Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000966 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000966
Unique NameTCONS_00000966
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5835

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000966 ID=TCONS_00000966|Name=TCONS_00000966|organism=Clytia hemisphaerica|type=transcript|length=5835bp
NAAGCAATGGTCATGTCAAAGTAGCCAAACTTTTGCTTGATGCAGGTGCT
GGAATTAATACACACTCAAGTGAATTCAAAGAAAGTGCTTTAACTTTGGC
CTGCTACAAAGGGCATGTTGATATGGTTTTCTTTTTATTGGAGAGAGGTG
CTGACCAAGAACATAAGACAGATGAAATGCACACAGCTTTGATGGAAGCA
TCAATGGATGGACATGTGGAAGTTGCAAGACTACTCTTGGACCATGGAGC
TCAGGTGAACATGCCGGCTGATAGTTTTGAATCCCCATTAACGCTTGCAG
CATGTGGAAGTCATGTTGAATTAGCTGAGTTGTTGATTGAGCATGGTGCA
AACCTTGAAGAAGTCAACGATGAAGGGTTCACTCCACTAATGGAAGCAGC
TAGGGAAGGATACTTACCAATGGTGGCTTTGCTTTTAGCACATGGAGCCA
ACTTGTATGCTCAGACAGAAGAGACACAAGAAACAGCATTGACACTTGCG
TGTTGTGGTGGGTTTCTGGAGGTGGTGGCTTACCTTTTGGATTGTGGTGC
CGATATCGAACTTGGTGCATCTACTCCTCTCATGGAAGCAGCTACTGAAG
GTCATGTTGAACTTGTCAAATTTCTTATTGAGAAAGGTGCAAACGTGAAT
GCCATCACAGCTACAGGTGATGCAGCATTGACATACGCTGCAGAAAACGG
TCATACAGACGTAGTAGAAGTATTGATTGAACAAGGTGCCAACATTGAAC
ATGAATCTGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTCGTGCGGGA
CACCTTTGCACAGTGGAATATCTCCTCAGTCAAGGGGCCGACGTGAATAG
AAAAACCAGCGGTGGAGAGCATTCTGTTTTATCATTAGCATGTGCTGGAG
GCCATACCGCTGTTGTCGAGCTCCTTCTTGGTAGAGGTGGTAATCCTACT
ATGAAATTAAAGGACAATTCAAGTATGTTGATAGAAGCGGCCAAAGGTGG
TCATGCTAACGTAGCCCACCTGCTCATGAACACTCAAATACATCAACAAA
CCTTCACTCAAACCGATACTTTACATTCTGAATATCCAATACATTCAAGC
GCTTTACCAACGGACAGCGCTTTCCCTATCTGTCCACACGTTCAACACGA
GCAAGATCACATCGCGCATCAACCAGATTGCCATTTTCATAATACGCCTG
AAAATCAACATTTTGCTCATGACTTTTCACAACAAATCATTCAACCGTCT
CCGCCTTCCGATCACTTTCAACAACAACATCCGAACGATGAGTTGGACGA
CGAGAATTACAACAACAATATCGATGTCAACACTTCACCAACTGATCTTT
ATCTTCCCAACATACCTGTCTCCCTCGCTTCTTCTCTCTCACTCGCCAAC
CTTACAACTGCCGATCTGCAACATTTAGCTCAGGTTTTACAATACTCTTC
GAATCAAAATCAAACGCTTGAAGACGTAGTAGCGGCTGGTCAAAATGCTG
AACAGATTGGTTTACAAACGATTACTTTCCCTGCAATCGACCCTCAAGTG
GAGAGTTTCACCACACAATCAGAAGTGTGTACACCATCACCCTCAAACAC
GGCAACTGCTCTCGTTACAAGTGCAGGACGAACCATCACTTCAACTGGCG
TGCAAACTGAAGATGCAATTTCCATGATTCAAAAACTTACCAACAGTGTC
CATCAGCTGAACGCTCTACAGACATTCGCAGCATCCCACAATTTGGAACT
AGTGAACCTGGGTGAGATTACACTACCTCCAGCGCCTTTCCAACTTGAAA
CAGAAGCGGAAGAAGGGATCATGGTAGCTGATTCTGCACGCACTCTACAA
AACTCCATCAACGGCATGGTTCGCGAAGatCCGATCGGTGAATGCAGCTC
TTTACCGATCGGTGAATGCAGCTCTTTACCATCCATCGAAACGACACTTC
CAGTACCGGCACAATCTCCCGTCACACCTCCCCTCTCACCAGCCATCGAT
ATCGACCAAAGTACGGACAGTAATCACGATACGGCGCTCACTATCGCCTG
TGCTGGTGGACACGATGAACTTGTACAACTTCTGCTGGCCAGAGGTTCCA
ACATTGAACACCGCGACAAAAAGGGCTGCACGCCATTAATCCTAGCGGCA
ACAGCAGGTCACACTGCCACATGTCACATTCTTCTCGAACATGGAGCAGA
CATCGAAGCACAATCAGATCGAACCAAAGACACTGCACTTTCCTTAGCAT
GTTCCAGTGGTCGCCAAGAAGTTGTCGAATTACTCCTCATGTCCAATGCT
AACTTTGAACACCGAAACGTCTCTGATTACACGCCTCTCAGTTTAGCAGC
TTCGGGAGGGTACGTTGGTATCATCAAAGTTCTGTTGAACCATGGTGCAG
AGATCAATTCACGCACAGGAAGCAAGCTGGGCATCTCTCCCCTCATGTTA
GCGGCAATGAACGGTCATGTTGCGGCTGTCAAACTCCTCTTGGATCGTGG
CAGTGACGTCAATGCTCAAATCGAAACCAATAGAAATACAGCTTTAAcgt
tagcatgttttcaaggGCGAACGGAAGTTGTTGGTCTGCTTTTAGACCGA
CATGCAAATGTGGAACACAGGGCCAAGACCGGATTAACTCCATTAATGGA
AGCAGCATCAGGTGGTTACGTCGATGTGGGTCGTGTTCTGATCGATCGCG
GTGCAGATGTGAACGCCATCCCAGTCCCTTCGTCACGTGACACTGCACTC
ACAATCGCTGCCGATAAAGGACACTACAAATTCGCCGAGTTATTAGTGGT
TCGTGGTGCCGTTGTTGACGTGCGTAATAAGAAAGGATGTACACCTCTAT
GGCTCTCCGCACACGGTGGGCATCTGGATGTTTGTCAGTTGTTAGCGCGT
GAAGGAGCTGATGTGAACGCCATGGACAATCGAGCAGTCTCTGTTCTCGT
AGCCGCGTTCAGAAAAGGAAACATCAAAGTGGTCAAGTGGCTGGTCAAAC
ATGTATCACAGTTCCCACCTGATTCTGACTGCAAACGTTTCATTCAAACC
ATCTCTGATAAGGACTTACTAAAGAAATTAGACGAATGTATGCAAATCAT
CAACGCGGCAAAGAAAAGACAAGAAGCAGAGGCGAACAAGAACGCGTCCA
TTCTGTTGGAAGAGTTGGATCATGAGAAAAAGAAGGAGGAGAGGCGGAAA
GCGCAAGCTCAAAAGAAACGTGATAAGAAGAagcagaagaaaaagaaaaa
gagtacGGAGAAGCAGTCTGTGGATACTGAAGAAGATGGCGAGAAAGAAG
ACGAGGAAGAGTTCGAACATGCAACGAGTGGATTCCCTTTCATCAATGCT
GATCAACGAACGCCCTTGATGATCAATGACGAACGACCCGATCTTTCGAC
TGCTGAATTGAAACTGAAATCTCAAGTTCAACTGAAGAGCAAGAAGAAGA
GCCGTCTAAAGAGTCGCAACTCCTCTCTCAGCAAAAGTACGGATGAAGAG
AAGGAGATGGCGGACAAAGATGTGGAAGATATCATAGATCCCGTATCCAC
CGCCATCGATGCTCTGACCAACATCGTTATCACTACTGCTGCTCAATTTG
TATCCTCTATCAAACCAACAGACACAGTGAGTGCGGCAACAGTAGCTGAA
ATCACCAAAGCTCTTGCAGCTTCCATCATCACTAACGCTAAAGACAATAC
TAAGACCTCTATCCCAGATGAGGTTGCTGTTACTATGGCAACGGCTGCTG
CTCAACGTGTGGCGGTCAGCATTTCTTCACCTTCGCTACTAAGCAACAAT
AATAACAATGGATTTGCGCTTAACACGAGTCAGAAGAAAGCAAAACGAGT
TGACGACGAATGGAAAGAGGTCACTCGAAGCATTCCGCATACGAAGTCAA
GGAAGATCTTGATACCAGCCGCCTTGATCAGTCGCGTTATCGGTCGTGGT
GGGTGCAACGTCAACGCAATACGTGAACACACGGGAGCACATATCGACAT
CGATACAAATCGAAAGAAAGCCAACGGTGATTGTATGGTCACCATCAAGG
GTTCGCAACAAGCTACGAAACAAGCAGGGAACTTGATCCAATCTTTGATC
GACGATCCCGATAGCAACGTTGCGGAAATTCTCCCTACACTTCCTACTAT
TGCGACGTCTCTGTCTACAAGCGTCTCATCTTCTTCTCTCATTCCTCTCA
TGAAAAACCTCACCAAACCCACCACCATCGAATCGTCTCTCGACAttcca
aaaacaattcaatcACTTTCAAAATCACTTAACACGCCCAAAACTAGCGA
CAAAATACCGACGCTTCGACAAATCTCGGCACCAGCAAATTTGGTGCCTC
CTACATCGACACCTTCTTCTCAACCAGTACGAATGGTTCCTGTTGTCAAC
TCGAATTCCAAGAAACTCGAAGTCGCCAAGGAATCTTCGGCGCCGTCTAG
AACGAAAGTGAAACCTCCTGCGCTCACTACAACCACACCAAATAGTGGAT
GGAAGTCCACTAATCAACAAGACACCAACACCGTGCTAAAGCAGACGTCC
TCAACGATGGCTGTCTCTACTCGCTCACAGGTGTCAGTGACACGGCAATT
ATCGAATGAAGGGAGCCAAGTGCACCAACAAATTATAACGACCATCAGTA
CAACAGTTTTCTCATCCTCTTCTCGTAATCTTCCCAAACCCATCGGTAGC
AATCGACCCTTTCGACCAATCGCTTCTCCCACTAATGCTCTCTCGTCAAC
AGCTGTGTCGAATTCAGTGGCAGCCACTCTTCATTCGACATTAAACAGTC
TACTTTCGCAGGTGGCGACACAACGCAGTCCCATGATATGGAACGATCAT
CCAGGTTCGAAGGAGCACCATGGTAGCAGTGGTGATCTGGTGGTGACGAC
AGTAGCCACCTCACCCAACAATACGCTAAACGGAACGCCCATTGAACGAT
TCTTACCCGCCTCTCTTTCGCAAGCTTCTTCACAGGAATCGTTCAAAGGT
CACTCGAGAACACCTTCACTATCTCCAACTTCTAACCACTCCAATTCACC
GACACCAGAAGAAAAACCCCACCTCAACCCCATCGGTAGTGAAAGAGGTC
ACAAGAAACCGACTGTAAACCAACAGGGCGGCTTGCAAGGTCTTACCTCG
CTACTACAAGGATCCGACAGTGGGCAGAACTTGTGGCGTTTTGACTACAA
CATGAGGAAGTCACCTTCGTGGAAGCCAAACTCGTCTCCTGTCGGGTGGA
CTGCACCCAACGAACAAGCGaaggaaatgaaaccactgctAGCGAATGGC
GATATGGAACACCATCATCCTTCGGTTGATCACGTCATCGGGCCTGATGA
AACACTGCAAAGTCTTCTCGAACGCCTCTCATTGTCCACTCATCTCAATC
TTTTTCAGAAAAACGAAATTGATTTGGATGCGTTGATGTTGATGTCGGAA
CAAGACTATGCGGACATTGGTCTTCCGAAGGAACCACGTATCAAGTTGTT
GAACAGCATGCGACAACTGCAAAACAGATCCACTGCTCACGTCCCTCAAT
CACCGCCCCAACAAATACCATTACTGAAGCACATCAATCCACAGCCGCTA
TGGAATTCTGCAATGGATAATAACTTACATCACCCTGAAAGCCGGTTACC
ACCCGCACTTCGGAACAGTGTTCATTTTCCTGGAACACCACAGCTTGCTG
CTTCCTGGCAGACGTGGAGTAACACTATCGATCAATGAAACGGTGAGTCA
TTCATTTGCAGGTATTCGTTGGCAACGGAGTGTAATTGGAAATCAAGATT
GTCCctttcattttcattgactGGAATTTTTCATT
Run BLAST on NCBI

