Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000952 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000952
Unique NameTCONS_00000952
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6664

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000952 ID=TCONS_00000952|Name=TCONS_00000952|organism=Clytia hemisphaerica|type=transcript|length=6664bp
gcgcgcgatcagtgaaagttatcgtgacatgttatgacaaaaagtatgat
tgataaacttggtggagttatcaaaataaatttgttgtcaaagagNTGAC
ATCAGTGATGAAGATGAAGACAGTATGTCGCTCCAATGTCTAGACCATAC
CAATAACTTGACAACTCGACTTTTACTTGCTGGGGAAGATATAAATCATG
ATTTATCAAATCTCACTCTTGTTGGTCCAGAAACACAAGCAAGACTTGAA
GCCTTGTTAGAGGCAGCTGGTGTTGCAGCAGATGGAAAAGCTTTCACTGA
TCCTGAAGTTCTGCGTCGACTAACTTCTTCAGTTAGCAGTGCACTAGATG
AAGCAGCTGCAGCACTGACAAGAATGAGATCACAAACAGGGAAACCAAAT
GCAACAACTTCGCAATCTGAGCAAGGCACCCGTAGCCTTGTGGAGGCTTG
CATTGAAGGAGATATAGCTGCAGTTCGTAAACTTTTAGATGAAGGAAGAA
GTGTACATGAACCAACTGATGAAGGAGAAAGTTTGTTGTCATTGGCTTGT
TCTGCTGGTTACTACGAACTTGTACAAGTGTTACTTGCAATGAACGCCAA
TGTTGAAGATAGAGGTAGTAAAGGTGATTGTACTCCTCTCATTGAGGCTG
CCAGCAATGGTTTTGTTGACATTGTAAAACTTCTTCTTCAACATGGAGCC
AATGTCAATGCACAATCATCTGCTGGAAACACTTCACTTCATAAAGCTTG
TGGTAGTGGATATGATGATGTCGTTGAACTTCTTATACAACACAATGCAG
ATCTTGAACATCAAAATGAAAACGGACATACTCCTCTGATGGACGCAGCT
AGCAATGGTCATGTCAAAGTAGCCAAACTTTTGCTTGATGCAGGTGCTGG
AATTAATACACACTCAAGTGAATTCAAAGAAAGTGCTTTAACTTTGGCCT
GCTACAAAGGGCATGTTGATATGGTTTTCTTTTTATTGGAGAGAGGTGCT
GACCAAGAACATAAGACAGATGAAATGCACACAGCTTTGATGGAAGCATC
AATGGATGGACATGTGGAAGTTGCAAGACTACTCTTGGACCATGGAGCTC
AGGTGAACATGCCGGCTGATAGTTTTGAATCCCCATTAACGCTTGCAGCA
TGTGGAAGTCATGTTGAATTAGCTGAGTTGTTGATTGAGCATGGTGCAAA
CCTTGAAGAAGTCAACGATGAAGGGTTCACTCCACTAATGGAAGCAGCTA
GGGAAGGATACTTACCAATGGTGGCTTTGCTTTTAGCACATGGAGCCAAC
TTGTATGCTCAGACAGAAGAGACACAAGAAACAGCATTGACACTTGCGTG
TTGTGGTGGGTTTCTGGAGGTGGTGGCTTACCTTTTGGATTGTGGTGCCG
ATATCGAACTTGGTGCATCTACTCCTCTCATGGAAGCAGCTACTGAAGGT
CATGTTGAACTTGTCAAATTTCTTATTGAGAAAGGTGCAAACGTGAATGC
CATCACAGCTACAGGTGATGCAGCATTGACATACGCTGCAGAAAACGGTC
ATACAGACGTAGTAGAAGTATTGATTGAACAAGGTGCCAACATTGAACAT
GAATCTGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTCGTGCGGGACA
CCTTTGCACAGTGGAATATCTCCTCAGTCAAGGGGCCGACGTGAATAGAA
AAACCAGCGGTGGAGAGCATTCTGTTTTATCATTAGCATGTGCTGGAGGC
CATACCGCTGTTGTCGAGCTCCTTCTTGGTAGAGGTGGTAATCCTACTAT
GAAATTAAAGGACAATTCAAGTATGTTGATAGAAGCGGCCAAAGGTGGTC
ATGCTAACGTAGCCCACCTGCTCATGAACACTCAAATACATCAACAAACC
TTCACTCAAACCGATACTTTACATTCTGAATATCCAATACATTCAAGCGC
TTTACCAACGGACAGCGCTTTCCCTATCTGTCCACACGTTCAACACGAGC
AAGATCACATCGCGCATCAACCAGATTGCCATTTTCATAATACGCCTGAA
