Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000981 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000981
Unique NameTCONS_00000981
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3482

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000981 ID=TCONS_00000981|Name=TCONS_00000981|organism=Clytia hemisphaerica|type=transcript|length=3482bp
aaCATAATTGTCTGTTCATTGGATATTGATTTCAGACTCAAAGTGATAGA
AAATGTTTGGAAGTGGAAAGAAAGGCAAATCAAGAGCCAGCAAATCTCCA
AATGATGATATGTCCAATGTGATGGGTTTAGGTGGCATGGATTctgatga
tgaagatgaatCAAGTCTTTTGGCAGAACTTGCTGCTCTTGAAGGGAGAC
CTGTAGCTCCCAAAAAAGCTAAACCCAAAAAAGCCTTGGTGAGCATGGAT
GAGATTGACCGTGAAGCAGAAGCAGGTATGGCTGATATTCATGATGGTGA
GATCAACAATGaagatgattttgatgaaaatgatttgcTGGCTGAATTAA
ATGATATAGTAAGCGATGAAGAAGATAAACCTCCGCCACCCAAAGTAGAG
AAGCCTGCAGCAGCTTCATCTGGTGGGATGCAGAAAACGCTAACAGATCG
TCGTGAAATCTATGTACAGGCTATCGCTAATGCAAAAGCAGAAGGTGCTT
CCTCGAAAGTCCGAAGATTCGATCGTGGTCTGAAGGAAATAGAAAGATTG
ATCAAGAGCGTTTCGAAAGGTGCCACGATTTCTGAAGATGATATTCCACC
TCCAGTAGTTGTCAAATCCAGTTCGCCCATTAACCCTAAAACACAAACac
tacccccacctgaaaaaccAGGACGGGCCACCGTTATCACGCCCGTTGAA
CCCTTCACTGCACCAGTTGAAACTCCACCCACCCGCACACCGGAACCCCA
ACCAGTCACTGCACCCACACCTCAACCACGCCCCACAGCTACACCACCAG
TTCAACCAACAACTCAAgacaatgaaaaattgaatcttCTTTTGGAAAGA
CAAAAGCAATTCAAAGTTTTAGCATTACAAATGAAACAAAGAGGAGATAT
TGATGGTGCCAAGAAAAATTTGGCAATCGCAAAACAATTCGACAGTGTGA
TTGCTGCAGTGAAAGAAGGGAAGGAGGTTGACCTCTCAAGAATGCCACAA
GTTCCCTCAGTATCTGAACCGTCGCCTGCGGCACCACCACAACAACCACA
AGCTGCTAGCTCCCCACCCAAACAGCCAGTAGCACCACCATCATCATCGT
CTACACCAGGTGCTCCTTCCACTGTCTTAGAAGCTTTAGAGCAGCGTTTG
GAGAAATATCGTGAAACTGGTGCTAAAGCTAAAGAGGAGGGGAACAGCGG
CAAAGTGAGACGTATGGGTCGAATTGTAAAGCAATTCGAAGCGGCGATAA
AAGATTACAAAGCGAACAAACCAGTAGATTTCAACGAATTACCATGTCCC
CCAGGCTTCGGTCCAATCCCTGGTGAAACACAAGCAGAAGAACCTGGCGA
CCCTCAAGAAATGGCTCAAATGTTGATAAACGCACCTTTAGACGGACCTG
AAGAAGATGACACGCCCAAACCACCATCGTCCAAATCTGTTGCACCCGCC
CCTTCACGCCCTGCTGTTGTCAACCCTGGAGTATCAGGAAGTCGCAACGA
GAACCAGTATCAATTTCTTGTCACTCGTCAAAAGGAATTCAAGAAAGCAG
CTCTTGAAGCTAAACATGCAGGCAACATTGATCAAGCTAGAGATTATCTC
CGAAAAGCAAAGGGATTGGATCCGATGATCGAAGCTGCATCCAGTGGACT
TGGTGTGGATCTCACAACAGTTCCATCGGTGCGACCGACCAAAGGAGCGT
CAACACAACAAGGCTCATCACCTACTGGTTTAAGAGAAGAAATCAAGATG
ACTGGAACGAACAATGAAAACTATGTGTTCGTTGAAACCGCTCTTCAAAG
ACAAATTGAGGCCGCAGAAAAGAACACAGCTCATTACAAATTGATGGGAA
ATTTAGATGCTGCCAAAAACTTTGAAATGTTGTTAAAGAACTCTCAGAAA
GACATAATGACGCTACAACAATACAAAGCAAATAAATCGCCCGTTCCCAA
ATGCTTCTACGTCAAAAAGACCTTCCCCGTTACAAAGTCCAATCCACATT
TGAGTGATTCTGAATTAGAGATCACCGTGGTTCGATGTTTGAACGTACCG
CTACAACAAGgctACCAACCAAAAGATATGTATACTTATGTCACTTGTGA
GATGGCCTATCCTACGGAGAAGCCGCAAACTGCAACAACGACCACCATCA
AAGAAACCATAAACCCTGaataCAACGGTGTTTTCAAAGTGCTTATTGAT
CGCAAGCAAAGTGCTTTTAAAAGGTTTTGTAGGCGTGGCGTGGTCAACTT
CAAATTATTTTATGTCAGAGGCTTTCTGAAGAGTGACAAAGCAATCGGAC
AAGCGAGCGTCAAATTAACAGGATTCGCCAACAAATGTGAAATCCACGAA
TGTGTTGATATCGTCGACCTGGAGAAAGGTCGTAAAGCAATTGGTGGGAA
GATAGAAATCGTGCTCAAAATACGCGAACCTTTTGTAGACAAAGATACAG
AGATTGTCAACGAGAAATGGTTGATATTAGATGCACATCTGCGCAAACTC
GATATGaaaacccCATCAGCAATTCCTCAAGGAAAAGCCGTTAGCGCATA
CGAAAGTTTAGAAGTCATGAAATCTGAGAAATCGCTCTTTGAACGACAGG
TAGCTGCTTACAAACAGCAAGGCAAACAACCTCCAACAGAGTTATTACAT
AAAATCAAATCTCACAACGAAAGTATGATAGCCATCCAAAATCGCCTGAA
ACAAGGAGGAAAGCCAGCTGTTATAGAATATTTGAAGAATTTGGGTCGTG
GAGTAGAAGTGGAGATGAAGAACGCGCAAGTTGCTGCTAAAAAGAACGAT
GACAAAActgcaaaaaattgtttggttaaGAAGAAATTATTGGACAAAGa
gATTGGAGTATTGAAACAAAGGCTGGGACTTTGATGAGATAAGTGGCTTA
AAGTTATTAccaatttatttttatacattTCTAGGAAAATacgaaatatt
aaaaactaAAATGTATTATTTATGTACAAACTTGAAATAAGatcggaaat
tttcaaaacgtatatggAATATTATCGTAAACTACAGAATATGCATCGAA
GATTTacaaaaatgttagattctGGCTGCCCGGTACACAAAAAACTCTGT
GAAATCTATTTTAAGATGCTCGGACCaatgaaaaatcatgaaaatagtAA
CACGGTTTAGCAGTTGATACGTTGATGAATTTTTCAGCAAATTTCTTCGC
CCAACGTTCCAAATTTTATGGGTTATGCTTTCACAGTATTGTCAACATAT
TAATAATTCTTTACTCCACACACGACGTTTCATTTTCCAATTTGGTATTA
TATTTGTTGCCAGTTTTTTCTAAtcatttgtttatgtttattgTATTGTA
ATTATCAATTGTTTATATGATATTGGAATAAATTTTCCGTCCGAACGTCT
TTTGTAGCGGACGGTAGTTATCACACATCGTCCCTTCTCGATTCACTTTG
GTCGATCGCAACTGCCGAAATTCTTGCAACTG
Run BLAST on NCBI

transcript from alignment at sc0000007:243363..258453+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000981 ID=TCONS_00000981|Name=TCONS_00000981|organism=Clytia hemisphaerica|type=transcript|length=15091bp|location=Sequence derived from alignment at sc0000007:243363..258453+ (Clytia hemisphaerica)
