Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000982 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000982
Unique NameTCONS_00000982
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1835

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000982 ID=TCONS_00000982|Name=TCONS_00000982|organism=Clytia hemisphaerica|type=transcript|length=1835bp
NTTTGGCGTGGATCTCACAACAGTTCCATCGGTGCGACCGACCAAAGGAG
CGTCAACACAACAAGGCTCATCACCTACTGGTTTAAGAGAAGAAATCAAG
ATGACTGGAACGAACAATGAAAACTATGTGTTCGTTGAAACCGCTCTTCA
AAGACAAATTGAGGCCGCAGAAAAGAACACAGCTCATTACAAATTGATGG
GAAATTTAGATGCTGCCAAAAACTTTGAAATGTTGTTAAAGAACTCTCAG
AAAGACATAATGACGCTACAACAATACAAAGCAAATAAATCGCCCGTTCC
CAAATGCTTCTACGTCAAAAAGACCTTCCCCGTTACAAAGTCCAATCCAC
ATTTGAGTGATTCTGAATTAGAGATCACCGTGGTTCGATGTTTGAACGTA
CCGCTACAACAAGgctACCAACCAAAAGATATGTATACTTATGTCACTTG
TGAGATGGCCTATCCTACGGAGAAGCCGCAAACTGCAACAACGACCACCA
TCAAAGAAACCATAAACCCTGaataCAACGGTGTTTTCAAAGTGCTTATT
GATCGCAAGCAAAGTGCTTTTAAAAGGTTTTGTAGGCGTGGCGTGGTCAA
CTTCAAATTATTTTATGTCAGAGGCTTTCTGAAGAGTGACAAAGCAATCG
GACAAGCGAGCGTCAAATTAACAGGATTCGCCAACAAATGTGAAATCCAC
GAATGTGTTGATATCGTCGACCTGGAGAAAGGTCGTAAAGCAATTGGTGG
GAAGATAGAAATCGTGCTCAAAATACGCGAACCTTTTGTAGACAAAGATA
CAGAGATTGTCAACGAGAAATGGTTGATATTAGATGCACATCTGCGCAAA
CTCGATATGaaaacccCATCAGCAATTCCTCAAGGAAAAGCCGTTAGCGC
ATACGAAAGTTTAGAAGTCATGAAATCTGAGAAATCGCTCTTTGAACGAC
AGGTAGCTGCTTACAAACAGCAAGGCAAACAACCTCCAACAGAGTTATTA
CATAAAATCAAATCTCACAACGAAAGTATGATAGCCATCCAAAATCGCCT
GAAACAAGGAGGAAAGCCAGCTGTTATAGAATATTTGAAGAATTTGGGTC
GTGGAGTAGAAGTGGAGATGAAGAACGCGCAAGTTGCTGCTAAAAAGAAC
GATGACAAAActgcaaaaaattgtttggttaaGAAGAAATTATTGGACAA
AGagATTGGAGTATTGAAACAAAGGCTGGGACTTTGATGAGATAAGTGGC
TTAAAGTTATTAccaatttatttttatacattTCTAGGAAAATacgaaat
attaaaaactaAAATGTATTATTTATGTACAAACTTGAAATAAGatcgga
aattttcaaaacgtatatggAATATTATCGTAAACTACAGAATATGCATC
GAAGATTTacaaaaatgttagattctGGCTGCCCGGTACACAAAAAACTC
TGTGAAATCTATTTTAAGATGCTCGGACCaatgaaaaatcatgaaaatag
tAACACGGTTTAGCAGTTGATACGTTGATGAATTTTTCAGCAAATTTCTT
CGCCCAACGTTCCAAATTTTATGGGTTATGCTTTCACAGTATTGTCAACA
TATTAATAATTCTTTACTCCACACACGACGTTTCATTTTCCAATTTGGTA
TTATATTTGTTGCCAGTTTTTTCTAAtcatttgtttatgtttattgTATT
GTAATTATCAATTGTTTATATGATATTGGAATAAATTTTCCGTCCGAACG
TCTTTTGTAGCGGACGGTAGTTATCACACATCGTCCCTTCTCGATTCACT
TTGGTCGATCGCAACTGCCGAAATTCTTGCAACTG
Run BLAST on NCBI

transcript from alignment at sc0000007:248251..258453+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000982 ID=TCONS_00000982|Name=TCONS_00000982|organism=Clytia hemisphaerica|type=transcript|length=10203bp|location=Sequence derived from alignment at sc0000007:248251..258453+ (Clytia hemisphaerica)