transcript from alignment at sc0000007:218373..234422+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000966 ID=TCONS_00000966|Name=TCONS_00000966|organism=Clytia hemisphaerica|type=transcript|length=16050bp|location=Sequence derived from alignment at sc0000007:218373..234422+ (Clytia hemisphaerica)
NAAGCAATGGTCATGTCAAAGTAGCCAAACTTTTGCTTGATGCAGGTGCT GGAATTAATACACACTCAAGTGAATTCAAAGAAAGTGCTTTAACTTTGGC CTGCTACAAAGGTATGTTTTATTTAGTTACTTGCATTTTCTTGCTTAGTC TCTTAGTNtaagctgaacgcatcataagccctttggataGTAAAGGGGAA ACTATCCCAAAGAACATTATAAACataaatgaattttattcttcAGGGCA TGTTGATATGGTTTTCTTTTTATTGGAGAGAGGTGCTGACCAAGAACATA AGACAGATGAAATGCACACAGCTTTGATGGAAGCATCAATGGTATCTACT TATCTTTCATCTTGTTATctataaaaagtttttctgttCTCAACTtaagt tgagctagaatctgtctgtctgtctgtctgtctgtctgtctgtctgtctg tctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtc tgtctgtctgtTTGTCTGTCACAAAGattttagggcagcctggagacttc aaaaatgattgaatttggctgaaattttgcacacttgttccttgggtgaa tatttgtggattctttttttcatttttcaaaaatttttatttgttggGTC TGGGTActaatcttttgttttttttgctacaATCGGGCCGGGGGCCTATG GATAATTTGAAGTATCTGAAGTTAAATTTTCATCGGCCACTAATTAGATA GGCTCCTGTTTTGTTTTACAAATCTCCATTGTATATTAATTACATTGAAA GTACTCAATGTTTTTCAAtgtttctttttggacctaccccggtggaggtc ctataaattaacctttgtccgtccgttcgttagttaccagcttttctcga gattgactcattagttttttctgattttttgcacaaagatgtgtaactat aaaccctcgaatgtgacggagcccgattttcgaaaaaatttttgggcaaa tttgggccaaaaaacggctaaaaaacggtttttttggacttcgtgaaaaa ttggtttattaattttttctgattttttgcatgaaagtagggtactatca taggtaaaagatggctcgagcagatttttgcaaaaaaaatttgttggctc aaaaaacgcatgtttatctataagaatcactattagtCATGTCATACATC AATTAGTCAagttactgaatttttttttgtgtggtagatatttttttgct cacgagggcttacttttaaagaataatgtgtgtttagacatgaaattttg gttgcttggtgtgtttttatagaaaaaatggccaaattcgatattttttt ataagcacattatcaattacttaggtattagcttttctcgagattggctc tttcattctttatgatttttcgcacaaagatgcataactataaaccctcg aaggtgacggagcctgattttcgaaaaaaatgtttttgggcaaatttggg ccaaaaaatggctaaaaaacgagttttttggactttgtgaaatattggat cattgttttttatcagatttttttgcatgaaagtaggtatagaaagaatt tttctgctcaaaaaaacgcatctttatctataagaattactattaataag catacatcaatgttcttagccaaattactaaatttttttatgagatagat gtttttttgctctcgaagtcttgaatatgaaagaatatttcaagagcatg acattttggtttctaaacgtttttttataagaaacaaacgactaatttta atagatcgtcactatttgtgttctgaataattgtttaacggtcatgccca cgtagatatcaattatatatgtgttaaatgcataacctggtaggtccata aaagtatcacttgtatTTTTCTAGGATGGACATGTGGAAGTTGCAAGACT ACTCTTGGACCATGGAGCTCAGGTATGATTTCTCAATCATAAAATAGGAA cgaccaggggggggggggcaagcagttaATACACAacttagtaccgtggt gggtccttttctgaaatttgcaaATTGCAGTTAATACACCAGTGTATTAA CTGTCAAAAGGGGTGGTGTTAAGACAATTTTAGAACTCAAAAAATGTATT AACTGCCTACCAGACCATAGTTTGGCACTTCCTATAAATTTAAAACTAAG CAACCATGCAACTGGAAAAcctcaaaatctttttctgcttactcaaaatc taaaaattttaactgTTGCATTGCTTAGGTAACTGTCTGACAAGGGATTT GCACCCCGACTTACAAAAACTTTCTAATGACATAAATATGTGGCATAAGT AGTCTCAAAACAGTTAAAACCCCTTGTATTGTATCAAATTAACAGGAAAA TACACGGTGGACCTGCATGGGACGGTTTGTCGGCCGCTGCAAACTCACTT TGGGGGTGGTGTATACATTTAATGGGTCAAAAACAGTTAATACACAGTGT ACTAAGTGTCAAGGAATGGTGgtccttttgaaaaattccaaaaagcaTTT AATACACAAAGTGTTGTGTATTAACTGCTTGTCCCTCCCCTGGAACGACA TTTTGTAAGTTTACATTGATAAATTCATCATCTTGCAAATTTGAATATTT cgcttcctttttctttctataGGTGAACATGCCGGCTGATAGTTTTGAAT CCCCATTAACGCTTGCAGCATGTGGAAGTCATGTTNTCCTTTTTCTTTGT ATAGGTGAACATGCCGGCTGATAGTTTTGAATCCCCATTAACGCTTGCAG CATGTGGAAGTCATGTTGAATTAGCTGAGTTGTTGATTGAGCATGGTGCA AACCTTGAAGAAGTCAACGATGAAGGGTAAGCTTGTCTCTTTGTTTTCGT TAAATTAACTTTGATAGTATATATAAGAATCTTCAAACtcggatttaaaa aaaactaatgatgctttttatgttttgtagccttttctttcttattatgT TAAACTATTGTGCTAGTAATGTACCTTATTATCTATTTCTTAAGGTTCAC TCCACTAATGGAAGCAGCTAGGGAAGGATACTTACCAATGGTGGCTTTGC TTTTAGCACATGGTAAGATAATATTCCAAATATCCGGCATGACTCAGAGA AATTACTTTTGACAATAGTAAGGTAAACTTTTTGCAAGTAGTAAATTTAG CTATGGACCGAAAGTTATAATAATTAAGTTCCAAGTTTGCTTGAACTTTC TGTtaccaacttattactaaaccatgaatttcattttttctatttgcAGG AGCCAACTTGTATGCTCAGACAGAAGAGACACAAGAAACAGCATTGACAC TTGCGTGTTGTGGTGGGTTTCTGGAGGTGGTGGCTTACCTTTTGGATTGT GGTGCCGATATCGAACTTGGTGCATCTACTCCTCTCATGGAAGCAGCTAC TGAAGGTCATGTTGAACTTGTCAAATTTCTTATTGAGAAAGGTAACCTTC AATTTAATTGTATCTTCTACTTCTTACTTTTTTCCTATCTTTTCTACGTT TCGCCAAATCTAACGGTGTTAACCCATcctgaaaacatgaaaaaatcaaa tcttaTATTCCcgttggaggtcctataaattaacctttgtctgttcgtcc gttcgtctgtctgttattagcttttcttgagattggctcattagtttttt tcagatttttggcacaacgatgcaaaatggcaattcCCGAAATGTgccgg agcccaattttcgaaaaaaaattttccagccgAAAAAAACTGGAAGTATG CCTTCATTATATTCTTTTGTTcaaggtaggtccaatcagTATCCACTTGT TATCAAGATAGATCTATTCTAACACGATTTTGACTTATTTCTAGGTGCAA ACGTGAATGCCATCACAGCTACAGGTGATGCAGCATTGACATACGCTGCA GAAAACGGTCATACAGACGTAGTAGAAGTATTGATTGAACAAGGTGCCAA CATTGAACATGAATCTGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTC GTGCGGGACACCTTTGCACAGTGGAATATCTCCTCAGTCAAGGTACCAAA ATGTTTCATCATAAATCATGAATCGTTATCCATCTTTCAATTATCAACGT AAACTTAAAATCATTCTTGCCATGCTGATATAGATGATTATAAATATTTG CTATTTTAGGGGCCGACGTGAATAGAAAAACCAGCGGTGGAGAGCATTCT GTTTTATCATTAGCATGTGCTGGAGGCCATACCGCTGTTGTCGAGCTCCT TCTTGGTAGAGGTGGTAATCCTACTATGAAATTAAAGGTAAGCTTAATTG TGCCACTCTCCTAACTtcttgaaatgaattttttcaagAGTTGTTAAGTT TATGAATCTGAAATTGTAAATATGTTCTTTTTTAGGTAAAAAGTCTTTTA AAATGAATCAAAAGAGGTagtaaagtctaattttctcaacTCAATTTTTA TTCGGCTTCTTTTATTTCCAGGACAATTCAAGTATGTTGATAGAAGCGGC CAAAGGTGGTCATGCTAACGTAGCCCACCTGCTCATGAACACTCAAATAC ATCAACAAACCTTCACTCAAACCGATACTTTACATTCTGAATATCCAATA CATTCAAGCGCTTTACCAACGGACAGCGCTTTCCCTATCTGTCCACACGT TCAACACGAGCAAGATCACATCGCGCATCAACCAGATTGCCATTTTCATA ATACGCCTGAAAATCAACATTTTGCTCATGACTTTTCACAACAAATCATT CAACCGTCTCCGCCTTCCGATCACTTTCAACAACAACATCCGAACGATGA GTTGGACGACGAGAATTACAACAACAATATCGATGTCAACACTTCACCAA CTGATCTTTATCTTCCCAACATACCTGTCTCCCTCGCTTCTTCTCTCTCA CTCGCCAACCTTACAACTGCCGATCTGCAACATTTAGCTCAGGTTTTACA ATACTCTTCGAATCAAAATCAAACGCTTGAAGACGTAGTAGCGGCTGGTC AAAATGCTGAACAGATTGGTTTACAAACGATTACTTTCCCTGCAATCGAC CCTCAAGTGGAGAGTTTCACCACACAATCAGAAGTGTGTACACCATCACC CTCAAACACGGCAACTGCTCTCGTTACAAGTGCAGGACGAACCATCACTT CAACTGGCGTGCAAACTGAAGATGCAATTTCCATGATTCAAAAACTTACC AACAGTGTCCATCAGCTGAACGCTCTACAGACATTCGCAGCATCCCACAA TTTGGAACTAGTGAACCTGGGTGAGATTACACTACCTCCAGCGCCTTTCC AACTTGAAACAGAAGCGGAAGAAGGGATCATGGTAGCTGATTCTGCACGC ACTCTACAAAACTCCATCAACGGCATGGTTCGCGAAGGTATCACTAATTA GAAatctatttatttttgttatatcCAGTTTATGTCGTGGTAATATTCGC AGCATACtgtaatattcaaaattttgcgCGTGTGTCTTGGACCAAAATTT AAATAGAGTTGTAAGACTTTTCAATACtacaatttaaaaatttatatttt cagatCCGATCGGTGAATGCAGCTCTTTACCGATCGGTGAATGCAGCTCT TTACCATCCATCGAAACGACACTTCCAGTACCGGCACAATCTCCCGTCAC ACCTCCCCTCTCACCAGCCATCGATATCGACCAAAGTACGGACAGTAATC ACGATACGGCGCTCACTATCGCCTGTGCTGGTGGACACGATGAACTTGTA CAACTTCTGCTGGCCAGAGGTTCCAACATTGAACACCGCGACAAAAAGGG TGAGAATCTTCTATTTACAATTACAGATTGAATTGAATCTTTAAATTTTG CTAAAGAATTATGGCTTATTACTATTTCTTATTTCCACAGGCTGCACGCC ATTAATCCTAGCGGCAACAGCAGGTCACACTGCCACATGTCACATTCTTC TCGAACATGGAGCAGACATCGAAGCACAATCAGATCGAACCAAAGACACT GCACTTTCCTTAGCATGTTCCAGTGGTCGCCAAGAAGTTGTCGAATTACT CCTCATGTCCAATGCTAACTTTGAACACCGAAACGTCTCTGATTACACGC CTCTCAGTTTAGCAGCTTCGGGAGGGTACGTTGGTATCATCAAAGTTCTG TTGAACCATGGTGCAGAGATCAATTCACGCACAGGAAGCAAGCTGGGCAT CTCTCCCCTCATGTTAGCGGCAATGAACGGTCATGTTGCGGCTGTCAAAC TCCTCTTGGATCGTGGCAGTGACGTCAATGCTCAAATCGAAACCAATAGA AATACAGCTTTAAcgttagcatgttttcaaggGCGAACGGAAGTTGTTGG TCTGCTTTTAGACCGACATGCAAATGTGGAACACAGGGCCAAGGTAagat tcaaaaagtcaaagtcaAGTTTTCCTTTTGATACATTATGAAATATATCC ACTTGCCTTACTGCTTTTTTCCTAAAGATAAATTCCGAAGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttttttcagatttttggca caacgatgcaaaatggcaattcCCGAAATGTgccggagcccaattttcga aaaaaaattttccagccgAAAAAAACTGGAAGTATGCCTTCATTATATTC TTTTGTTcaaggtaggtccaatcagTATCCACTTGTTATCAAGATAGATC TATTCTAACACGATTTTGACTTATTTCTAGGTGCAAACGTGAATGCCATC ACAGCTACAGGTGATGCAGCATTGACATACGCTGCAGAAAACGGTCATAC AGACGTAGTAGAAGTATTGATTGAACAAGGTGCCAACATTGAACATGAAT CTGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTCGTGCGGGACACCTT TGCACAGTGGAATATCTCCTCAGTCAAGGTACCAAAATGTTTCATCATAA ATCATGAATCGTTATCCATCTTTCAATTATCAATGTAAACTTAAAATCAT TCTTGCCATGCTAATATAGATGATTATAAATATTTGCTATTTTAGGGGCC GACGTGAATAGAAAAACCAGCGGTGGAGAGCATTCTGTTTTATCATTAGC ATGTGCTGGAGGCCATACCGCTGTTGTCGAGCTCCTTCTTGGTAGAGGTG GTAATCCTACTATGAAATTAAAGGTAAGCTTAATTGTGCCACTCTCCTAA CTtcttgaaatgaattttttcaagAGTTGTTAAGTTTATGAATCTGAAAT TGTAAATATGTTCTTTTTTAGGTAAAAAGTCTTTTAAAATGAATCAAAAG AGGTagtaaagtctaattttctcaacTCAATTTTTATTCGGCTTCTTTTA TTTCCAGGACAATTCAAGTATGTNAATCAAATCTTATATTCCcgttggag gtcctataaattaacctttgtctgttcgtccgttcgtctgtctgttatta gcttttcttgagattggctcattagtttttttcagatttttggcacaacg atgcaaaatggcaattcCCGAAATGTgccggagcccaattttcgaaaaaa aattttccagccgAAAAAAACTGGAAGTATGCCTTCATTATATTCTTTTG TTcaaggtaggtccaatcagTATCCACTTGTTATCAAGATAGATCTATTC TAACACGATTTTGACTTATTTCTAGGTGCAAACGTGAATGCCATCACAGC TACAGGTGATGCAGCATTGACATACGCTGCAGAAAACGGTCATACAGACG TAGTAGAAGTATTGATTGAACAAGGTGCCAACATTGAACATGAATCTGAG GGTGGTCGCACTCCTTTGATGAAAGCTGCTCGTGCGGGACACCTTTGCAC AGTGGAATATCTCCTCAGTCAAGGTACCAAAATGTTTCATCATAAATCAT