aaCATAATTGTCTGTTCATTGGATATTGATTTCAGACTCAAAGTGATAGA AAATGTTTGGAAGTGGAAAGAAAGGCAAATCAAGAGCCAGCAAATCTCCA AATGATGATATGTCCAATGTGGTATGTTACTCCataaaaatgtgattttt ttgccctttttgtcTAATATTTGATTGTCTATATTCGGATCACCCTAAGT TAGAAGAGAAGCAGAGTAAATTGGGTTAAGATAAAACgggtgaaaaaaat taaagtggGAATTAGGGTATATGcattcatttttcatattttgttgcTGT CATTTTTCAGATGGGTTTAGGTGGCATGGATTctgatgatgaagatgaat CAAGTCTTTTGGCAGAACTTGCTGCTCTTGAAGGGAGACCTGTAGCTCCC AAAAAAGCTAAACCCAAAAAAGGTAATAATTATAAAACAATGAAGATAGC TGAAAGCTATTTcatcaagattttttcaatatttcatttttataacaTTA TAATGCTATCTACACCGATTAAAAGTTTCTTAAATCTTAATAATATATAG CCCATTTTATCGTACTCACACAGCCTTGGTGAGCATGGATGAGATTGACC GTGAAGCAGAAGCAGGTATGGCTGATATTCATGATGGTGAGATCAACAAT GaagatgattttgatgaaaatgatttgcTGGTAAGATGCCTCAGTTCTGC TCagttttctttttattagaTTGTAGTTCACTCCCAGAAAATCCCCAATG GTGATTTGCCCCCTTGAAAATATCCACAAGAAAATTCCCTCTGTTGACCA ACTATGggtttttcccaaaaaatttttttcattctcgTTCAGAGTTGGTG CCAATTATTGAGTGCGTAAGGTCTTTAGAAATTAGCTATTAGAGGAAATA TTTGTTTCAACAGCAAATGAATGTACCTAGGATCCTGGACTTTCTGAGTA ATAGACTTTTTTGGGTGttttactttaggcgtacaaactttcgcgagcag aaactttcgcgaggacgaaaaatcgcgaaattcacgacatttactttcgc gaatttaacggaaaaatattTTTCGCGAGCATAAACattcgcgaatcaag acgtaaaattgagaattttcacacgaaaaaatggcttagagacacaaata cttcttgggttggcttgaaacatttgtcctttgacttattagtcttttag cNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttctgc tcgcgaaagtttctacgcctaaagtattctcctcaaacaaatattttagt aaattcttgaaaaatacttcaaataaggcgaattttctttcttttgaaaa tctatCGTGGCGAATTCAGGGGAAATCTTCTGCAGAATTTTCTGGAGCAT TTTCTGGATGGAACTCTTGGTCTTTCTCTACATTTGATGAGTTCAACTTT CTTGGTAAAAGTaggtattccttttgcagccatttaatttatttttgcgc atcttttttttgttttcctcaGGCTGAATTAAATGATATAGTAAGCGATG AAGAAGATAAACCTCCGCCACCCAAAGTAGAGAAGGTAAAGATTTATGCC ATTAGTTTTTAAAGTTCTTTCGTCTCAGTCAgataaaaatatgatttttg tCGCAAGATTCAGTAAAATTGTTTATAAACATCGAATAAATTTGGTTGTT GTGTAAAGCAAttttctgtctcaaaattctaCTATAAGCACACAAATATT TTAAGAGATGAAATTTAGTCTGGAAGAAATATCACCCCTGCTAGTTTTCT TTTGTGAAGTGAAGAATGTAGGAGATTGAATAAAGTTTACAACTTTCTGT ATTTAGCCTGCAGCAGCTTCATCTGGTGGGATGCAGAAAACGCTAACAGA TCGTCGTGAAATCTATGTACAGGCTATCGCTAATGCAAAAGCAGAAGGTG CTTCCTCGAAAGTCCGAAGATTCGATCGTGGTCTGAAGGTTTGTTTGATA TTCTTTGAAATGAGTATTGAATCCAGTGACAAGAGCtgatttaacatttt ttattattatgttTCTATGATTTTCCTAGGTAtttgcagattttcatgat CGGATCTGTTctaacattttgattttgtttcaaATCCAATTTCGCATTTT GTAGGAAATAGAAAGATTGATCAAGAGCGTTTCGAAAGGTGCCACGATTT CTGAAGATGATATTCCACCTCCAGTAGTTGTCAAATCCAGTTCGCCCATT AACCCTAAAACACAAACactacccccacctgaaaaaccAGGACGGGCCAC CGTTATCACGCCCGTTGAACCCTTCACTGCACCAGTTGAAACTCCACCCA CCCGCACACCGGAACCCCAACCAGTCACTGCACCCACACCTCAACCACGC CCCACAGCTACACCACCAGTTCAACCAACAACTCAAgacaatgaaaaatt gaatcttCTTTTGGAAAGACAAAAGCAATTCAAAGTTTTAGCATTACAAA TGAAACAAAGAGGAGATATTGATGGTGCCAAGAAAAATTTGGCAATCGCA AAAGTAAGTGGGTATATTTTTAGGAATTCCCTGACTTCAAATCAAATAAC TTTCAAATCTCAATCTCAACCAATGAATTGATATTTTAAGTTCTTATATT TTCTCATCTTTAGCAATTCGACAGTGTGATTGCTGCAGTGAAAGAAGGGA AGGAGGTTGACCTCTCAAGAATGCCACAAGTTCCCTCAGGTGAGAAAATC GTTACTTGGGTGACGGCGTTGTTTATTAGGTAATAGTAAGTAATAGTTGT AATAttctatttgttttattttcatcataGTATCTGAACCGTCGCCTGCG GCACCACCACAACAACCACAAGCTGCTAGCTCCCCACCCAAACAGCCAGT AGCACCACCATCATCATCGTCTACACCAGGTGCTCCTTCCACTGTCTTAG AAGCTTTAGAGCAGCGTTTGGAGAAATATCGTGAAACTGGTGCTAAAGCT AAAGAGGAGGGGAACAGCGGCAAAGTGAGACGTATGGGTCGAATTGTAAA GGTAGTTATTAGCCTGTTTAGATCTTTCATCATCTATGATACAAACTTCA TTTTTGAATTTGCTTGTAATTTCAATTATATCTTCTCACGCTTGTATTTC CAAGTCATATGAACaccaaaaacattattttgtgCATTGTATTAGATAAT ATGTaatcttgtttttctttcttgttttttcagCAATTCGAAGCGGCGAT AAAAGATTACAAAGCGAACAAACCAGTAGATTTCAACGAATTACCATGTC CCCCAGGCTTCGGTCCAATCCCTGGTGAAACACAAGCAGAAGAACCTGGC GACCCTCAAGAAATGGCTCAAATGGTGAGACATGATCATGTTCTGTTTAT TACCTTCAGTAGAATGATTTACAcgaggattatatttcgcgagtTTCACG ATTTTCCCCGAAAATTCGTGAAATTTAATGCTCGCAAGAATTTTTTAACC aagtttttttcccaaaaacctTCTTTGATTCTTTTCCAAAACCTCTATGA AAAATGGTTTAGATGGGACGATGGCTTCGTTTCATTACATTATTAATACT ATGCTACACTGTGGCTATTCAACAAGAATTTCTGAACGACCACACTATCA TTCGTTTGAAGAGATTCaactttgaaataaatattCTCGCTTTTTCCACA GTTGATAAACGCACCTTTAGACGGACCTGAAGAAGATGACACGCCCAAAC CACCATCGTCCAAATCTGTTGCACCCGCCCCTTCACGCCCTGCTGTTGTC AACCCTGGAGTATCAGGAAGTCGCAACGAGAACCAGTATCAATTTCTTGT CACTCGTCAAAAGGAATTCAAGAAAGCAGCTCTTGAAGCTAAACATGCAG