NTTTGGCGTGGATCTCACAACAGTACGTGATCCTCACTGAAAGCTTTTTT GATCACTCATTAATTCATCTACCTTTCTTCAATATTTCTAGAAATCTTTT ATGTGATAAAATAATCAAGTTGAAAGTTACGAAAATTATATGATAAGTTA AAATTACCAATGACGACGAAAGTTCTAAGttgaaagttaaaaacatcGTG ATGATGTACATGCTTTTGCCAATTTTAGGTTCCATCGGTGCGACCGACCA AAGGAGCGTCAACACAACAAGGCTCATCACCTACTGGTTTAAGAGAAGAA ATCAAGATGACTGGAACGAACAATGAAAACTATGTGTTCGTTGAAACCGC TCTTCAAAGACAAATTGAGGTCAGTGCTTCTTTACCATTGTTACCTCACA AAATTAAGTATTTTATTTCTTGACGGTGAAGTTCGTTTGATAAAGACGat tgttttaagttttttaatttttcatacatAGGCCGCAGAAAAGAACACAG CTCATTACAAATTGATGGGAAATTTAGATGCTGCCAAAAAGTAAGTTTTC CAGCTTTTCCGGCTTCAACATTCTTCTGTATAAATATCAACGGTTTGATT GATGTAATTTTACCTTGCAATTACataattctttttaatttctttcataG CTTTGAAATGTTGTTAAAGAACTCTCAGAAAGACATAATGACGCTACAAC AATACAAAGCAAATAAATCGCCCGTTCCCAAATGCTTCTACGTCAAAAAG ACCTTCCCCGTTACAAAgtaattttttcttctctttggTTTACGGAATCA GTAATATCTGATAGTGACTTGACAAAACTAGTCAGTTCTCGATGTAAGTG CTTTTTTCACatgataaatttttcatttttcttacatACAGGTCCAATCC ACATTTGAGTGATTCTGAATTAGAGATCACCGTGGTTCGATGTTTGAACG TACCGCTACAACAAGGTGAGTGACAATGCTTTCTTTTGTTGAATGAACTT CACTTCACTTTCTATTGATTTTTGAACTTTGCCTGGATGTCCACTTTGAC TTTCGATTTCTCCGAACAACTCCTTACGTAAAAAGTCTCATCTTTTGTTT AGACAACAACCActgctttttttttatttcaggctACCAACCAAAAGATA TGTATACTTATGTCACTTNGTCAACACAACAAGGCTCATCACCTACTGGT TTAAGAGAAGAAATCAAGATGACTGGAACGAACAATGAAAACTATGTGTT CGTTGAAACCGCTCTTCAAAGACAAATTGAGGTCAGTGCTTCTTTACCAT TGTTACCTCACAAAATTAAGTATTTTATTTCTTGACGGTGAAGTTCGTTT GATAAAGACGattgttttaagttttttaatttttcatacatAGGCCGCAG AAAAGAACACAGCTCATTACAAATTGATGGGAAATTTAGATGCTGCCAAA AAGTAAGTTTTCCAGCTTTTCCGGCTTCAACATTCTTCTGTATAAATATC AACGGTTTGATTGATGTAATTTTACCTTGCAATTACataattctttttaa tttctttcataGCTTTGAAATGTTGTTAAAGAACTCTCAGAAAGACATAA TGACGCTACAACAATACAAAGCAAATAAATCGCCCGTTCCCAAATGCTTC TACGTCAAAAAGACCTTCCCCGTTACAAAgtaattttttcttctctttgg TTTACGGAATCAGTAATATCTGATAGTGACTTGACAAAACTAGTCAGTTC TCGATGTAAGTGCTTTTTTCACatgataaatttttcatttttcttacatA CAGGTCCAATCCACATTTGAGTGATTCTGAATTAGAGATCACCGTGGTTC GATGTTTGAACGTACCGCTACAACAAGGTGAGTGACAATGCTTTCTTTTG TTGAATGAACTTCACTTCACTTTCTATTGATTTTTGAACTTTGCCTGGAT GTCCACTTTGACTTTCGATTTCTCCGAACAACTCCTTGCGTAAAAAGTCT CATCTTTTGTTTAGACAACAACCActgctttttttttatttcaggctACC AACCAAAAGATATGTATACTTATGTCACTTGTGAGATGGCCTATCCTACG GTATGTACTGTAATCATTCtttatattttatgattttgaaggttttataa ATAACTGAAAATATGATTCATTTCCACCACCGTTCCCATTTGCATAACTg cgatattttgaaaattcgaattCGTGTTCTCGGATCAAAATCCCAGTGTC AAACTTTCAGAAATGTATTTGTGAAAAAGTTTCATaagttttctaaaaat taaGTTAAGCCAAAACTTCAATAGATCTAACATCTAAATGCAGCTCTAAG GGAGTATGGTGTGTACAATGCTATGTAATGATAGTAAGGAATGAAAGAAA TGGTGCATAAGGGTTGCAAGGATTTTATTTATTCTATGAAAGTATTTAAA GATTTGTGAACAATTATTGTCGTTGAGTTAGATCGATAACGACTGGTTGT TGGTTGATGGCTGACAAGTTGGGAATGGGTGTGATGTTTCGTTTTGCTTG TTTTCGTGGTCTTTGAATATATTGGGGGGTAGTATTTTGTTGATAAGCTT