcgtaaagtaaagaaata tattttgacaTTGACAATCGAATATgatatattacattatatttccttta attcaaaatcaaaaattcattttgcattAATTcgcgaaaaaagaaaataa taataatgaattaatattacatactaagacgcccccgtcttttactctgg CCTAACTTCTGATCTCGGAACGTgaaaaacgcccgtccgcccaatatcta CCTAATCAGCTTAAATTTACTTTAATTGtactttgactttcaaaaaatag tatttaaaaattatgaatttataataattacaaaaaacaaaaagttagat acttcattagtgaaatattcaataaattcctagtttcaattttcactggg cgtttttctagggcttcgtttattgcgcaatttttgcgtcacacaaactt tctgggccgctcgtaataattatgaattgccaaatttggttcaaCATTGT CAGgacaggatcgatggtgacatcacctaagcataaaaaagaaaggattc cGTCAGGTTTATGCATATATAtaaatttgcgagatattctattcgccgcg cgagcgcatTTTTCGTAaactagtcggaatactttctttttttactcgcg ggattgatggtaacttttcatctttgtttttttttaaatgaagcacaacc gaataaaatgaaacttcaaaaagttgcgtatttccagtgagtaaacgatt ctgacaattaacaaaattgatgatgatgattttttttcggtcaggcaaat gtctcgtNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcaggcaaatgtctc gtattgggggttctagtcttgacccctaagcctacgcgagattgaagcgt ttgggtaaacaagacaaaactccaaaaaagctggtggtttgaagcgcttc cgtgcgatcgaaatattgctgtttgtgacggactgattagcattttcaaa aactttgagaaattacctaaaatttgagccatagatgaaaaaatttgagc caagccaaccttgaaaactaatttgaagatcaacttcacaagaaaaagat ctacggggaaggcggaacccacctagatccacgcaccgccggataggcta tttcccggaaattttgccggacctcagaCCTGCTCagacaatgacccatt tacatgtgcggaattatttttacttgagcgtataaacaaggccttaaaaa tcaaagcgctgtctcgggaattgaatgacaaaatttggtttgttgatatt tggctgctgcacgttttattttgtttcaaactttcaagttttaattaatt gatttgcgaacttgattcaggtaactctcatccttgttgtgcaaatacat cctgtagatgactgatgttgttttttctgaaagctagatttcctagtgtg actaactctaactggctggactacataattattcaacagggttgcctctt tgaaaaaaggtctattttatgattttcctGACTTTTCTAATCAGGACACA GGAGAGCCTTTCCTAATAGATGCTTTGGCTAACGCGACGGTtatttgaat aactaattactccacagcagTTTAGCCTGGGCGGTCGAGCGCTTAAGTAC TGTacaaaagcgaataaaatctaatacaattgaatcaattgaacgtaatc gaacataatcgaatacaattgaACGTAATTGAAGCAATCGAATTGACTCG GCAttcgatttgttcgattgacaccgtcgtCTGGCCATTACTTTTAGTAA GTCAAAATTGATCTATGTGaagaaatgtttaaaaaaatatgaaatcaaaT GGGCGGAGCATTGAGATACCATTGGATACCCCTTTAAAAAACCTGCTACA AAAAAAGGTACCCCCTATATCCTGATAGAGAAAACAGTAAgggctgaaac tttttctggtgagtctaggctatctatgaatttcttccctgggtatggta ttttataaaagctgctaagaaaatttttattgcttggtgaaaaaatgcaa ttttagcaATTTACCCCTTAACACCgacaaaatggttttcttgaataact ttttataaaatagtccttttggtctcaaattttgaacatggattcactgc aaagttactaatgctacaattagatcattggtacctaaatattttcaaaa ctgtacgttGAAATCAAATTACATGGTGAATTGCAGAAAAATAGTACAAT