GAATCGTTATCCATCTTTCAATTATCAACGTAAACTTAAAATCATTCTTG CCATGCTGATATAGATGATTATAAATATTTGCTATTTTAGGGGCCGACGT GAATAGAAAAACCAGCGGTGGAGAGCATTCTGTTTTATCATTAGCATGTG CTGGAGGCCATACCGCTGTTGTCGAGCTCCTTCTTGGTAGAGGTGGTAAT CCTACTATGAAATTAAAGGTAAGCTTAATTGTGCCACTCTCCTAACTtct tgaaatgaattttttcaagAGTTGTTAAGTTTATGAATCTGAAATTGTAA ATATGTTCTTTTTTAGGTAAAAAGTCTTTTAAAATGAATCAAAAGAGGTa gtaaagtctaattttctcaacTCAATTTTTATTCGGCTTCATTTCCAGGA CAATTCAAGTATGTTGATAGAAGCGGCCAAAGGTGGTCATGCTAACGTAG CCCACCTGCTCATGAACACTCAAATACATCAACAAACCTTCACTCAAACC GATACTTTACATTCTGAATATCCAATACATTCAAGCGCTTTACCAACGGA CAGCGCTTTCCCTATCTGTCCACACGTTCAACACGAGCAAGATCACATCG CGCATCAACCAGATTGCCATTTTCATAATACGCCTGAAAATCAACATTTT GCTCATGACTTTTCACAACAAATCATTCAACCGTCTCCGCCTTCCGATCA CTTTCAACAACAACATCCGAACGATGAGTTGGACGACGAGAATTACAACA ACAATATCGATGTCAACACTTCACCAACTGATCTTTATCTTCCCAACATA CCTGTCTCCCTCGCTTCTTCTCTCTCACTCGCCAACCTTACAACTGCCGA TCTGCAACATTTAGCTCAGGTTTTACAATACTCTTCGAATCAAAATCAAA CGCTTGAAGACGTAGTAGCGGCTGGTCAAAATGCTGAACAGATTGGTTTA CAAACGATTACTTTCCCTGCAATCGACCCTCAAGTGGAGAGTTTCACCAC ACAATCAGAAGTGTGTACACCATCACCCTCAAACACGGCAACTGCTCTCG TTACAAGTGCAGGACGAACCATCACTTCAACTGGCGTGCAAACTGAAGAT GCAATTTCCATGATTCAAAAACTTACCAACAGTGTCCATCAGCTGAACGC TCTACAGACATTCGCAGCATCCCACAATTTGGAACTAGTGAACCTGGGTG AGATTACACTACCTCCAGCGCCTTTCCAACTTGAAACAGAAGCGGAAGAA GGGATCATGGTAGCTGATTCTGCACGCACTCTACAAAACTCCATCAACGG CATGGTTCGCGAAGGTATCACTAATTAGAAatctatttatttttgttata tcCAGTTTATGTCGTGGTAATATTCGCAGCATACtgtaatattcaaaatt ttgcgCGTGTGTCTTGGACCAAAATTTAAATAGAGTTGTAAGACTTTTCA ATACtacaatttaaaaatttatattttcagatCCGATCGGTGAATGCAGC TCTTTACCGATCGGTGAATGCAGCTCTTTACCATCCATCGAAACGACACT TCCAGTACCGGCACAATCTCCCGTCACACCTCCCCTCTCACCAGCCATCG ATATCGACCAAAGTACGGACAGTAATCACGATACGGCGCTCACTATCGCC TGTGCTGGTGGACACGATGAACTTGTACAACTTCTGCTGGCCAGAGGTTC CAACATTGAACACCGCGACAAAAAGGGTGAGAATCTTCTATTTACAATTA CAGATTGAATTGAATCTTTAAATTTTGCTAAAGAATTATGGCTTATTACT ATTTCTTATTTCCACAGGCTGCACGCCATTAATCCTAGCGGCAACAGCAG GTCACACTGCCACATGTCACATTCTTCTCGAACATGGAGCAGACATCGAA GCACAATCAGATCGAACCAAAGACACTGCACTTTCCTTAGCATGTTCCAG TGGTCGCCAAGAAGTTGTCGAATTACTCCTCATGTCCAATGCTAACTTTG AACACCGAAACGTCTCTGATTACACGCCTCTCAGTTTAGCAGCTTCGGGA GGGTACGTTGGTATCATCAAAGTTCTGTTGAACCATGGTGCAGAGATCAA TTCACGCACAGGAAGCAAGCTGGGCATCTCTCCCCTCATGTTAGCGGCAA TGAACGGTCATGTTGCGGCTGTCAAACTCCTCTTGGATCGTGGCAGTGAC GTCAATGCTCAAATCGAAACCAATAGAAATACAGCTTTAAcgttagcatg ttttcaaggGCGAACGGAAGTTGTTGGTCTGCTTTTAGACCGACATGCAA ATGTGGAACACAGGGCCAAGGTAagattcaaaaagtcaaagtcaAGTTTT CCTTTTGATACATTATGAAATATATCCACTTGCCTTACTGCTTTTTTCCT AAAGATAAATTCCGAAGGTAGGGACCTCAAGTTCATTGGAAAGATTTCAT TCTTTTCACTCAAACACAAATCTTCTTCGACCATCTCTCATAGACCGGAT TAACTCCATTAATGGAAGCAGCATCAGGTGGTTACGTCGATGTGGGTCGT GTTCTGATCGATCGCGGTGCAGATGTGAACGCCATCCCAGTCCCTTCGTC ACGTGACACTGCACTCACAATCGCTGCCGATAAAGGACACTACAAATTCG CCGAGTTATTAGTGGTTCGTGGTGCCGTTGTTGACGTGCGTAATAAGAAA GGATGTACACCTCTATGGCTCTCCGCACACGGTAAGATACTTACGAACTC GAGTAAAACTTTGACTCGGCTGGTAAGAACTTTAACTAGCGCCGACTAGT AATAAAGAATGGTCGAATTATAATTTGTGCATTTTTTCTTTACAGGTGGG CATCTGGATGTTTGTCAGTTGTTAGCGCGTGAAGGAGCTGATGTGAACGC CATGGACAATCGAGCAGTCTCTGTTCTCGTAGCCGCGTTCAGAAAAGGAA ACATCAAAGTGGTCAAGTGGCTGGTCAAACATGTATCACAGTTCCCACCT GATTCTGACTGCAAACGTTTCATTCAAACCATCTCTGATAAGGTTTGTGA AGATGTTTGGTACCAAAAGTAGATCTTTTAGATAAAGAAATTTGTTGAGT GGGTCCCTTTATGAGTTTGACTTTGGATTaatgatttgaaatttcttctt tctcaaTAGGACTTACTAAAGAAATTAGACGAATGTATGCAAATCATCAA CGCGGCAAAGAAAAGACAAGAAGCAGAGGCGAACAAGAACGCGTCCATTC TGTTGGAAGAGTTGGATCATGAGAAAAAGAAGGAGGAGAGGCGGAAAGCG CAAGCTCAAAAGAAACGTGATAAGAAGAagcagaagaaaaagaaaaagag tacGGAGAAGCAGTCTGTGGATACTGAAGAAGATGGCGAGAAAGAAGACG AGGAAGAGTTCGAACATGCAACGAGTGGATTCCCTTTCATCAATGCTGAT CAACGAACGCCCTTGATGATCAATGGTACTTTTCTTTATTGTCAGAAATG TCTTTTTGATATCAACTTTATGGACTGGTGGAAACTTTTTAGGAACCAGT ATAGTATAGTTCGTAAGAGGGACCCGAACCTCccttattttgaaatcttt taaagTCTACACTTTTTGCAGGGTTAAATCTTTGAGATCTAATATCAATC GCCTATTTCATCCAGGAAGACTTCCATCTGCACACTAAAAAGGTACCTGA TAAATAGATATGAATATTTCTTAtatatttctaatatttttcaCTGGCAT TGTTTTAGACGAACGACCCGATCTTTCGACTGCTGAATTGAAACTGAAAT CTCAAGTTCAACTGAAGAGCAAGAAGAAGAGCCGTCTAAAGAGTCGCAAC TCCTCTCTCAGCAAAAGTACGGATGAAGAGAAGGAGATGGCGGACAAAGA TGTGGAAGATATCATAGATCCCGTATCCACCGCCATCGATGCTCTGACCA ACATCGTTATCACTACTGCTGCTCAATTTGTATCCTCTATCAAGTAAGAA TTGTGGTACAGTGTTGTAACTTTTCCGTctgtagacgaaaatccgtccaG TTAAGATAAAAACACACAATTTCCGTCTTGCTAGCAAGAGGCAAATGATG ACCCACAAAACCAAAGATTGATTTTGTttatattcaaaaaagtttttcaa catTGATACACTATTCCACTATTTCCATTGAAAATAACGAGTAAGAACTT CAATCGGGTTATCTCACAATTtcatttatattattttttacagACCAACA GACACAGTGAGTGCGGCAACAGTAGCTGAAATCACCAAAGCTCTTGCAGC TTCCATCATCACTAACGCTAAAGACAATACTAAGACCTCTATCCCAGATG AGGTTGCTGTTACTATGGCAACGGCTGCTGCTCAACGTGTGGCGGTCAGC ATTTCTTCACCTTCGCTACTAAGCAACAATAATAACAATGGATTTGCGCT TAACACGAGTCAGAAGAAAGCAAAACGAGTTGACGACGAATGGAAAGAGG TCACTCGAAGGTtggtatttttttaataattgtgATACAATTGGGAGGGG TAGGTACTGGTTTCTCAGACATATAAGAGTACTAGAAGGTTTTTGGGAAA CTTTGCATACAACCAAACTTATTCAGAGAAGTGGTATTTAGGTTTTAGTA CAGATTTTCCTAGACACCACCCTATTTTGATCTTCTCGGGACAGATTTGG ctgaattcaaaataattggGACTTTTTAAAAAGGAGgcgaaaaatgttca aaaaatgataaaaacactAGTACTTATACAGggtgttcttgtaaaaaagt aCCGTAAGTAGAAATACATTACTTTTGTGTATATGACAAAGATTTTCTGT ATGCCACCAATCATCGCCAATCACCAATCATAATCATATGATATTCACTT CACCACTTTCTTCATTTCAGCATTCCGCATACGAAGTCAAGGAAGATCTT GATACCAGCCGCCTTGATCAGTCGCGTTATCGGTCGTGGTGGGTGCAACG TCAACGCAATACGTGAACACACGGGAGCACATATCGACATCGATACAAAT CGAAAGAAAGCCAACGGTGATTGTATGGTCACCATCAAGTAAGGAACTTT TGAACATTTCATTCATACAATGTCCTTGACGTTTACAACTTGTCTCGTGA AATGAATTTGCTGTCTTTTTAAGATCCGATCAAATTGGAATCTAACAAAT AATTTTGACTTCTGGATTTCATATTTGAACACAAGAAAATGATTAGGTCT GGATGAAGCCATCTTCACTACAGCAATTATTACACACTCTATAAAGGTGg agaataagaaaaaaatacttaGCTATCCTCTGAAACAAttattttctctc aaaattcaGGGNCAGGTGgagaataagaaaaaaatacttaGCTATCCTCT GAAACAAttattttctctcaaaattcaGGGGTTCGCAACAAGCTACGAAA CAAGCAGGGAACTTGATCCAATCTTTGATCGACGATCCCGATAGCAACGT TGCGGAAATTCTCCCTACACTTCCTACTATTGCGACGTCTCTGTCTACAA GCGTCTCATCTTCTTCTCTCATTCCTCTCATGAAAAACCTCACCAAACCC ACCACCATCGAATCGTCTCTCGACAttccaaaaacaattcaatcACTTTC AAAATCACTTAACACGCCCAAAACTAGCGACAAAATACCGACGCTTCGAC AAATCTCGGCACCAGCAAATTTGGTGCCTCCTACATCGACACCTTCTTCT CAACCAGTACGAATGGTTCCTGTTGTCAACTCGAATTCCAAGAAACTCGA AGTCGCCAAGGAATCTTCGGCGCCGTCTAGAACGAAAGTGAAACCTCCTG CGCTCACTACAACCACACCAAATAGTGGATGGAAGTCCACTAATCAACAA GACACCAACACCGTGCTAAAGCAGACGTCCTCAACGATGGCTGTCTCTAC TCGCTCACAGGTGTCAGTGACACGGCAATTATCGAATGAAGGGAGCCAAG TGCACCAACAAATTATAACGACCATCAGTACAACAGTTTTCTCATCCTCT TCTCGTAATCTTCCCAAACCCATCGGTAGCAATCGACCCTTTCGACCAAT CGCTTCTCCCACTAATGCTCTCTCGTCAACAGCTGTGTCGAATTCAGTGG CAGCCACTCTTCATTCGACATTAAACAGTCTACTTTCGCAGGTGGCGACA CAACGCAGTCCCATGATATGGAACGATCATCCAGGTTCGAAGGAGCACCA TGGTAGCAGTGGTGATCTGGTGGTGACGACAGTAGCCACCTCACCCAACA ATACGCTAAACGGAACGCCCATTGAACGATTCTTACCCGCCTCTCTTTCG CAAGCTTCTTCACAGGAATCGTTCAAAGGTCACTCGAGAACACCTTCACT ATCTCCAACTTCTAACCACTCCAATTCACCGACACCAGAAGAAAAACCCC ACCTCAACCCCATCGGTAGTGAAAGAGGTCACAAGAAACCGACTGTAAAC CAACAGGGCGGCTTGCAAGGTCTTACCTCGCTACTACAAGGTTATTTCAG ATTTATATTTTAATATGTTCAGTCCCCTTTGTGATCGATATGATTTTATC TTTATCTTTTACGTGTATTTCTTTAAAGTATAATTCCGGCAGTTACTGTC ATATAATGCAATATCATTAATTCTCTCTTCTTTATGGGTTTAGGATCCGA CAGTGGGCAGAACTTGTGGCGTTTTGACTACAACATGAGGAAGTCACCTT CGTGGAAGCCAAACTCGTCTCCTGTCGGGTGGACTGCACCCAACGAACAA GCGaaggaaatgaaaccactgctAGCGAATGGCGATATGGAACACCATCA TCCTTCGGTTGATCACGTCATCGGGCCTGATGAAACACTGCAAAGTCTTC TCGAACGCCTCTCATTGTCCACTCATCTCAATCTTTTTCAGGTAAGCAGT TGCTTCCAAATTGATGCCTCATACATCTTGTTGTTATCCAACGTTTGCTT CACAATTGACACGCAAACTTTAAGTCTTCGTTGCTTCTATTGAATTTTCA TTTCTCTTCTCGTTTAGAAAAACGAAATTGATTTGGATGCGTTGATGTTG ATGTCGGAACAAGACTATGCGGACATTGGTCTTCCGAAGGAACCACGTAT CAAGTTGTTGAACAGCATGCGACAACTGCAAAACAGATCCACTGCTCACG TCCCTCAATCACCGCCCCAACAAATACCATTACTGAAGCACATCAATCCA CAGCCGCTATGGAATTCTGCAATGGATAATAACTTACATCACCCTGAAAG CCGGTTACCACCCGCACTTCGGAACAGTGTTCATTTTCCTGGAACACCAC AGCTTGCTGTAAGACactttaatcaaactttgtgtATTTCATGTCGctct tttccatttttttgttgCTGTTCGTTGTCTTTGGTGACTATCACTAATTT AATACTTGTGAGGTGCCTATGATTGCTCAAAGCTGTGTCACGCTGGTGCA TTGCAATCTTCAGAAAATTTAAGTGCGATACTAATGATTCTATTTGCCCG TGttcactttgcaattttttacaaaatatttcctAAATTCTCCTTAGGCT TCCTGGCAGACGTGGAGTAACACTATCGATCAATGAAACGGTGAGTCATT CATTTGCAGGTTCACACTAATACAAACTGCTTCTAAGCACATGCTTTTGA GTTTACATGAGTTTGAAATTACTTATGGAGGTGATACAATCACCAGTGCT ATCTGAACCATAGCAAGGCGAACTAATAAAAGGCGACTTGGTTCGAGTTT GCGAAGTACATGCTTTTGAACTTATATGACTTTGATCTTACTACCAGTTc aaatcgcagacctctacaaaactaCAGATAGTATTAGGAGCACGACTTTG TTAAAGGATGTGATCAGCCTAACTATTTTgttcttgttttcattttgacg aacttcttttttactttctcCCTCAGGTATTCGTTGGCAACGGAGTGTAA