GGGTGTAAATTCCTGATGGTTGAGGAATGTATGGAAAATAAGCGATATTT TGTGTGGTGTTTTGTTGAGTCATCATTCGAGGGCGTTTATGATAGAAAGC TGGGAAGACGATGTTGTTGCCAACATTGTGTCTTTTGCGAGAACGTAAAG AAGCTATGTCATAGTATGGTTTGAGTGGATTGATTGGTCGAACAGGAGCT GCGGGTTTTGGTGCAGGGGGTGTGATTTCTTTTGGTTTTTCGAACAAAGC CTCAAACAGGTCCTCTTTGGAGGGCTTTGGTGTCACATCGTCATTTTGTG TCACGCGTGACTTTTTGCAAGCTATTTGATCGCCAGAAGAAGATCTTTTT GATCCAACTCGACGGAAGTTCAAAGAATCCGAAAATTCAGACAATTCTGT ATTCAAAGCATCAGTTGAAGATGTAGTTTGGTTTTGTCCGCCAAGTGATG GTTCTTGTGCGACTGCACTGTTGCATGTATCAAGGGGTTTTAGCTCTTTG CTAAACAAACcatttgaattgcttttgagagATGCTTGTTGTGATGTCTT TGGAATGACGTCATCTTTGGTTTGTTGAacaattttgattggttcatttG GTTGATATCGTTCAAGATATCCTCTGCAAGCATCGAGTTGTGATtcttga attttggtgaaattcTCCAAATCATCGAAACTAGAAAAGAGGAAAAGAGT TGATCGAATTCTGAAATGATTTGgtggaaaatatttcaattcgatGTATG AACAAGTTCAAAAAACGAACAACcactcaacaacaacaatacATCATTTG AAATCGATTTCTTACCTTTCTTTTAGATATTGATAAATTGATTTTAATTC GTTGATATCTTTGATACAGTCCAAACCTCCAtcaatttcttttaatttcC GTTGGCAAATTTTATGGCGATCCCCAAAATCACGTGTCAAGTATTTTGCT TCTTCGATCACCTGATTTAAATTCGCCAAGATTTTTTCTTGAGATGGCGA AAGGTTTCTTCGGCCATTCTTCATCAAAGAAGAAACAATTTCTGCCGAAG CAAATAAGTTGATTTGAATTTGTGTGATGTACGTATTCAAGTCGTTGTAT CTAAAATTGGGGAAATAAGATCAgttataaacatcaaaacaccTTTTTAG CGCTGACAGTCACTCCCTTTACTTCCCTTCTACATGTTTTTACATCTAAC AGAATGATTTAGGGTTCAATNAAAACACCTTTTTGGCGCTGACAGTCACT CCCTTTACTTCCCTTCTACATGTTTTACATCTAACAGAATGATTTAGGGT TCAATGAAAAGTATGTAGATGAAATTTTACCTCTCTCGGAGATTTCTATA TGCTTTTCGGACATCAGATCTCTTTGTGATGATATCTAAAAGAATATCTT CTGCATCATCTTGTATCTGACTGCAAAACATGGGACCACAATATCGATAT TGATCTTTGTTTCCAACTGCTTCGTCGATCAAATCTTTCAACTCGCCCCA GGCTTTCGCGTTGTCGAATTTGGAATTCATTTTCAAGTTTCGACGAATTT GGAACAAAAGGATGCACCAGAACAAATTTAGTATGCAAAACAATCCAATG AAATAGTATTTCTCGCGAATAATCGAAAGAAATAGCGAGAGCTGATAAAA CACAGCCACTCTTCAGAATCAAAATTCCTACctaaatttcatttcaacac CGCGCGTGTTTTCTTAAAgcgaaaaaaatttgacgtcaatatTTTAATTG ACGTCATTCAAGCTACATATCGACAGCAATGATGACGAAACCAAATGGTG GAGAGGATTGTTCATTCTTGGAGACGCAAAGGGGATTTTGGACTTGGACT TTTGGGGTTTCTAAGTAACTTTAGCTAATTAATTCCTGTGTCATATATTG TCATATATTACACGATAAATTTCATATTCAGGAGAAGCCGCAAACTGCAA CAACGACCACCATCAAAGAAACCATAAACCCTGGTGAGGACATTCGCTTC GCTATGCTATGGGATTTTGGTGGAAGTTTGATTTAGATGTTGAAAAGATT TTAGTTATTTATTAAGTTTTTTATGGGATTTTCCTGAGATTTTACCTTTA TCTTTCTTGCACAGAGAAGCGTGTCAGCAATTTcgattttgctatttttt ccctTGTAAAATTCCTGAGATTTGTCGAGTAACAATGCTCTGCTTTCTTA TTTCAACATTCTTCATCATTCTGATTTCACACAATTCTGGTGACTTTAAT CTGTTCACTATTATTTTCACTAATTGTTGCTAAGCTACTTTTTTTCCTGC AATTCCTTTGGGCGTATTTTTCACTCCCTTTTGTCTCTTTCGACAAAGCT AATCTTTCTtttcatatttcattttcagaataCAACGGTGTTTTCAAAGT GCTTATTGATCGCAAGCAAAGTGCTTTTAAAAGGTTTTGTAGGCGTGGCG TGGTCAACTTCAAATTATTTTATGTCAGGTAGGTGGAATGTTgagtctat