GCAACATTGATCAAGCTAGAGATTATCTCCGAAAAGCAAAGGTACGCTAT CATCAAGCTGACATTCAttagacaaaaatatttgtgaacattttttgatt tgtttaaaCTATTTCAATGTTGCTCTTTCTCGTTTCAAGGGATTGGATCC GATGATCGAAGCTGCATCCAGTGGACTTGGTGTGGATCTCACAACAGTAC GTGATCGCTTTGATCCTCACTGAAAGCTTTTTTGATCACTCATTAATTCA TCTACCTTTCCTCAATATTTCTAGAAATCTTTTATGTGATAAAATAATCA AGTTGAAAGTTACGAAAATTATATGATAAGTTAAAATTACCAATGACGAC GAAAGTTCTAAGttgaaagttaaaaacatcGTGATGATGTACATGCTTTT GCCAATTTTAGGTTCCATCGGTGCGACCGACCAAAGGAGCGTCAACACAA CAAGGCTCATCACCTACTGGTTTAAGAGAAGAAATCAAGATGACTGGAAC GAACAATGAAAACTATGTGTTCGTTGAAACCGCTCTTCAAAGACAAATTG AGGTCAGTGCTTCTTTACCATTGTTACCTCACAAAATTAAGTATTTTATT TCTTGACGGTGAAGTTCGTTTGATAAAGACGattgttttaagttttttaa tttttcatacatAGGCCGCAGAAAAGAACACAGCTCATTACAAATTGATG GGAAATTTAGATGCTGCCAAAAAGTAAGTTTTCCAGCTNTTTGGCGTGGA TCTCACAACAGTACGTGATCCTCACTGAAAGCTTTTTTGATCACTCATTA ATTCATCTACCTTTCTTCAATATTTCTAGAAATCTTTTATGTGATAAAAT AATCAAGTTGAAAGTTACGAAAATTATATGATAAGTTAAAATTACCAATG ACGACGAAAGTTCTAAGttgaaagttaaaaacatcGTGATGATGTACATG CTTTTGCCAATTTTAGGTTCCATCGGTGCGACCGACCAAAGGAGCGTCAA CACAACAAGGCTCATCACCTACTGGTTTAAGAGAAGAAATCAAGATGACT GGAACGAACAATGAAAACTATGTGTTCGTTGAAACCGCTCTTCAAAGACA AATTGAGGTCAGTGCTTCTTTACCATTGTTACCTCACAAAATTAAGTATT TTATTTCTTGACGGTGAAGTTCGTTTGATAAAGACGattgttttaagttt tttaatttttcatacatAGGCCGCAGAAAAGAACACAGCTCATTACAAAT TGATGGGAAATTTAGATGCTGCCAAAAAGTAAGTTTTCCAGCTTTTCCGG CTTCAACATTCTTCTGTATAAATATCAACGGTTTGATTGATGTAATTTTA CCTTGCAATTACataattctttttaatttctttcataGCTTTGAAATGTT GTTAAAGAACTCTCAGAAAGACATAATGACGCTACAACAATACAAAGCAA ATAAATCGCCCGTTCCCAAATGCTTCTACGTCAAAAAGACCTTCCCCGTT ACAAAgtaattttttcttctctttggTTTACGGAATCAGTAATATCTGAT AGTGACTTGACAAAACTAGTCAGTTCTCGATGTAAGTGCTTTTTTCACat gataaatttttcatttttcttacatACAGGTCCAATCCACATTTGAGTGA TTCTGAATTAGAGATCACCGTGGTTCGATGTTTGAACGTACCGCTACAAC AAGGTGAGTGACAATGCTTTCTTTTGTTGAATGAACTTCACTTCACTTTC TATTGATTTTTGAACTTTGCCTGGATGTCCACTTTGACTTTCGATTTCTC CGAACAACTCCTTACGTAAAAAGTCTCATCTTTTGTTTAGACAACAACCA ctgctttttttttatttcaggctACCAACCAAAAGATATGTATACTTATG TCACTTNGTCAACACAACAAGGCTCATCACCTACTGGTTTAAGAGAAGAA ATCAAGATGACTGGAACGAACAATGAAAACTATGTGTTCGTTGAAACCGC TCTTCAAAGACAAATTGAGGTCAGTGCTTCTTTACCATTGTTACCTCACA AAATTAAGTATTTTATTTCTTGACGGTGAAGTTCGTTTGATAAAGACGat tgttttaagttttttaatttttcatacatAGGCCGCAGAAAAGAACACAG CTCATTACAAATTGATGGGAAATTTAGATGCTGCCAAAAAGTAAGTTTTC CAGCTTTTCCGGCTTCAACATTCTTCTGTATAAATATCAACGGTTTGATT GATGTAATTTTACCTTGCAATTACataattctttttaatttctttcataG CTTTGAAATGTTGTTAAAGAACTCTCAGAAAGACATAATGACGCTACAAC AATACAAAGCAAATAAATCGCCCGTTCCCAAATGCTTCTACGTCAAAAAG ACCTTCCCCGTTACAAAgtaattttttcttctctttggTTTACGGAATCA GTAATATCTGATAGTGACTTGACAAAACTAGTCAGTTCTCGATGTAAGTG CTTTTTTCACatgataaatttttcatttttcttacatACAGGTCCAATCC ACATTTGAGTGATTCTGAATTAGAGATCACCGTGGTTCGATGTTTGAACG TACCGCTACAACAAGGTGAGTGACAATGCTTTCTTTTGTTGAATGAACTT CACTTCACTTTCTATTGATTTTTGAACTTTGCCTGGATGTCCACTTTGAC TTTCGATTTCTCCGAACAACTCCTTGCGTAAAAAGTCTCATCTTTTGTTT AGACAACAACCActgctttttttttatttcaggctACCAACCAAAAGATA TGTATACTTATGTCACTTGTGAGATGGCCTATCCTACGGTATGTACTGTA ATCATTCtttatattttatgattttgaaggttttataaATAACTGAAAAT ATGATTCATTTCCACCACCGTTCCCATTTGCATAACTgcgatattttgaa aattcgaattCGTGTTCTCGGATCAAAATCCCAGTGTCAAACTTTCAGAA ATGTATTTGTGAAAAAGTTTCATaagttttctaaaaattaaGTTAAGCCA AAACTTCAATAGATCTAACATCTAAATGCAGCTCTAAGGGAGTATGGTGT GTACAATGCTATGTAATGATAGTAAGGAATGAAAGAAATGGTGCATAAGG GTTGCAAGGATTTTATTTATTCTATGAAAGTATTTAAAGATTTGTGAACA ATTATTGTCGTTGAGTTAGATCGATAACGACTGGTTGTTGGTTGATGGCT GACAAGTTGGGAATGGGTGTGATGTTTCGTTTTGCTTGTTTTCGTGGTCT TTGAATATATTGGGGGGTAGTATTTTGTTGATAAGCTTGGGTGTAAATTC CTGATGGTTGAGGAATGTATGGAAAATAAGCGATATTTTGTGTGGTGTTT TGTTGAGTCATCATTCGAGGGCGTTTATGATAGAAAGCTGGGAAGACGAT GTTGTTGCCAACATTGTGTCTTTTGCGAGAACGTAAAGAAGCTATGTCAT AGTATGGTTTGAGTGGATTGATTGGTCGAACAGGAGCTGCGGGTTTTGGT GCAGGGGGTGTGATTTCTTTTGGTTTTTCGAACAAAGCCTCAAACAGGTC CTCTTTGGAGGGCTTTGGTGTCACATCGTCATTTTGTGTCACGCGTGACT TTTTGCAAGCTATTTGATCGCCAGAAGAAGATCTTTTTGATCCAACTCGA CGGAAGTTCAAAGAATCCGAAAATTCAGACAATTCTGTATTCAAAGCATC AGTTGAAGATGTAGTTTGGTTTTGTCCGCCAAGTGATGGTTCTTGTGCGA CTGCACTGTTGCATGTATCAAGGGGTTTTAGCTCTTTGCTAAACAAACca tttgaattgcttttgagagATGCTTGTTGTGATGTCTTTGGAATGACGTC ATCTTTGGTTTGTTGAacaattttgattggttcatttGGTTGATATCGTT CAAGATATCCTCTGCAAGCATCGAGTTGTGATtcttgaattttggtgaaa ttcTCCAAATCATCGAAACTAGAAAAGAGGAAAAGAGTTGATCGAATTCT