TTGGAAATCAAGATTGTCCctttcattttcattgactGGAATTTTTCATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000571XLOC_000571Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000966-exon-sc0000007-1491911889:218373..218483TCONS_00000966-exon-sc0000007-1491911889:218373..218483Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:218373..218483TCONS_00000966-exon-sc0000007-1510915933:218373..218483Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:218373..218483TCONS_00000966-exon-sc0000007-1575043694:218373..218483Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:218619..218713TCONS_00000966-exon-sc0000007-1491911889:218619..218713Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:218619..218713TCONS_00000966-exon-sc0000007-1510915933:218619..218713Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:218619..218713TCONS_00000966-exon-sc0000007-1575043694:218619..218713Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:220297..220344TCONS_00000966-exon-sc0000007-1491911889:220297..220344Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:220297..220344TCONS_00000966-exon-sc0000007-1510915933:220297..220344Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:220297..220344TCONS_00000966-exon-sc0000007-1575043694:220297..220344Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:221127..221248TCONS_00000966-exon-sc0000007-1491911889:221127..221248Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:221127..221248TCONS_00000966-exon-sc0000007-1510915933:221127..221248Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:221127..221248TCONS_00000966-exon-sc0000007-1575043694:221127..221248Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:221417..221484TCONS_00000966-exon-sc0000007-1491911889:221417..221484Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:221417..221484TCONS_00000966-exon-sc0000007-1510915933:221417..221484Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:221417..221484TCONS_00000966-exon-sc0000007-1575043694:221417..221484Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:221672..221863TCONS_00000966-exon-sc0000007-1491911889:221672..221863Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:221672..221863TCONS_00000966-exon-sc0000007-1510915933:221672..221863Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:221672..221863TCONS_00000966-exon-sc0000007-1575043694:221672..221863Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:222267..222464TCONS_00000966-exon-sc0000007-1491911889:222267..222464Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:222267..222464TCONS_00000966-exon-sc0000007-1510915933:222267..222464Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:222267..222464TCONS_00000966-exon-sc0000007-1575043694:222267..222464Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:222582..222709TCONS_00000966-exon-sc0000007-1491911889:222582..222709Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:222582..222709TCONS_00000966-exon-sc0000007-1510915933:222582..222709Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:222582..222709TCONS_00000966-exon-sc0000007-1575043694:222582..222709Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:222894..223809TCONS_00000966-exon-sc0000007-1491911889:222894..223809Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:222894..223809TCONS_00000966-exon-sc0000007-1510915933:222894..223809Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:222894..223809TCONS_00000966-exon-sc0000007-1575043694:222894..223809Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:223976..224221TCONS_00000966-exon-sc0000007-1491911889:223976..224221Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:223976..224221TCONS_00000966-exon-sc0000007-1510915933:223976..224221Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:223976..224221TCONS_00000966-exon-sc0000007-1575043694:223976..224221Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:224313..224815TCONS_00000966-exon-sc0000007-1491911889:224313..224815Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:224313..224815TCONS_00000966-exon-sc0000007-1510915933:224313..224815Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:224313..224815TCONS_00000966-exon-sc0000007-1575043694:224313..224815Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:228866..229103TCONS_00000966-exon-sc0000007-1491911889:228866..229103Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:228866..229103TCONS_00000966-exon-sc0000007-1510915933:228866..229103Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:228866..229103TCONS_00000966-exon-sc0000007-1575043694:228866..229103Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:229218..229414TCONS_00000966-exon-sc0000007-1491911889:229218..229414Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:229218..229414TCONS_00000966-exon-sc0000007-1510915933:229218..229414Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:229218..229414TCONS_00000966-exon-sc0000007-1575043694:229218..229414Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:229532..229847TCONS_00000966-exon-sc0000007-1491911889:229532..229847Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:229532..229847TCONS_00000966-exon-sc0000007-1510915933:229532..229847Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:229532..229847TCONS_00000966-exon-sc0000007-1575043694:229532..229847Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:230131..230365TCONS_00000966-exon-sc0000007-1491911889:230131..230365Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:230131..230365TCONS_00000966-exon-sc0000007-1510915933:230131..230365Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:230131..230365TCONS_00000966-exon-sc0000007-1575043694:230131..230365Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:230616..230882TCONS_00000966-exon-sc0000007-1491911889:230616..230882Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:230616..230882TCONS_00000966-exon-sc0000007-1510915933:230616..230882Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:230616..230882TCONS_00000966-exon-sc0000007-1575043694:230616..230882Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:231293..231460TCONS_00000966-exon-sc0000007-1491911889:231293..231460Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:231293..231460TCONS_00000966-exon-sc0000007-1510915933:231293..231460Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:231293..231460TCONS_00000966-exon-sc0000007-1575043694:231293..231460Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:231801..232912TCONS_00000966-exon-sc0000007-1491911889:231801..232912Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:231801..232912TCONS_00000966-exon-sc0000007-1510915933:231801..232912Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:231801..232912TCONS_00000966-exon-sc0000007-1575043694:231801..232912Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:233066..233313TCONS_00000966-exon-sc0000007-1491911889:233066..233313Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:233066..233313TCONS_00000966-exon-sc0000007-1510915933:233066..233313Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:233066..233313TCONS_00000966-exon-sc0000007-1575043694:233066..233313Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:233440..233730TCONS_00000966-exon-sc0000007-1491911889:233440..233730Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:233440..233730TCONS_00000966-exon-sc0000007-1510915933:233440..233730Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:233440..233730TCONS_00000966-exon-sc0000007-1575043694:233440..233730Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:233970..234031TCONS_00000966-exon-sc0000007-1491911889:233970..234031Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:233970..234031TCONS_00000966-exon-sc0000007-1510915933:233970..234031Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:233970..234031TCONS_00000966-exon-sc0000007-1575043694:233970..234031Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1491911889:234349..234422TCONS_00000966-exon-sc0000007-1491911889:234349..234422Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1510915933:234349..234422TCONS_00000966-exon-sc0000007-1510915933:234349..234422Clytia hemisphaericaexon
TCONS_00000966-exon-sc0000007-1575043694:234349..234422TCONS_00000966-exon-sc0000007-1575043694:234349..234422Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:218373..234422 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.78474 0.0358514 1.03308 0.562737 6.22796 2.4173 2.95669 3.29886 2.77664 3.09216 0.632808 1.75281 3.75667 3.08452 3.63553 0.402727 1.55388 2.1237 1.59488 0.325301 1.70806 2.63906 4.54229 0.0018507 3.35898 3.47192 2.22049 3.28216 0.557797 2.11599
Blast
BLAST of TCONS_00000966 vs. Swiss-Prot (Human)
Match: ANR17 (Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3)