atattaatacgcttaaacgtgtgtgtttacaacattttgtaaaaagtttt cgcaaatctaacaaagctctacaaagcctcctcttcatggcgttgaacca tcatctttttgcaccctaagcagatttcctaccactagactaactttgag accccaagatactattttctacTCACCAAGTCtttggagcttgatgggtt aaaatcaaccatcttcccaatttttttttctcgttttaaagaattcttat tcttaaaactttctgtttacaatagcggctccctatcactttcaaaactt ttcaaagtctataaaagtcaccctcgaatgtccaaccacgatggctagcc acgatggctaaaaagatctaaaatatatatacttttgctaagccatttat ttaattgtggttaaaaattacaatgcaatgttatcttctttctcctttat ttcttaaaatcaaaatcaaatcatcacTCGGCGGCTATCTTTCTTCCGtt agaattttttagatgtgtagtgattcactggaatgggacacgcagcgtgc gacgctgcgcatacggctagttgATTTTAAACGTTCTCAATTTACTAACT ACAGTGCagtcataactcgaacacgaaCGGGGAATGCAataaacttgttc gagttgtagaggttcgagttaaagagacgcCACTGTATAACCCATAGTGT CCTAGTAGGTTGGTTCCCCaacttgaaaatcgaaaaaagtcCCTCTTTAG TCCCCCCTaaggttttacaaaaaaatttccccTTTGAAAATTGTGTTAAA CTTCTCACAAAACCCACATTTAGTATGGAAGTATTATTTTAAAAGAATAC TATGTAACCAAAGAGAAAAAAGATATCGAAACTTGAATCGCATTGTATTT GTCCATTAAACTGCTTGCTTTTTTCTGGTTGTAGAGGCTTTCTGAAGAGT GACAAAGCAATCGGACAAGCGAGCGTCAAATTAACAGGATTCGCCAACAA ATGTGAAATCCACGAATGTGTTGATGTAAGTtcgctttcattttcttctc cTAAATCTCTTCAAACATTTCCAATCTAAATCGCTGGCCTGGGACATTCC AAGACAGGACCACGATTCGCTATGCTTGTTCCTTTAATCTTACCCAtcca attcaatttttcaatttctctaCATTTTTTCCGTAGATCGTCGACCTGGA GAAAGGTCGTAAAGCAATTGGTGGGAAGATAGAAATCGTGCTCAAAATAC GCGAACCTTTTGTAGACAAAGATACAGAGATTGTCAACGAGAAATGGTTG ATATTAGATGCACATCTGCGCAAACTCGATATGGTAAGATGTTAGAAATG CTGTGTGATACCAAGCACTGCGATTTGCTTTGAAATAACATTATCTTTCC TTTAAACAAATACTACTTTTCCAGGAGGGAttcgttttattttgattgtG TTTCATTGAtcttccaactttttttttcagaaaacccCATCAGCAATTCC TCAAGGAAAAGCCGTTAGCGCGTGAGTATagacattttcttttcttttga attatttcaaaataatttacttcTCCCCACCTGCTTAGGTATCAGAGATA TCCACCAATATGCAATTTTTGACCTCCACCATGAAGAATTCAAGAAATTT GAGATAGTTCACCAGGCATTTGTCTGTCTGTCTTTTGACCGGCATCTTTG TTCTGATCTCTAGCCATCCATCGAACGGTCATCAACACATCAAACTACAT TCTTTATGAACGAATCTTTCTTCCGATAATTTTCTCTTTCTACTATTTCT TTCTTCTCCATAGAAATTCGAAAGTTTGCGCCATTTCTTGAATTCTTATT GGTGGAGCATAATCCATTGCAGAAGTTTTGTTCGAAATTTTATTTACtat catttttattgttttttacacaggatataattttttgaaggggattttta gttttctttgtaaatattttttgtacataAGATGCTTTTATAAGACTGtt aatataagaaaaaaaggagCACCATGATGAATTGAATCATTACATTGTCA GTATTCTTGTCTATGCAATTAATATATTGTGTAGATTGTGTAGATCATGA AATCAATGATTTTACCCAATTAAATAACTGAGAGAAGCTGAACCGTTTCA TATTTTTTGTCTTTAGATACGAAAGTTTAGAAGTCATGAAATCTGAGAAA TCGCTCTTTGAACGACAGGTAATAATCATACCTTTCAAAtcccttttttt ttaattgcgtATCTCCCTAACTTGtaacatttttggacctacctccgggt accccggtggaggttctataaattaacccatgtccgttcgtccgtccgtc cgttcgtccgtctgttaccagcttttctcaggattgactcattagttttt tctgattttttgcggagcccgatttttgagaaaaaatttatttgggcaaa tttgggccaaaaactacctaaaaatagggttttttggactttgtgcaaaa tcctgtcattacttttttctgattttttgtacaaagatggagggcaagat