GAAATGATTTGgtggaaaatatttcaattcgatGTATGAACAAGTTCAAA AAACGAACAACcactcaacaacaacaatacATCATTTGAAATCGATTTCT TACCTTTCTTTTAGATATTGATAAATTGATTTTAATTCGTTGATATCTTT GATACAGTCCAAACCTCCAtcaatttcttttaatttcCGTTGGCAAATTT TATGGCGATCCCCAAAATCACGTGTCAAGTATTTTGCTTCTTCGATCACC TGATTTAAATTCGCCAAGATTTTTTCTTGAGATGGCGAAAGGTTTCTTCG GCCATTCTTCATCAAAGAAGAAACAATTTCTGCCGAAGCAAATAAGTTGA TTTGAATTTGTGTGATGTACGTATTCAAGTCGTTGTATCTAAAATTGGGG AAATAAGATCAgttataaacatcaaaacaccTTTTTAGCGCTGACAGTCA CTCCCTTTACTTCCCTTCTACATGTTTTTACATCTAACAGAATGATTTAG GGTTCAATNAAAACACCTTTTTGGCGCTGACAGTCACTCCCTTTACTTCC CTTCTACATGTTTTACATCTAACAGAATGATTTAGGGTTCAATGAAAAGT ATGTAGATGAAATTTTACCTCTCTCGGAGATTTCTATATGCTTTTCGGAC ATCAGATCTCTTTGTGATGATATCTAAAAGAATATCTTCTGCATCATCTT GTATCTGACTGCAAAACATGGGACCACAATATCGATATTGATCTTTGTTT CCAACTGCTTCGTCGATCAAATCTTTCAACTCGCCCCAGGCTTTCGCGTT GTCGAATTTGGAATTCATTTTCAAGTTTCGACGAATTTGGAACAAAAGGA TGCACCAGAACAAATTTAGTATGCAAAACAATCCAATGAAATAGTATTTC TCGCGAATAATCGAAAGAAATAGCGAGAGCTGATAAAACACAGCCACTCT TCAGAATCAAAATTCCTACctaaatttcatttcaacacCGCGCGTGTTTT CTTAAAgcgaaaaaaatttgacgtcaatatTTTAATTGACGTCATTCAAG CTACATATCGACAGCAATGATGACGAAACCAAATGGTGGAGAGGATTGTT CATTCTTGGAGACGCAAAGGGGATTTTGGACTTGGACTTTTGGGGTTTCT AAGTAACTTTAGCTAATTAATTCCTGTGTCATATATTGTCATATATTACA CGATAAATTTCATATTCAGGAGAAGCCGCAAACTGCAACAACGACCACCA TCAAAGAAACCATAAACCCTGGTGAGGACATTCGCTTCGCTATGCTATGG GATTTTGGTGGAAGTTTGATTTAGATGTTGAAAAGATTTTAGTTATTTAT TAAGTTTTTTATGGGATTTTCCTGAGATTTTACCTTTATCTTTCTTGCAC AGAGAAGCGTGTCAGCAATTTcgattttgctattttttccctTGTAAAAT TCCTGAGATTTGTCGAGTAACAATGCTCTGCTTTCTTATTTCAACATTCT TCATCATTCTGATTTCACACAATTCTGGTGACTTTAATCTGTTCACTATT ATTTTCACTAATTGTTGCTAAGCTACTTTTTTTCCTGCAATTCCTTTGGG CGTATTTTTCACTCCCTTTTGTCTCTTTCGACAAAGCTAATCTTTCTttt catatttcattttcagaataCAACGGTGTTTTCAAAGTGCTTATTGATCG CAAGCAAAGTGCTTTTAAAAGGTTTTGTAGGCGTGGCGTGGTCAACTTCA AATTATTTTATGTCAGGTAGGTGGAATGTTgagtctatatattaatacgc ttaaacgtgtgtgtttacaacattttgtaaaaagttttcgcaaatctaac aaagctctacaaagcctcctcttcatggcgttgaaccatcatctttttgc accctaagcagatttcctaccactagactaactttgagaccccaagatac tattttctacTCACCAAGTCtttggagcttgatgggttaaaatcaaccat cttcccaatttttttttctcgttttaaagaattcttattcttaaaacttt ctgtttacaatagcggctccctatcactttcaaaacttttcaaagtctat aaaagtcaccctcgaatgtccaaccacgatggctagccacgatggctaaa aagatctaaaatatatatacttttgctaagccatttatttaattgtggtt aaaaattacaatgcaatgttatcttctttctcctttatttcttaaaatca aaatcaaatcatcacTCGGCGGCTATCTTTCTTCCGttagaattttttag atgtgtagtgattcactggaatgggacacgcagcgtgcgacgctgcgcat acggctagttgATTTTAAACGTTCTCAATTTACTAACTACAGTGCagtca taactcgaacacgaaCGGGGAATGCAataaacttgttcgagttgtagagg ttcgagttaaagagacgcCACTGTATAACCCATAGTGTCCTAGTAGGTTG GTTCCCCaacttgaaaatcgaaaaaagtcCCTCTTTAGTCCCCCCTaagg ttttacaaaaaaatttccccTTTGAAAATTGTGTTAAACTTCTCACAAAA CCCACATTTAGTATGGAAGTATTATTTTAAAAGAATACTATGTAACCAAA GAGAAAAAAGATATCGAAACTTGAATCGCATTGTATTTGTCCATTAAACT GCTTGCTTTTTTCTGGTTGTAGAGGCTTTCTGAAGAGTGACAAAGCAATC GGACAAGCGAGCGTCAAATTAACAGGATTCGCCAACAAATGTGAAATCCA CGAATGTGTTGATGTAAGTtcgctttcattttcttctccTAAATCTCTTC AAACATTTCCAATCTAAATCGCTGGCCTGGGACATTCCAAGACAGGACCA CGATTCGCTATGCTTGTTCCTTTAATCTTACCCAtccaattcaatttttc aatttctctaCATTTTTTCCGTAGATCGTCGACCTGGAGAAAGGTCGTAA AGCAATTGGTGGGAAGATAGAAATCGTGCTCAAAATACGCGAACCTTTTG TAGACAAAGATACAGAGATTGTCAACGAGAAATGGTTGATATTAGATGCA CATCTGCGCAAACTCGATATGGTAAGATGTTAGAAATGCTGTGTGATACC AAGCACTGCGATTTGCTTTGAAATAACATTATCTTTCCTTTAAACAAATA CTACTTTTCCAGGAGGGAttcgttttattttgattgtGTTTCATTGAtct tccaactttttttttcagaaaacccCATCAGCAATTCCTCAAGGAAAAGC CGTTAGCGCGTGAGTATagacattttcttttcttttgaattatttcaaaa taatttacttcTCCCCACCTGCTTAGGTATCAGAGATATCCACCAATATG CAATTTTTGACCTCCACCATGAAGAATTCAAGAAATTTGAGATAGTTCAC CAGGCATTTGTCTGTCTGTCTTTTGACCGGCATCTTTGTTCTGATCTCTA GCCATCCATCGAACGGTCATCAACACATCAAACTACATTCTTTATGAACG AATCTTTCTTCCGATAATTTTCTCTTTCTACTATTTCTTTCTTCTCCATA GAAATTCGAAAGTTTGCGCCATTTCTTGAATTCTTATTGGTGGAGCATAA TCCATTGCAGAAGTTTTGTTCGAAATTTTATTTACtatcatttttattgt tttttacacaggatataattttttgaaggggatttttagttttctttgta aatattttttgtacataAGATGCTTTTATAAGACTGttaatataagaaaa aaaggagCACCATGATGAATTGAATCATTACATTGTCAGTATTCTTGTCT ATGCAATTAATATATTGTGTAGATTGTGTAGATCATGAAATCAATGATTT TACCCAATTAAATAACTGAGAGAAGCTGAACCGTTTCATATTTTTTGTCT TTAGATACGAAAGTTTAGAAGTCATGAAATCTGAGAAATCGCTCTTTGAA