GTCCCTTCTGCATCAGTCTCTTTTTGAGGACCCTGGCAAATGCAATTTCT AAGAACTTCACATTTTTGTGAACTCTACTAAATAGCCTTCCTTGGATTGt tatagaatttttttgttacagccccaatcttgagaaaaatgtTGCGGACG GGACACTTTGTTGCAGACGGGACACTTTGTTGCAGACaggacaaaaagtt tttcactCATAGCTAGTACATgtaaagtcaagaaaaatgataCTGCTGCA AAAAGCATGTGGTTCCCTATAGTTCATTGGCTTGNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNACGGGACAAATTTTTGGACCGTATTAGTTTTTAC cagttaaaaaattcaaaatagatTATTTAAAGGCAATAAATGTCTTTAAC GCAAGAAACCATTTAATATGccacaacaaaacaaaaatggggGTCCTCTA GTTCCCAGATCTTGACTTGTAAGCATAAATGGAGCTTTTGTTGCAGATGG GACATTGTACTATTTTTCTGCAATTCACcctacaccttaaaacctacaaa cattgaaccccttgctcacaacttactgaaactgtaaaattgcaattcag gtgctaaaccgtgattcaattgatcaaatacttgctagaaattcattacc aaaacaatatttgtattttatcaggattttttttttaccagaTATCTTTC TATGTCTAAATCTtgagataattcatttttaaggtgggtaagtatgctga aaaactgctgactcagcaaaaaatatatttggatactactaattcagggc tatccagccgtgggaatgattttttttctgaaaatgctcctaggaaaatg ctgacgtcatcggaaaacgcccaaaacatcgatttttcgccttaaaaatg tcatttctcggcaccaggtggttgaaacttaacaaataactccattttct ttatctacttttcacgctggaTCAGTTGGTAGCATCAGGTATTTGATTTG TAAAACCTTGTAAAATCTTCATTCACAGCATTGGCAGATTGATCACATCT TGCCAATAGAAATATTGACATGTTAAAATAGTTTgatttttggctgtttt ttgtGTAAATCTCTCAACAGTCTGGACAGGTGGGGTGTAGCCAACTTTTT CAAGCCACTCAGTGatttttaacttgaaaaagtCCCAAACTGGCCCAGGC ATGTTCAGACCAGGTTTTCaacaaagaaaagcaaaaatttcaggGTAGCT ATGTTGGGGCCATGCCATGGGTCGTGTGTAGGACATCAACTATAATCATG GATGTATATATGATGACACTTGCCCCAAAGGTAGCAAGGACaggggaaaa tttttaattaaaatggTGCGTAGAATAGATCTTTATCAGCTAAACTACCT AATTTGATGGTTACCTTATtgctaaattttgattgggCAGTAGATAAGTA TTCCAGCTAGACCGtaagatttccagggggtttgatttactttttcttga gttgatttttactttagatttttataagaatgaattTATGAAATAAATCT GCATTTTTTAAAGGACATTTTCTCTCTactattcttaaaaaaaccatTTT ATAATTACCCTGAGGATATGAGATGATTTATAAGATACTATAAGGGAATA ATTTATTGGGAAAAAAGTGTTGACAAACAGTGCTTGATATCAAGAGGAGT ACATTGAGGAACtgattttggctgaaatttcttaaaattggaaaaaaaag gTAGATGCTAAAAGGGTTAAAAGAGTGCTGTATTTTCATTTAAATCTCTT GAAATAAATCTTCAACATTTTTACTACTTAGACTACAATGGAACTAATTT TACACCTCAAAATTATCAATGTCCCTTCCTTACTGATAAATACTCTTATC ATTTTGATtagataaaagaaaaatgtcGAGCTCTGAAGATGAAGATATAA ATGAACAGCAACTGAAAATCACATTGGTTGGAGATGGTACGGCTGGTAAA ACTTCTCTTTGTACGCGGCTTGCTcaagaaaattttgacaaaCAATACAA ACAGACTATGGGTTTGGACTTCTTCATGAAACGCTTTTCTTTACCTGGAA ATACAAATGTCACATTACAAGTTTGGGACATTGGGGGACAGCAGATTGGT GGTAAAATGTTAGATACATATCTGTATGGGGCCAATGGAATTCTGTTGGT