tctctaaagaatggctgaagtggtttttttccgaaaaattcttattcgcc ttaaaaaacggatttccgtattttggggaaattacctttaaccaaataag aaaatatagcttttctcaaagttgactcattatttttttctgattttttg cacaatgatgcaaaatggcaatgcctaaaatgtgacagatGTTTCGGCTT TTTTTACCTTTATGCCCGCACTCCATAACTCTATATTACTCTCCATAACT TGCTCGAACATTTCACTGAGTTTCTGACTATGTTCAATGAATTAATAATT TCTCCTTATAGGTAGCTGCTTACAAACAGCAAGGCAAACAACCTCCAACA GAGTTATTACATAAAATCAAATCTCACAACGAAAGTATGATAGCCATCCA AAATCGCCTGAAACAAGGAGGAAAGCCAGCTGTTATAGGTTCGTAAgtct ttgtcaaattttcttcCCAAATCGGCTGTTAGATAATTTCAAGTGATTTT GTCTCTGTATGacctttttggatttttatGGATATCTTCGGTTTTTTGTT TAGAATATTTGAAGAATTTGGGTCGTGGAGTAGAAGTGGAGATGAAGAAC GCGCAAGTTGCTGCTAAAAAGAACGATGACGTAAGAAATATTACAATACC AATGCAAAGTCGAACCCAGTTCCTTTGTTCACTTTTTNTGCTAAAAAGAA CGATGACGTAAGAAATATCACAATACCAATGCAAAGTCGAACCCAGTTCC TttgttcacttttttatgattctaaaGTTTGTCCCAAAAGTATGTGGACG CTTtagtttttgaacattttctcaGCACCCATTAATGTTATGTTAGAAAG TTaaacaccgttggaaagatatttccaaggaaaataaaataaatgaaatt ctTTAGAATGTTTGAATCTTGCTGATTTTAAAACAGCAAAAATGACCAAC TTCACAgtgctgtaactttttatctaaggaaaatacaaaaattctGAATA GAGATGTAAAATCAGCAAGGTTCAAACATTCTAAAGAATTTCATGAAGTT CATgtcatgatttttaaaacaatacaatttttttcattttttttctttat ttttcaacttttaaaaaatcttttatcctttagattaTTTTCTTGAGAAA TATCATTCTAACGGTGTATAACTTTCTAACATAGCATGAATAAGTGCtca gaaaatgtcaaaaaactaaagtgtccacatactttaGAGAGAGAGAGTTT GATACGTATCGTAAATTGAAAAAGTGTCTCGAAGCATTCAAGGATTAATT TAATCACATCTTTTTTGCTAGTGGGTATGTGAACTATGAAAATGTAGAAA TTGCGGAATTGGAACGAGTTTCTTATTATGATAAATAAAGGAACTGTTTT TCTCCCGTTAGGATATCATTCTCTGACAAACCCTCCTTTTTCAGAAAAct gcaaaaaattgtttggttaaGAAGAAATTATTGGACAAAGaggtaaaata taaattttctttgtcttcgATTTTCCCTCCTACTATTATTCACTCGAATC CAGCGGCAAATCCAGCAAATGGCTTTTTTTTTATCCAAAGACGGttaaaa gggaagaaattttgacgggaatttaatttggattAGGAAAAATGCTAATT ATGGAGTATGACGGATTTTTTTCAGGGTTAAAACAATGTGACTTtcaact ttgtgaaaaattaaattaaagaatAATAATAGTGGGAActtgatttggcg gatttcTGACATATCCGCCAAATtctcttcccgccaaaatttgcTTCCCG TAAAGTATATGATAAATTTAAGGAAATTCAGCTATCTTAGCTTTGGCAAA CTGAATCTTGGTTTAGGGAAatgaaattaggtattttttttaacaaaaag gaAACGGTTCTTCTTGTTTCAGATTGGAGTATTGAAACAAAGGCTGGGAC TTTGATGAGATAAGTGGCTTAAAGTTATTAccaatttatttttatacatt TCTAGGAAAATacgaaatattaaaaactaAAATGTATTATTTATGTACAA ACTTGAAATAAGatcggaaattttcaaaacgtatatggAATATTATCGTA AACTACAGAATATGCATCGAAGATTTacaaaaatgttagattctGGCTGC CCGGTACACAAAAAACTCTGTGAAATCTATTTTAAGATGCTCGGACCaat gaaaaatcatgaaaatagtAACACGGTTTAGCAGTTGATACGTTGATGAA TTTTTCAGCAAATTTCTTCGCCCAACGTTCCAAATTTTATGGGTTATGCT TTCACAGTATTGTCAACATATTAATAATTCTTTACTCCACACACGACGTT TCATTTTCCAATTTGGTATTATATTTGTTGCCAGTTTTTTCTAAtcattt gtttatgtttattgTATTGTAATTATCAATTGTTTATATGATATTGGAAT AAATTTTCCGTCCGAACGTCTTTTGTAGCGGACGGTAGTTATCACACATC GTCCCTTCTCGATTCACTTTGGTCGATCGCAACTGCCGAAATTCTTGCAA CTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000572XLOC_000572Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000982-exon-sc0000007-1491911889:248251..248272TCONS_00000982-exon-sc0000007-1491911889:248251..248272Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:248251..248272TCONS_00000982-exon-sc0000007-1510915933:248251..248272Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:248251..248272TCONS_00000982-exon-sc0000007-1575043694:248251..248272Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:248479..248619TCONS_00000982-exon-sc0000007-1491911889:248479..248619Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:248479..248619TCONS_00000982-exon-sc0000007-1510915933:248479..248619Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:248479..248619TCONS_00000982-exon-sc0000007-1575043694:248479..248619Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:248732..248790TCONS_00000982-exon-sc0000007-1491911889:248732..248790Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:248732..248790TCONS_00000982-exon-sc0000007-1510915933:248732..248790Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:248732..248790TCONS_00000982-exon-sc0000007-1575043694:248732..248790Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:248901..249017TCONS_00000982-exon-sc0000007-1491911889:248901..249017Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:248901..249017TCONS_00000982-exon-sc0000007-1510915933:248901..249017Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:248901..249017TCONS_00000982-exon-sc0000007-1575043694:248901..249017Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:250054..250127TCONS_00000982-exon-sc0000007-1491911889:250054..250127Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:250054..250127TCONS_00000982-exon-sc0000007-1510915933:250054..250127Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:250054..250127TCONS_00000982-exon-sc0000007-1575043694:250054..250127Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:250295..250350TCONS_00000982-exon-sc0000007-1491911889:250295..250350Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:250295..250350TCONS_00000982-exon-sc0000007-1510915933:250295..250350Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:250295..250350TCONS_00000982-exon-sc0000007-1575043694:250295..250350Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:252782..252833TCONS_00000982-exon-sc0000007-1491911889:252782..252833Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:252782..252833TCONS_00000982-exon-sc0000007-1510915933:252782..252833Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