CGACAGGTAATAATCATACCTTTCAAAtccctttttttttaattgcgtAT CTCCCTAACTTGtaacatttttggacctacctccgggtaccccggtggag gttctataaattaacccatgtccgttcgtccgtccgtccgttcgtccgtc tgttaccagcttttctcaggattgactcattagttttttctgattttttg cggagcccgatttttgagaaaaaatttatttgggcaaatttgggccaaaa actacctaaaaatagggttttttggactttgtgcaaaatcctgtcattac ttttttctgattttttgtacaaagatggagggcaagattctctaaagaat ggctgaagtggtttttttccgaaaaattcttattcgccttaaaaaacgga tttccgtattttggggaaattacctttaaccaaataagaaaatatagctt ttctcaaagttgactcattatttttttctgattttttgcacaatgatgca aaatggcaatgcctaaaatgtgacagatGTTTCGGCTTTTTTTACCTTTA TGCCCGCACTCCATAACTCTATATTACTCTCCATAACTTGCTCGAACATT TCACTGAGTTTCTGACTATGTTCAATGAATTAATAATTTCTCCTTATAGG TAGCTGCTTACAAACAGCAAGGCAAACAACCTCCAACAGAGTTATTACAT AAAATCAAATCTCACAACGAAAGTATGATAGCCATCCAAAATCGCCTGAA ACAAGGAGGAAAGCCAGCTGTTATAGGTTCGTAAgtctttgtcaaatttt cttcCCAAATCGGCTGTTAGATAATTTCAAGTGATTTTGTCTCTGTATGa cctttttggatttttatGGATATCTTCGGTTTTTTGTTTAGAATATTTGA AGAATTTGGGTCGTGGAGTAGAAGTGGAGATGAAGAACGCGCAAGTTGCT GCTAAAAAGAACGATGACGTAAGAAATATTACAATACCAATGCAAAGTCG AACCCAGTTCCTTTGTTCACTTTTTNTGCTAAAAAGAACGATGACGTAAG AAATATCACAATACCAATGCAAAGTCGAACCCAGTTCCTttgttcacttt tttatgattctaaaGTTTGTCCCAAAAGTATGTGGACGCTTtagtttttg aacattttctcaGCACCCATTAATGTTATGTTAGAAAGTTaaacaccgtt ggaaagatatttccaaggaaaataaaataaatgaaattctTTAGAATGTT TGAATCTTGCTGATTTTAAAACAGCAAAAATGACCAACTTCACAgtgctg taactttttatctaaggaaaatacaaaaattctGAATAGAGATGTAAAAT CAGCAAGGTTCAAACATTCTAAAGAATTTCATGAAGTTCATgtcatgatt tttaaaacaatacaatttttttcattttttttctttatttttcaactttt aaaaaatcttttatcctttagattaTTTTCTTGAGAAATATCATTCTAAC GGTGTATAACTTTCTAACATAGCATGAATAAGTGCtcagaaaatgtcaaa aaactaaagtgtccacatactttaGAGAGAGAGAGTTTGATACGTATCGT AAATTGAAAAAGTGTCTCGAAGCATTCAAGGATTAATTTAATCACATCTT TTTTGCTAGTGGGTATGTGAACTATGAAAATGTAGAAATTGCGGAATTGG AACGAGTTTCTTATTATGATAAATAAAGGAACTGTTTTTCTCCCGTTAGG ATATCATTCTCTGACAAACCCTCCTTTTTCAGAAAActgcaaaaaattgt ttggttaaGAAGAAATTATTGGACAAAGaggtaaaatataaattttcttt gtcttcgATTTTCCCTCCTACTATTATTCACTCGAATCCAGCGGCAAATC CAGCAAATGGCTTTTTTTTTATCCAAAGACGGttaaaagggaagaaattt tgacgggaatttaatttggattAGGAAAAATGCTAATTATGGAGTATGAC GGATTTTTTTCAGGGTTAAAACAATGTGACTTtcaactttgtgaaaaatt aaattaaagaatAATAATAGTGGGAActtgatttggcggatttcTGACAT ATCCGCCAAATtctcttcccgccaaaatttgcTTCCCGTAAAGTATATGA TAAATTTAAGGAAATTCAGCTATCTTAGCTTTGGCAAACTGAATCTTGGT TTAGGGAAatgaaattaggtattttttttaacaaaaaggaAACGGTTCTT CTTGTTTCAGATTGGAGTATTGAAACAAAGGCTGGGACTTTGATGAGATA AGTGGCTTAAAGTTATTAccaatttatttttatacattTCTAGGAAAATa cgaaatattaaaaactaAAATGTATTATTTATGTACAAACTTGAAATAAG atcggaaattttcaaaacgtatatggAATATTATCGTAAACTACAGAATA TGCATCGAAGATTTacaaaaatgttagattctGGCTGCCCGGTACACAAA AAACTCTGTGAAATCTATTTTAAGATGCTCGGACCaatgaaaaatcatga aaatagtAACACGGTTTAGCAGTTGATACGTTGATGAATTTTTCAGCAAA TTTCTTCGCCCAACGTTCCAAATTTTATGGGTTATGCTTTCACAGTATTG TCAACATATTAATAATTCTTTACTCCACACACGACGTTTCATTTTCCAAT TTGGTATTATATTTGTTGCCAGTTTTTTCTAAtcatttgtttatgtttat tgTATTGTAATTATCAATTGTTTATATGATATTGGAATAAATTTTCCGTC CGAACGTCTTTTGTAGCGGACGGTAGTTATCACACATCGTCCCTTCTCGA TTCACTTTGGTCGATCGCAACTGCCGAAATTCTTGCAACTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000572XLOC_000572Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000981-exon-sc0000007-1491911889:243363..243483TCONS_00000981-exon-sc0000007-1491911889:243363..243483Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:243363..243483TCONS_00000981-exon-sc0000007-1510915933:243363..243483Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:243363..243483TCONS_00000981-exon-sc0000007-1575043694:243363..243483Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:243673..243784TCONS_00000981-exon-sc0000007-1491911889:243673..243784Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:243673..243784TCONS_00000981-exon-sc0000007-1510915933:243673..243784Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:243673..243784TCONS_00000981-exon-sc0000007-1575043694:243673..243784Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:243936..244042TCONS_00000981-exon-sc0000007-1491911889:243936..244042Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:243936..244042TCONS_00000981-exon-sc0000007-1510915933:243936..244042Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:243936..244042TCONS_00000981-exon-sc0