CTATGATGTCACTAATCAtaatagttttgaaaatttacaagaCTGGTTAG AGGTCATTAAACAAACTTATGCCAAAAGTGAAAAGAAACCATACCTTGGT TTGATTGGAAATAAAAAAGACTTGGAGCATTTGCGCACAgttaaaagaga aaaacatgTTGAATTTGCCCAAGAAAATGGGATGGCAAACTTCTTTTTAT CTGCAAAATCAGGTGATCaagtgaatttttgttttcaaaaaattgcagCT GATATATTGGGGATCAGATTGTCAAAACAAGAGGTTGAGCAATCTAATCG GGTGATTAAAGCAGACATTGTAAATTACAAAGAGATGGCCACACCTGCAC TGCACACTGGATCGAGTCATACCAAGAGCTCACTTTGTTCTattcaatga atttttattacttcaaaaaactaaaaactataTATCAGAGTGTGTTtaaa ttttaatcttttttaacTCAAGCACATCTTAATTTATTGATTTTAGCATT TTATTTCTTCTAGAAATGacaaatatttatttattttcaaccAGATTGAT TAAAAGACACATATTCGCTTCAAACAT

Coding sequence (CDS) from alignment at sc0000007:361577..393703+

>TCONS_00000991 ID=TCONS_00000991|Name=TCONS_00000991|organism=Clytia hemisphaerica|type=CDS|length=4248bp|location=Sequence derived from alignment at sc0000007:361577..393703+ (Clytia hemisphaerica)
ATGGGTAGCTGTTGTGGGAAGCCAAAGCAGCCTCCCTCACACACCAATAA
TACTCAAACTCAAATGACACCCCTGGCAAATAACCAGATGCAAGCAAAGC
CTCCAGCAGACTCTCCCTTTCCACCGCCTGCTCAACCTCTCCCTAACAAC
CCTTTGCCAGGAGCTGGGGGTGCTACGATATTTCAAGCACTTTATGATTA
TGATGCAAGGATTAGTGAAGATCTAAGTTTCAAGAAATCTGAAAGACTTC
AAATCATAAACACTGCAGATGGTGATTGGTGGTATGCACGTTCTCTGGTC
ACCAACAAAGAAGGATACATTCCTAGCACCTATGTTGCTCCTGAAAAAAG
TTATGAAGCTGAAGActgGTATTTTGGAGAAGTCAAACGTGCTGAAGCTG
AAAAGAGGCTAATGATGAAAGGATTACCAACAGGGACATACTTGATCCGA
AAAGCTGAATCAGCACCAGGAAATTTCTCACTCAGTGTACGCGATGGGGA
CTCGGTAAAGCATTATAGGATAAGAAAGCTTGATACTGGTGGTTACTTCA
TTACAAGTCGAGCTCCGTTTTCCAGTTTACATGAGCTTGTACAGCACTAT
TCTAAAGATGCTGATGGTTTGGTTTGTGCATTAACTATTGCTTGTCCAAA
TGATAAACCTGTAACAGGAGGCTTAGCAAAAGATGCTTGGGAAATTCCAA
GAGAATCGTTAAGGCTAACAAGGAAGCTTGGTGCTGGTCAGTTTGGAGAA
GTTTGGGCAGGAGTATGGAACAATACGACACAAGTTGCCGTCAAAACGCT
TCGTCAAGGAACTATGTCTCCATCAGCTTTCTTAACTGAAGCTGGTATAA
TGAAGAACCTTAGGCATAAGCATTTAGTCCAGcttTATGCCATCTGTTCG
GACAAGGAACCCATCTATATTGTTACTGAGTATATGACGTGTGGGTCGTT
ACTGGATTACTTAGCTAGAGGTGATGGAGCAAATCTACAACTCCCCACAC
TCATTGATATGTCTGCTCAAGTTGCTGCTGGTATGGCATACCTTGAAACA
CAAGGATATATTCATCGTGATTTAGCTGCCCGTAATATTTTAGTTGGTGA
AAATTATGTTTGTAAAGTAGCAGATTTTGGTTTAGCTCGTTTAATCGAGG
ATGATGAATACACAGCTCACGAAGGCGCTAAATTCCCTATCAAGTGGACT
GCTCCAGAAGCAGCTCTTTATAATACCTTTACAATCAAATCGGACGTTTG
GTCTTTCGGTATCCTTCTTACTGAGATAGTTACGAAAGGTCGCATACCAT
ATCCAGGTATGTCAAATGCAGAGACAATTGCCCAAGTTGAAAGGGGTTAC
AGGATGCCCATGCCACCAAATTGCCCCGAACCACTTTATCAAATTATGTT