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 326/456 (71.49%), Postives = 375/456 (82.24%), Query Frame = 3
Query: 1800 TEAEEGIMVADSARTLQNSINGMV-----REDPIGECSSLPIGECSSLPSIETTLPVPAQSPVTPPLSPAIDIDQSTDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLVKHVSQFPPDSDCKRFIQTISDKDLLKKLDECMQIINAAKKRQEAEANKNASI 3152
            TE ++G+MVA  A+TL ++++ ++     R   +    +  I    S P   T  P+ + S + P + PAIDID  T+SNHDTALT+ACAGGH+ELVQ LL RG++IEHRDKKG TPLILAATAGH     ILL++GADIEAQS+RTKDT LSLACS GRQEVVELLL   AN EHRNVSDYTPLSLAASGGYV IIK+LLN GAEINSRTGSKLGISPLMLAAMNGH AAVKLLLD GSD+NAQIETNRNTALTLACFQGRTEVV LLLDR ANVEHRAKTGLTPLMEAASGGY +VGRVL+D+GADVNA PVPSSRDTALTIAADKGHYKF ELL+ RGA +DVRNKKG TPLWL+A+GGHLDV QLL + GADV+A DNR ++ L+AAFRKG++KVV++LVK V+QFP DS+C R+I TI+DK++LKK   CM+ I  AK RQ AEANKNASI
Sbjct: 1004 TETQQGLMVASPAQTLNDTLDDIMAAVSGRASAMSNTPTHSIAASISQPQTPTPSPIISPSAMLP-IYPAIDIDAQTESNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMESIVQAKDRQAAEANKNASI 1458          