000007-1575043694:243936..244042Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:245135..245197TCONS_00000981-exon-sc0000007-1491911889:245135..245197Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:245135..245197TCONS_00000981-exon-sc0000007-1510915933:245135..245197Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:245135..245197TCONS_00000981-exon-sc0000007-1575043694:245135..245197Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:245469..245600TCONS_00000981-exon-sc0000007-1491911889:245469..245600Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:245469..245600TCONS_00000981-exon-sc0000007-1510915933:245469..245600Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:245469..245600TCONS_00000981-exon-sc0000007-1575043694:245469..245600Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:245767..246165TCONS_00000981-exon-sc0000007-1491911889:245767..246165Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:245767..246165TCONS_00000981-exon-sc0000007-1510915933:245767..246165Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:245767..246165TCONS_00000981-exon-sc0000007-1575043694:245767..246165Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:246276..246351TCONS_00000981-exon-sc0000007-1491911889:246276..246351Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:246276..246351TCONS_00000981-exon-sc0000007-1510915933:246276..246351Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:246276..246351TCONS_00000981-exon-sc0000007-1575043694:246276..246351Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:246443..246663TCONS_00000981-exon-sc0000007-1491911889:246443..246663Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:246443..246663TCONS_00000981-exon-sc0000007-1510915933:246443..246663Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:246443..246663TCONS_00000981-exon-sc0000007-1575043694:246443..246663Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:246846..246986TCONS_00000981-exon-sc0000007-1491911889:246846..246986Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:246846..246986TCONS_00000981-exon-sc0000007-1510915933:246846..246986Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:246846..246986TCONS_00000981-exon-sc0000007-1575043694:246846..246986Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:247314..247553TCONS_00000981-exon-sc0000007-1491911889:247314..247553Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:247314..247553TCONS_00000981-exon-sc0000007-1510915933:247314..247553Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:247314..247553TCONS_00000981-exon-sc0000007-1575043694:247314..247553Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:247652..247708TCONS_00000981-exon-sc0000007-1491911889:247652..247708Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:247652..247708TCONS_00000981-exon-sc0000007-1510915933:247652..247708Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:247652..247708TCONS_00000981-exon-sc0000007-1575043694:247652..247708Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:247924..247966TCONS_00000981-exon-sc0000007-1491911889:247924..247966Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:247924..247966TCONS_00000981-exon-sc0000007-1510915933:247924..247966Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:247924..247966TCONS_00000981-exon-sc0000007-1575043694:247924..247966Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:248522..248619TCONS_00000981-exon-sc0000007-1491911889:248522..248619Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:248522..248619TCONS_00000981-exon-sc0000007-1510915933:248522..248619Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:248522..248619TCONS_00000981-exon-sc0000007-1575043694:248522..248619Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:248732..248790TCONS_00000981-exon-sc0000007-1491911889:248732..248790Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:248732..248790TCONS_00000981-exon-sc0000007-1510915933:248732..248790Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:248732..248790TCONS_00000981-exon-sc0000007-1575043694:248732..248790Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:249813..249929TCONS_00000981-exon-sc0000007-1491911889:249813..249929Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:249813..249929TCONS_00000981-exon-sc0000007-1510915933:249813..249929Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:249813..249929TCONS_00000981-exon-sc0000007-1575043694:249813..249929Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:250054..250127TCONS_00000981-exon-sc0000007-1491911889:250054..250127Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:250054..250127TCONS_00000981-exon-sc0000007-1510915933:250054..250127Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:250054..250127TCONS_00000981-exon-sc0000007-1575043694:250054..250127Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:250295..250350TCONS_00000981-exon-sc0000007-1491911889:250295..250350Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:250295..250350TCONS_00000981-exon-sc0000007-1510915933:250295..250350Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:250295..250350TCONS_00000981-exon-sc0000007-1575043694:250295..250350Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:252782..252833TCONS_00000981-exon-sc0000007-1491911889:252782..252833Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:252782..252833TCONS_00000981-exon-sc0000007-1510915933:252782..252833Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:252782..252833TCONS_00000981-exon-sc0000007-1575043694:252782..252833Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:253229..253328TCONS_00000981-exon-sc0000007-1491911889:253229..253328Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:253229..253328TCONS_00000981-exon-sc0000007-1510915933:253229..253328Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:253229..253328TCONS_00000981-exon-sc0000007-1575043694:253229..253328Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:254285..254375TCONS_00000981-exon-sc0000007-1491911889:254285..254375Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:254285..254375TCONS_00000981-exon-sc0000007-1510915933:254285..254375Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:254285..254375TCONS_00000981-exon-sc0000007-1575043694:254285..254375Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:254537..254683TCONS_00000981-exon-sc0000007-1491911889:254537..254683Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:254537..254683TCONS_00000981-exon-sc0000007-1510915933:254537..254683Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:254537..254683TCONS_00000981-exon-sc0000007-1575043694:254537..254683Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:254831..254871TCONS_00000981-exon-sc0000007-1491911889:254831..254871Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:254831..254871TCONS_00000981-exon-sc0000007-1510915933:254831..254871Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:254831..254871TCONS_00000981-exon-sc0000007-1575043694:254831..254871Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:255517..255568TCONS_00000981-exon-sc0000007-1491911889:255517..255568Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:255517..255568TCONS_00000981-exon-sc0000007-1510915933:255517..255568Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:255517..255568TCONS_00000981-exon-sc0000007-1575043694:255517..255568Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:256212..256338TCONS_00000981-exon-sc0000007-1491911889:256212..256338Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:256212..256338TCONS_00000981-exon-sc0000007-1510915933:256212..256338Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:256212..256338TCONS_00000981-exon-sc0000007-1575043694:256212..256338Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:256454..256530TCONS_00000981-exon-sc0000007-1491911889:256454..256530Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:256454..256530TCONS_00000981-exon-sc0000007-1510915933:256454..256530Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:256454..256530TCONS_00000981-exon-sc0000007-1575043694:256454..256530Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:257345..257392TCONS_00000981-exon-sc0000007-1491911889:257345..257392Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:257345..257392TCONS_00000981-exon-sc0000007-1510915933:257345..257392Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:257345..257392TCONS_00000981-exon-sc0000007-1575043694:257345..257392Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1491911889:257823..258453TCONS_00000981-exon-sc0000007-1491911889:257823..258453Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1510915933:257823..258453TCONS_00000981-exon-sc0000007-1510915933:257823..258453Clytia hemisphaericaexon