ACAANTTAATAAATAAATGGGTAGCTGTTGTGGGAAGCCAAAGCAGCCTC
CCTCACACACCAATAATACTCAAACTCAAATGACACCCCTGGCAAATAAC
CAGATGCAAGCAAAGCCTCCAGCAGACTCTCCCTTTCCACCGCCTGCTCA
ACCTCTCCCTAACAACCCTTTGCCAGGAGCTGGGGGTGCTACGATATTTC
AAGCACTTTATGATTATGATGCAAGGATTAGTGAAGATCTAAGTTTCAAG
AAATCTGAAAGACTTCAAATCATAAACACTGCAGATGGTGATTGGTGGTA
TGCACGTTCTCTGGTCACCAACAAAGAAGGATACATTCCTAGCACCTATG
TTGCTCCTGAAAAAAGTTATGAAGCTGAAGActgGTATTTTGGAGAAGTC
AAACGTGCTGAAGCTGAAAAGAGGCTAATGATGAAAGGATTACCAACAGG
GACATACTTGATCCGAAAAGCTGAATCAGCACCAGGAAATTTCTCACTCA
GTGTACGCGATGGGGACTCGGTAAAGCATTATAGGATAAGAAAGCTTGAT
ACTGGTGGTTACTTCATTACAAGTCGAGCTCCGTTTTCCAGTTTACATGA
GCTTGTACAGCACTATTCTAAAGATGCTGATGGTTTGGTTTGTGCATTAA
CTATTGCTTGTCCAAATGATAAACCTGTAACAGGAGGCTTAGCAAAAGAT
GCTTGGGAAATTCCAAGAGAATCGTTAAGGCTAACAAGGAAGCTTGGTGC
TGGTCAGTTTGGAGAAGTTTGGGCAGGAGTATGGAACAATACGACACAAG
TTGCCGTCAAAACGCTTCGTCAAGGAACTATGTCTCCATCAGCTTTCTTA
ACTGAAGCTGGTATAATGAAGAACCTTAGGCATAAGCATTTAGTCCAGct
tTATGCCATCTGTTCGGACAAGGAACCCATCTATATTGTTACTGAGTATA
TGACGTGTGGGTCGTTACTGGATTACTTAGCTAGAGGTGATGGAGCAAAT
CTACAACTCCCCACACTCATTGATATGTCTGCTCAAGTTGCTGCTGGTAT
GGCATACCTTGAAACACAAGGATATATTCATCGTGATTTAGCTGCCCGTA
ATATTTTAGTTGGTGAAAATTATGTTTGTAAAGTAGCAGATTTTGGTTTA
GCTCGTTTAATCGAGGATGATGAATACACAGCTCACGAAGGCGCTAAATT
CCCTATCAAGTGGACTGCTCCAGAAGCAGCTCTTTATAATACCTTTACAA
TCAAATCGGACGTTTGGTCTTTCGGTATCCTTCTTACTGAGATAGTTACG
AAAGGTCGCATACCATATCCAGGTATGTCAAATGCAGAGACAATTGCCCA
AGTTGAAAGGGGTTACAGGATGCCCATGCCACCAAATTGCCCCGAACCAC
TTTATCAAATTATGTTACAANTTAATAAATAAATGGGTAGCTGTTGTGGG
AAGCCAAAGCAGCCTCCCTCACACACCAATAATACTCAAACTCAAATGAC
ACCCCTGGCAAATAACCAGATGCAAGCAAAGCCTCCAGCAGACTCTCCCT
TTCCACCGCCTGCTCAACCTCTCCCTAACAACCCTTTGCCAGGAGCTGGG
GGTGCTACGATATTTCAAGCACTTTATGATTATGATGCAAGGATTAGTGA
AGATCTAAGTTTCAAGAAATCTGAAAGACTTCAAATCATAAACACTGCAG
ATGGTGATTGGTGGTATGCACGTTCTCTGGTCACCAACAAAGAAGGATAC
ATTCCTAGCACCTATGTTGCTCCTGAAAAAAGTTATGAAGCTGAAGActg
GTATTTTGGAGAAGTCAAACGTGCTGAAGCTGAAAAGAGGCTAATGATGA
AAGGATTACCAACAGGGACATACTTGATCCGAAAAGCTGAATCAGCACCA
GGAAATTTCTCACTCAGTGTACGCGATGGGGACTCGGTAAAGCATTATAG
GATAAGAAAGCTTGATACTGGTGGTTACTTCATTACAAGTCGAGCTCCGT
TTTCCAGTTTACATGAGCTTGTACAGCACTATTCTAAAGATGCTGATGGT
TTGGTTTGTGCATTAACTATTGCTTGTCCAAATGATAAACCTGTAACAGG
AGGCTTAGCAAAAGATGCTTGGGAAATTCCAAGAGAATCGTTAAGGCTAA
CAAGGAAGCTTGGTGCTGGTCAGTTTGGAGAAGTTTGGGCAGGAGTATGG
AACAATACGACACAAGTTGCCGTCAAAACGCTTCGTCAAGGAACTATGTC