HSP 2 Score: 528.865 bits (1361), Expect = 1.286e-153
Identity = 267/343 (77.84%), Postives = 303/343 (88.34%), Query Frame = 3
Query:    3 SNGHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGASTPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1031
            S GHV+VA+LLL+ GAGINTHS+EFKESALTLACYKGH++MV FLLE GADQEHKTDEMHTALMEA MDGHVEVARLLLD GAQVNMPADSFESPLTLAACG HVELA LLIE GA+LEEVNDEG+TPLMEAAREG+  MVALLL  GAN+ AQTEETQETALTLACCGGFLEV  +L+  GADIELG STPLMEAA EGH+ELVK+L+  GANV+A TATGD ALTYA ENGHTDV +VL++ GA++EHESEGGRTPLMKAARAGH+CTV++L+S+GA+VNR T+  +H+VLSLACAGGH AVVELLL  G +PT +LKD S+MLIEAAKGGH +V   L++
Sbjct:  376 SAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLD 718          

HSP 3 Score: 214.927 bits (546), Expect = 1.422e-55
Identity = 140/358 (39.11%), Postives = 210/358 (58.66%), Query Frame = 3
Query:    3 SNGHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMH-TALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGAS---TPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLM--NTQIHQQTFT 1058
            S G V   + LL  G  +N H+ E  ES L LAC  G+ ++   LL   A+ E +  +   T LM A+  GHV++ +LLL H A VN  + +  + LT A  G +V++ ++L+E GA++E+ N+ G TPLMEA   G++ +  LLL +GA +   + E +E+ALTLAC  G LE+V +LL+ GAD E       T LMEA  +GHVE+ + L++ GA VN    + ++ LT AA  GH ++  +LIE+GA++E  ++ G TPLM+AAR GH   V  LL QGA++N +T   + + L+LAC GG   V + L+  G +  +     S+ L+EAA+ GH  +   L+     +H  T T
Sbjct:  243 SEGDVNAVRKLLIEGRSVNEHTEE-GESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGC---STPLMEAAQEGHLELVKYLLAAGANVHATTAT 596          