TCONS_00000981-exon-sc0000007-1575043694:257823..258453TCONS_00000981-exon-sc0000007-1575043694:257823..258453Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:243363..258453 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.42591e-08 7.80148e-09 2.67858e-09 6.28259e-07 0.00409414 0.100407 0.00743993 0.00161384 0 3.05522e-08 0 0 1.57702e-10 0 0 0 0 0 1.0293e-08 0 1.00349e-08 0 1.81968e-10 2.49577e-10 0.157707 0.00118701 0 4.97219e-10 7.66151e-10 0
Blast
BLAST of TCONS_00000981 vs. Swiss-Prot (Human)
Match: C2D1A (Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens GN=CC2D1A PE=1 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 6.484e-71
Identity = 232/829 (27.99%), Postives = 380/829 (45.84%), Query Frame = 2
Query:  527 GLKEIERLIKSVSKGATISEDDXXXXXXXXXXXXXXXXTQTLPPPEKPGRATVITPV------EPFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNEKLNLLLERQKQFKVLALQMKQRGDIDGAKKNLAIAKQFDSVIAAVKEGKEVDLSRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEALEQRLEKYRETGAKAKEEGNSGKVRRMGRIVKQFEAAIKDYKANKPVDFNELPCPPGFGPIPGETQAEEPGDPQ-----EMAQMLIN--------------------APLDGPEEDDTXXXXXXXXXXXXXXXXXXXNPGVSGSRNENQYQFLVTRQKEFKKAALEAKHAGNIDQARDYLRKAKGLDPMIEAASSGLGVDLTTVPSVRPTKGASTQQGSSPTGLREEIKMTGTNNENYVFVETALQRQIEAAEKNTAHYKLMGNLDAAKNFEMLLKNSQKDIMTLQQYKANKSPVPKCFYVKKTFPVTKSNPHLSDSELEITVVRCLNVPLQQGYQPKDMYTYVTCEMAYXXXXXXXXXXXXXXXXXN-PEYNGVFKVLIDRKQSAFKRFCRRGVVNFKLFYVRGFLKSDKAIGQASVKLTGFANKCEIHECVDIVDLEKGRKAIGGKIEIVLKIREPFVDKDTEIVNEKWLILDAHLRKLDMKTPSAI--PQGKA--------------VSAYESLEVMKSEKSLFERQVAAYKQQGKQPPTELLHKIKSHNESMIAIQNRLKQGGKPAVIEYLKNLGRGVEVEMKNAQVXXXXXXXXXXXXCLVKKKLLDKEIGVLKQ 2869
            GLK +E L+ S+ KG  I E D                   +PPP   G+    TP       +P       P  R     P           A P + P       L  L  RQ+ +K+ AL  KQ+GD   A ++  +AK FD+V+ A+  G+ VDLS          P P   P  P +  S P  P   PS++  P  P T+LEALEQR+E+Y+   A+AK +G+  K R   RIVKQ++ AI+ +KA + VD  ELP PPGF PI G  +A +P         E A  L N                    AP   P+   +  P S  +            P  + +R + Q  FL  R+K+  +AAL AK   +++ A+ +LR+AKGL+PM+EA+ +GL VD+T VP     K           GL +E          Y  +   +++Q E    ++  +  +GN+     FE L ++ ++ +  L+Q      P P   + ++TF V K  P LS +++ + +V+ +N+P   G  P D+  +V  +  YP  +      T++ +  + PE+   FK+ I+R    F+R  +   + F++ +  G  K+D+ +G A +KL      CE+ E ++++D   GR+  GG++E++++IREP   +  E   E+WL++D     +    P+ +  P+GKA                   SL V+  ++   ER++ A +Q  +  P E+  + +   +     + +L+QGG     EY   L R ++   + A+          AK  L ++ L++ E+  L++
Sbjct:  169 GLKTLENLLASIRKGNAIDEAD-------------------IPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLEALSRGEPVDLS-------CLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLEALEQRMERYQVAAAQAKSKGDQRKARMHERIVKQYQDAIRAHKAGRAVDVAELPVPPGFPPIQG-LEATKPTQQSLVGVLETAMKLANQDEGPEDEEDEVPKKQNSPVAPTAQPKAPPSRTPQSGSAPTAKAP------PKATSTRAQQQLAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNGLPVDITKVPPAPVNKDDFALVQRPGPGLSQEAA------RRYGELTKLIRQQHEMCLNHSNQFTQLGNITETTKFEKLAEDCKRSMDILKQAFVRGLPTPTARFEQRTFSVIKIFPDLSSNDMLLFIVKGINLPTPPGLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFKEQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDALEIACEVREILEVLD---GRRPTGGRLEVMVRIREPLTAQQLETTTERWLVIDP----VPAAVPTQVAGPKGKAPPVPAPARESGNRSARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRREYAAQLERQLQFYTEAARRLGNDGSRDAAKEALYRRNLVESELQRLRR 951          
The following BLAST results are available for this feature:
BLAST of TCONS_00000981 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
C2D1A6.484e-7127.99Coiled-coil and C2 domain-containing protein 1A OS... [more]
back to top