TCCATCAGCTTTCTTAACTGAAGCTGGTATAATGAAGAACCTTAGGCATA
AGCATTTAGTCCAGcttTATGCCATCTGTTCGGACAAGGAACCCATCTAT
ATTGTTACTGAGTATATGACGTGTGGGTCGTTACTGGATTACTTAGCTAG
AGGTGATGGAGCAAATCTACAACTCCCCACACTCATTGATATGTCTGCTC
AAGTTGCTGCTGGTATGGCATACCTTGAAACACAAGGATATATTCATCGT
GATTTAGCTGCCCGTAATATTTTAGTTGGTGAAAATTATGTTTGTAAAGT
AGCAGATTTTGGTTTAGCTCGTTTAATCGAGGATGATGAATACACAGCTC
ACGAAGGCGCTAAATTCCCTATCAAGTGGACTGCTCCAGAAGCAGCTCTT
TATAATACCTTTACAATCAAATCGGACGTTTGGTCTTTCGGTATCCTTCT
TACTGAGATAGTTACGAAAGGTCGCATACCATATCCAGGTATGTCAAATG
CAGAGACAATTGCCCAAGTTGAAAGGGGTTACAGGATGCCCATGCCACCA
AATTGCCCCGAACCACTTTATCAAATTATGTTACAANTTAATAAATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000577XLOC_000577Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000991-proteinTCONS_00000991-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000991-exon-sc0000007-1491911889:361577..362293TCONS_00000991-exon-sc0000007-1491911889:361577..362293Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1510915933:361577..362293TCONS_00000991-exon-sc0000007-1510915933:361577..362293Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1575043694:361577..362293TCONS_00000991-exon-sc0000007-1575043694:361577..362293Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1491911889:367506..368022TCONS_00000991-exon-sc0000007-1491911889:367506..368022Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1510915933:367506..368022TCONS_00000991-exon-sc0000007-1510915933:367506..368022Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1575043694:367506..368022TCONS_00000991-exon-sc0000007-1575043694:367506..368022Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1491911889:368234..369374TCONS_00000991-exon-sc0000007-1491911889:368234..369374Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1510915933:368234..369374TCONS_00000991-exon-sc0000007-1510915933:368234..369374Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1575043694:368234..369374TCONS_00000991-exon-sc0000007-1575043694:368234..369374Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1491911889:392838..393703TCONS_00000991-exon-sc0000007-1491911889:392838..393703Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1510915933:392838..393703TCONS_00000991-exon-sc0000007-1510915933:392838..393703Clytia hemisphaericaexon