HSP 4 Score: 206.068 bits (523), Expect = 8.254e-53
Identity = 134/360 (37.22%), Postives = 201/360 (55.83%), Query Frame = 3
Query: 2019 SNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINS-------------------------RTGSKL------GISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVN-AMDNRAVSVLVAAFRKGNIKVVKWLVKH 3002
            S  +TALT ACAGG+ ++V++LL  G++IE  ++ G TPL+ A +AGH     +LLE+GA I   S+  K++AL+LAC  G  E+V  LL + A+ EH+    +T L  A   G+V + ++LL+ GA++N                            G+ L      G +PLM AA  GH   V LLL +G+++NAQ E  + TALTLAC  G  EV   L+   A++E       TPLMEAA  G++++ + L+  GA+V+A    ++ DTALT A + GH   A++L+  GA ++  ++ G TPL  +A  GH+   Q L  +GA+VN    N   +VL  A   G++ VV+ L+ H
Sbjct:  332 STGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGCS---TPLMEAAQEGHLELVKYLLAAGANVHA--TTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAH 686          

HSP 5 Score: 187.963 bits (476), Expect = 2.413e-47
Identity = 124/325 (38.15%), Postives = 192/325 (59.08%), Query Frame = 3
Query: 2028 DTALTIACAGGHDELVQLLLARGSNIEHRDKKG-CTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGC-TPLWLSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLV 2996
            ++ L +AC+ G+ EL Q+LLA  +N+E R  KG  TPL+ AA  GH     +LL H AD+ AQS  T +TAL+ AC+ G  +VV++LL S A+ E  N + +TPL  A S G+V + ++LL +GA IN+ + ++   S L LA   GH+  V+ LL+ G+D   + +   +TAL  AC  G  EV  LLLD  A V   A +  +PL  AA GG+V++  +LI+RGA +    V     T L  AA +GH +   LL+ +GA ++ + ++   T L L+  GG L+V   L + GAD+   +    + L+ A ++G++++VK+L+
Sbjct:  268 ESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSS-TGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHS-NEFKESALTLACYKGHLEMVRFLLEAGADQEHKTD-EMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGASLEE--VNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADI---ELGCSTPLMEAAQEGHLELVKYLL 584          

HSP 6 Score: 184.496 bits (467), Expect = 2.902e-46
Identity = 117/325 (36.00%), Postives = 185/325 (56.92%), Query Frame = 3
Query: 2028 DTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVNAM-DNRAVSVLVAAFRKGNIKVVKWLVK 2999
            + +L  AC+ G    V+ LL  G ++    ++G + L LA +AG+     +LL   A++E +  +   T L  A + G  ++V+LLL   A+   ++ +  T L+ A +GGYV ++KVLL  GA I     ++ G +PLM A   GHV   +LLL+ G+ +N      + +ALTLAC++G  E+V  LL+  A+ EH+     T LMEA   G+V+V R+L+D GA VN +P   S ++ LT+AA  GH + A LL+ RGA ++  N +G TPL  +A  GH ++  LL  +GA++NA  +    + L  A   G ++V  +L+K
Sbjct:  235 NRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDH--NENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVN-MPA-DSFESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIK 555          

HSP 7 Score: 183.726 bits (465), Expect = 4.100e-46
Identity = 120/328 (36.59%), Postives = 177/328 (53.96%), Query Frame = 3
Query:   54 INTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPAD-SFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGASTPLMEAATEGHVELVKFLIEKGANVNA-ITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNR-KTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLM 1028
            I+  +    ++ALTLAC  GH ++V  LLERGA  EH+  +  T L+ A+  GHV V  +LLD+GA +   ++ + ++PL+LA  G   E+ ELL+  GAN E  N   +TPL  AA  GY+ ++ +LL  GA                             ++     +LG S PLM AA  GH   VK L++ G+++NA I    + ALT A   G T+VV +L+++ AN+EH ++ G TPLM+AA  G+      LL +GADVN         + L++A   GH    ELL+GRG +  ++ K  ++ L  AA GGH +V  LL+
Sbjct: 1075 IDAQTESNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAE----------------------------INSRTGSKLGIS-PLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLV 1373          