:252782..252833TCONS_00000982-exon-sc0000007-1575043694:252782..252833Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:253229..253328TCONS_00000982-exon-sc0000007-1491911889:253229..253328Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:253229..253328TCONS_00000982-exon-sc0000007-1510915933:253229..253328Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:253229..253328TCONS_00000982-exon-sc0000007-1575043694:253229..253328Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:254285..254375TCONS_00000982-exon-sc0000007-1491911889:254285..254375Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:254285..254375TCONS_00000982-exon-sc0000007-1510915933:254285..254375Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:254285..254375TCONS_00000982-exon-sc0000007-1575043694:254285..254375Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:254537..254683TCONS_00000982-exon-sc0000007-1491911889:254537..254683Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:254537..254683TCONS_00000982-exon-sc0000007-1510915933:254537..254683Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:254537..254683TCONS_00000982-exon-sc0000007-1575043694:254537..254683Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:254831..254871TCONS_00000982-exon-sc0000007-1491911889:254831..254871Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:254831..254871TCONS_00000982-exon-sc0000007-1510915933:254831..254871Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:254831..254871TCONS_00000982-exon-sc0000007-1575043694:254831..254871Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:255517..255568TCONS_00000982-exon-sc0000007-1491911889:255517..255568Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:255517..255568TCONS_00000982-exon-sc0000007-1510915933:255517..255568Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:255517..255568TCONS_00000982-exon-sc0000007-1575043694:255517..255568Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:256212..256338TCONS_00000982-exon-sc0000007-1491911889:256212..256338Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:256212..256338TCONS_00000982-exon-sc0000007-1510915933:256212..256338Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:256212..256338TCONS_00000982-exon-sc0000007-1575043694:256212..256338Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:256454..256530TCONS_00000982-exon-sc0000007-1491911889:256454..256530Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:256454..256530TCONS_00000982-exon-sc0000007-1510915933:256454..256530Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:256