TCONS_00000991-exon-sc0000007-1575043694:392838..393703TCONS_00000991-exon-sc0000007-1575043694:392838..393703Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:361577..393703 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
28.5303 28.0548 81.9434 98.6889 230.997 181.815 94.593 104.807 74.4483 95.6303 64.5635 47.2695 59.3835 55.499 53.6864 56.8923 84.5828 74.2381 50.4297 57.921 62.2534 65.4283 61.7262 67.1153 58.9885 60.2702 65.3809 52.856 73.1029 76.7403
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001452SH3_domain
IPR000980SH2
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR017441Protein_kinase_ATP_BS
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0005515 protein binding
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0004713 protein tyrosine kinase activity
Blast
BLAST of TCONS_00000991 vs. Swiss-Prot (Human)
Match: YES (Tyrosine-protein kinase Yes OS=Homo sapiens GN=YES1 PE=1 SV=3)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 276/413 (66.83%), Postives = 325/413 (78.69%), Query Frame = 2
Query:  527 TIFQALYDYDARISEDLSFKKSERLQIINTADGDWWYARSLVTNKEGYIPSTYVAPEKSYEAEDWYFGEVKRAEAEKRLMMKGLPTGTYLIRKAESAPGNFSLSVRD-----GDSVKHYRIRKLDTGGYFITSRAPFSSLHELVQHYSKDADGLVCALTIACPNDKPVTGGLAKDAWEIPRESLRLTRKLGAGQFGEVWAGVWNNTTQVAVKTLRQGTMSPSAFLTEAGIMKNLRHKHLVQLYAICSDKEPIYIVTEYMTCGSLLDYLARGDGANLQLPTLIDMSAQVAAGMAYLETQGYIHRDLAARNILVGENYVCKVADFGLARLIEDDEYTAHEGAKFPIKWTAPEAALYNTFTIKSDVWSFGILLTEIVTKGRIPYPGMSNAETIAQVERGYRMPMPPNCPEPLYQIM 1750
            TIF ALYDY+AR +EDLSFKK ER QIIN  +GDWW ARS+ T K GYIPS YVAP  S +AE+WYFG++ R +AE+ L+  G   G +L+R++E+  G +SLS+RD     GD+VKHY+IRKLD GGY+IT+RA F +L +LV+HY++ ADGL   LT  CP  KP T GLAKDAWEIPRESLRL  KLG G FGEVW G WN TT+VA+KTL+ GTM P AFL EA IMK LRH  LV LYA+ S+ EPIYIVTE+M+ GSLLD+L  GDG  L+LP L+DM+AQ+A GMAY+E   YIHRDL A NILVGEN VCK+ADFGLARLIED+EYTA +GAKFPIKWTAPEAALY  FTIKSDVWSFGIL TE+VTKGR+PYPGM N E + QVERGYRMP P  CPE L+++M
Sbjct:   94 TIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSE-EPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELM 505          
The following BLAST results are available for this feature:
BLAST of TCONS_00000991 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
YES0.000e+066.83Tyrosine-protein kinase Yes OS=Homo sapiens GN=YES... [more]
back to top