HSP 8 Score: 167.933 bits (424), Expect = 2.668e-41
Identity = 119/328 (36.28%), Postives = 172/328 (52.44%), Query Frame = 3
Query: 2001 IDQSTDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGS----------------------------KLGIS-PLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLD-VCQLL 2894
            I+  ++   ++ALT+AC  GH E+V+ LL  G++ EH+  +  T L+ A   GH     +LL+ GA +   +D + ++ L+LA   G  E+  LL+   A+ E  N   YTPL  AA  G+  ++ +LL  GA IN++T                              +LG S PLM AA  GH+  VK LL  G++V+A   T  +TALT AC  G T+V  +LL   A++EH ++ G TPLM+AA  G+V   + LI +GA+VN     ++  T L++A   GH    ELL+  GA    R K G T L  +A GGH   VC LL
Sbjct:  393 INTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPAD-SFESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATG-DTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRT-TANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLL 717          

HSP 9 Score: 163.696 bits (413), Expect = 5.682e-40
Identity = 115/286 (40.21%), Postives = 161/286 (56.29%), Query Frame = 3
Query:  186 ALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEG-FTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIE---LGASTPLMEAATEGHVELVKFLIEKGANVNAIT-ATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLM 1028
            +L EA  +G V   R LL  G  VN   +  ES L LA    + ELA++L+   AN+E+   +G  TPLM AA  G++ +V LLLAH A++      T  TALT AC GG+++VV  LL+ GA IE       TPLMEA + GHVE+ + L+E GA +N  +    ++ALT A   GH ++V  L+E GA+ EH+++   T LM+A   GH+     LL  GA VN      E S L+LA  GGH  +  LL+ RG +      +  + L+EAA+ GH  +  LL+
Sbjct:  237 SLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADV-NAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFE-SPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLL 520          

HSP 10 Score: 154.066 bits (388), Expect = 4.718e-37
Identity = 103/283 (36.40%), Postives = 155/283 (54.77%), Query Frame = 3
Query:    9 GHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFE--SPLTLAACGSHVELAELLIEHGANLE-EVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIEL-----GASTPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQ 833
            GHV V ++LLD GA I   S   K++ L+LAC  G  ++V  LL RGA++EH+    +T L  A+  G+V + ++LL+ GA++N    S    SPL LAA   H    +LL++ G+++  ++     T L  A  +G   +V+LLL   AN+     +T  T L  A  GG+ EV   LLD GAD+          T L  AA +GH +  + LI +GA+++     G+  L  AA  GH DVV++L++ GA+++       TPLM A R GH+  V YL+ +
Sbjct: 1127 GHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANV-EHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGADVDAADNRKITPLMAAFRKGHVKVVRYLVKE 1408          

HSP 11 Score: 152.14 bits (383), Expect = 1.770e-36
Identity = 97/265 (36.60%), Postives = 142/265 (53.58%), Query Frame = 3
Query: 2028 DTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTG-------------------------------SKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVP 2729
            ++ LT+A  GGH EL  LL+ RG+++E  + +G TPL+ AA  GH     +LL  GA+I AQ++ T++TAL+LAC  G  EV + L+ + A+ E   +   TPL  AA  G++ ++K LL  GA +++ T                                S+ G +PLM AA  GHV  V+ L+ +G++VN     N +T L+LAC  G   VV LLL   A+  HR K G T L+EAA GG+  V   L+D   ++ + P P
Sbjct:  468 ESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIE---LGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLLSAPPP 729          

HSP 12 Score: 142.51 bits (358), Expect = 1.466e-33
Identity = 92/220 (41.82%), Postives = 128/220 (58.18%), Query Frame = 3
Query:  387 LMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIE----LGASTPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMNT 1034
            L EA  EG +  V  LL  G ++  +  E  E+ L LAC  G+ E+   LL   A++E     G  TPLM AA  GHV++VK L+   A+VNA ++TG+ ALTYA   G+ DVV+VL+E GA+IE  +E G TPLM+A  AGH+     LL  GA +N  ++  + S L+LAC  GH  +V  LL  G +   K  +  + L+EA   GH  VA LL+++
Sbjct:  238 LAEACSEGDVNAVRKLLIEGRSV-NEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDS 456          

HSP 13 Score: 131.339 bits (329), Expect = 3.777e-30
Identity = 88/254 (34.65%), Postives = 128/254 (50.39%), Query Frame = 3
Query:  288 LTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGAS----TPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHE--SEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1031
            LTLA  G H EL + L+E GA++E  + +GFTPL+ AA  G++                                   VV  LLD GADIE  +     TPL  A + G  E+V+ L+ +GAN      +    L+ AA  G+ +++++L+  GA I     S+ G +PLM AA  GH   V+ LL  G+D+N +     ++ L+LAC  G T VV LLL R  N   + K   + L+EAA GG+A V  +L++
Sbjct: 1087 LTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHV----------------------------------GVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLD 1306          

HSP 14 Score: 129.798 bits (325), Expect = 1.280e-29
Identity = 79/212 (37.26%), Postives = 116/212 (54.72%), Query Frame = 3
Query:    6 NGHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMP--ADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGASTPLMEAATEGHVELVKFLIEK 635
            NGH    KLLLD G+ IN      + +ALTLAC++G  ++V  LL+R A+ EH+     T LMEA+  G+ EV R+LLD GA VN P    S ++ LT+AA   H +  ELLI  GA+++  N +G TPL  AA  G+L +V LL+  GA+                            +D   + ++   TPLM A  +GHV++V++L+++
Sbjct: 1228 NGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGAD----------------------------VDAADNRKI---TPLMAAFRKGHVKVVRYLVKE 1408          

HSP 15 Score: 115.161 bits (287), Expect = 3.215e-25
Identity = 51/101 (50.50%), Postives = 74/101 (73.27%), Query Frame = 3
Query: 3834 KKAKRVDDEWKEVTRSIPHTKSRKILIPAALISRVIGRGGCNVNAIREHTGAHIDIDTNRKKANGDCMVTIKGSQQATKQAGNLIQSLIDDPDSNVAEILP 4136
            K+ ++ ++ WKEV R     +S+K+ +P+ +ISRVIGRGGCN+NAIRE TGAHIDID  + K  GD ++TI+G  ++T+QA  LI +LI DPD  + E++P
Sbjct: 1711 KRGQKREEGWKEVVR-----RSKKVSVPSTVISRVIGRGGCNINAIREFTGAHIDIDKQKDK-TGDRIITIRGGTESTRQATQLINALIKDPDKEIDELIP 1805          

HSP 16 Score: 105.531 bits (262), Expect = 2.352e-22
Identity = 55/121 (45.45%), Postives = 77/121 (63.64%), Query Frame = 3
Query:  669 DAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1031
            D ALT A   GH ++V+ L+E+GA+IEH  + G TPL+ AA AGH+  VE LL  GAD+  ++   + + LSLAC+GG   VVELLL RG N   +   + + L  AA GG+ N+  +L+N
Sbjct: 1084 DTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLN 1204          

HSP 17 Score: 100.138 bits (248), Expect = 1.246e-20
Identity = 59/150 (39.33%), Postives = 91/150 (60.67%), Query Frame = 3
Query:    9 GHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVN-MPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANL 455
            GH+++ K LL AGA ++  ++   ++ALT AC  GH D+   LL+ GAD EH+++   T LM+A+  GHV   + L+  GA VN   A++  + L+LA  G H+ + ELL+ HGA+      +G T L+EAA+ G+  +V  LL +  NL
Sbjct:  575 GHLELVKYLLAAGANVHA-TTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNL 723          

HSP 18 Score: 95.9005 bits (237), Expect = 2.306e-19
Identity = 52/128 (40.62%), Postives = 73/128 (57.03%), Query Frame = 3
Query: 2010 STDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNH 2393
            +T +  DTALT AC  GH ++  +LL  G+++EH  + G TPL+ AA AGH  T   L+  GA++   +     T LSLAC+ G   VVELLL   A+  HR     T L  AA GG+  ++  LL++
Sbjct:  592 ATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDY 719          

HSP 19 Score: 87.0409 bits (214), Expect = 9.904e-17
Identity = 66/183 (36.07%), Postives = 95/183 (51.91%), Query Frame = 3
Query:  537 LDCGADIELGASTPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGR-TPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGG--NPTMKLKDNSSMLIEAAKGGHANVAHLL--MNTQIHQQTFTQTDT 1070
            +D  A  E    T L  A   GH ELV+ L+E+GA++      G   L  AA  GH  VVE+L++ GA+IE +SE  + TPL  A   G    VE LL++GA+   +    +++ LSLA +GG+  ++++LL  G   N     K   S L+ AA  GH     LL  M + I+ Q  T  +T
Sbjct: 1073 IDIDAQTESNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNV-SDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNT 1254          
The following BLAST results are available for this feature:
BLAST of TCONS_00000966 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ANR171.286e-15371.49Ankyrin repeat domain-containing protein 17 OS=Hom... [more]
back to top