454..256530TCONS_00000982-exon-sc0000007-1575043694:256454..256530Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:257345..257392TCONS_00000982-exon-sc0000007-1491911889:257345..257392Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:257345..257392TCONS_00000982-exon-sc0000007-1510915933:257345..257392Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:257345..257392TCONS_00000982-exon-sc0000007-1575043694:257345..257392Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1491911889:257823..258453TCONS_00000982-exon-sc0000007-1491911889:257823..258453Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1510915933:257823..258453TCONS_00000982-exon-sc0000007-1510915933:257823..258453Clytia hemisphaericaexon
TCONS_00000982-exon-sc0000007-1575043694:257823..258453TCONS_00000982-exon-sc0000007-1575043694:257823..258453Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:248251..258453 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.90569 3.5515 1.87655 2.21864 0.893944 6.12243e-08 3.87355 4.23874 3.58006 4.17431 5.46595 2.94914 3.66902 5.06219 2.75637 2.56772 3.19227 3.72935 1.74907 3.35563 1.93657 1.50566 1.52123 2.41893 1.89604 3.80734 1.10151 1.88501 1.68246 2.46764
Blast
BLAST of TCONS_00000982 vs. Swiss-Prot (Human)
Match: C2D1B (Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens GN=CC2D1B PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.051e-34
Identity = 83/277 (29.96%), Postives = 143/277 (51.62%), Query Frame = 2
Query:    8 VDLTTVPSVRPTKGASTQQGSSPTGLREEIKMTGTNNENYVFVETALQRQIEAAEKNTAHYKLMGNLDAAKNFEMLLKNSQKDIMTLQQYKANKSPVPKCFYVKKTFPVTKSNPHLSDSELEITVVRCLNVPLQQGYQPKDMYTYVTCEMAYXXXXXXXXXXXXXXXXXN-PEYNGVFKVLIDRKQSAFKRFCRRGVVNFKLFYVRGFLKSDKAIGQASVKLTGFANKCEIHECVDIVDLEKGRKAIGGKIEIVLKIREPFVDKDTEIVNEKWLILD 835
            VDL+ VPS       + ++G       E+++++    E Y  ++  L  Q E     +  +   GN+     FE L ++ +K +  LQ  +A     P   +  KTF   +    L+ +E+ + +VR +N+P   G  P D+  +V  E  YP       + T + +  N PE++ +FK+ I+R    FKR  +   + F++F+   F +SDK +G A +KL    N+CEI E V+++D   GRK  GGK+E+ +++REP   +D ++V E WL+L+
Sbjct:  586 VDLSKVPSP-----LTDEEGDFILIHHEDLRLSQKAEEVYAQLQKMLLEQQEKCLLFSKQFMHQGNVAETTRFEKLAQDRKKQLEILQLAQAQGLDPPTHHFELKTFQTVRIFSELNSTEMHLIIVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEFDQLFKLNINRNHRGFKRVIQSKGIKFEIFHKGSFFRSDKLVGTAHLKLERLENECEIREIVEVLD---GRKPTGGKLEVKVRLREPLSGQDVQMVTENWLVLE 854          
The following BLAST results are available for this feature:
BLAST of TCONS_00000982 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
C2D1B5.051e-3429.96Coiled-coil and C2 domain-containing protein 1B OS... [more]
back to top