AATCAACATTTTGCTCATGACTTTTCACAACAAATCATTCAACCGTCTCC
GCCTTCCGATCACTTTCAACAACAACATCCGAACGATGAGTTGGACGACG
AGAATTACAACAACAATATCGATGTCAACACTTCACCAACTGATCTTTAT
CTTCCCAACATACCTGTCTCCCTCGCTTCTTCTCTCTCACTCGCCAACCT
TACAACTGCCGATCTGCAACATTTAGCTCAGGTTTTACAATACTCTTCGA
ATCAAAATCAAACGCTTGAAGACGTAGTAGCGGCTGGTCAAAATGCTGAA
CAGATTGGTTTACAAACGATTACTTTCCCTGCAATCGACCCTCAAGTGGA
GAGTTTCACCACACAATCAGAAGTGTGTACACCATCACCCTCAAACACGG
CAACTGCTCTCGTTACAAGTGCAGGACGAACCATCACTTCAACTGGCGTG
CAAACTGAAGATGCAATTTCCATGATTCAAAAACTTACCAACAGTGTCCA
TCAGCTGAACGCTCTACAGACATTCGCAGCATCCCACAATTTGGAACTAG
TGAACCTGGGTGAGATTACACTACCTCCAGCGCCTTTCCAACTTGAAACA
GAAGCGGAAGAAGGGATCATGGTAGCTGATTCTGCACGCACTCTACAAAA
CTCCATCAACGGCATGGTTCGCGAAGatCCGATCGGTGAATGCAGCTCTT
TACCGATCGGTGAATGCAGCTCTTTACCATCCATCGAAACGACACTTCCA
GTACCGGCACAATCTCCCGTCACACCTCCCCTCTCACCAGCCATCGATAT
CGACCAAAGTACGGACAGTAATCACGATACGGCGCTCACTATCGCCTGTG
CTGGTGGACACGATGAACTTGTACAACTTCTGCTGGCCAGAGGTTCCAAC
ATTGAACACCGCGACAAAAAGGGCTGCACGCCATTAATCCTAGCGGCAAC
AGCAGGTCACACTGCCACATGTCACATTCTTCTCGAACATGGAGCAGACA
TCGAAGCACAATCAGATCGAACCAAAGACACTGCACTTTCCTTAGCATGT
TCCAGTGGTCGCCAAGAAGTTGTCGAATTACTCCTCATGTCCAATGCTAA
CTTTGAACACCGAAACGTCTCTGATTACACGCCTCTCAGTTTAGCAGCTT
CGGGAGGGTACGTTGGTATCATCAAAGTTCTGTTGAACCATGGTGCAGAG
ATCAATTCACGCACAGGAAGCAAGCTGGGCATCTCTCCCCTCATGTTAGC
GGCAATGAACGGTCATGTTGCGGCTGTCAAACTCCTCTTGGATCGTGGCA
GTGACGTCAATGCTCAAATCGAAACCAATAGAAATACAGCTTTAAcgtta
gcatgttttcaaggGCGAACGGAAGTTGTTGGTCTGCTTTTAGACCGACA
TGCAAATGTGGAACACAGGGCCAAGACCGGATTAACTCCATTAATGGAAG
CAGCATCAGGTGGTTACGTCGATGTGGGTCGTGTTCTGATCGATCGCGGT
GCAGATGTGAACGCCATCCCAGTCCCTTCGTCACGTGACACTGCACTCAC
AATCGCTGCCGATAAAGGACACTACAAATTCGCCGAGTTATTAGTGGTTC
GTGGTGCCGTTGTTGACGTGCGTAATAAGAAAGGATGTACACCTCTATGG
CTCTCCGCACACGGTGGGCATCTGGATGTTTGTCAGTTGTTAGCGCGTGA
AGGAGCTGATGTGAACGCCATGGACAATCGAGCAGTCTCTGTTCTCGTAG
CCGCGTTCAGAAAAGGAAACATCAAAGTGGTCAAGTGGCTGGTCAAACAT
GTATCACAGTTCCCACCTGATTCTGACTGCAAACGTTTCATTCAAACCAT
CTCTGATAAGGACTTACTAAAGAAATTAGACGAATGTATGCAAATCATCA
ACGCGGCAAAGAAAAGACAAGAAGCAGAGGCGAACAAGAACGCGTCCATT
CTGTTGGAAGAGTTGGATCATGAGAAAAAGAAGGAGGAGAGGCGGAAAGC
GCAAGCTCAAAAGAAACGTGATAAGAAGAagcagaagaaaaagaaaaaga
gtacGGAGAAGCAGTCTGTGGATACTGAAGAAGATGGCGAGAAAGAAGAC
GAGGAAGAGTTCGAACATGCAACGAGTGGATTCCCTTTCATCAATGCTGA
TCAACGAACGCCCTTGATGATCAATGACGAACGACCCGATCTTTCGACTG
CTGAATTGAAACTGAAATCTCAAGTTCAACTGAAGAGCAAGAAGAAGAGC
CGTCTAAAGAGTCGCAACTCCTCTCTCAGCAAAAGTACGGATGAAGAGAA
GGAGATGGCGGACAAAGATGTGGAAGATATCATAGATCCCGTATCCACCG
CCATCGATGCTCTGACCAACATCGTTATCACTACTGCTGCTCAATTTGTA
TCCTCTATCAAACCAACAGACACAGTGAGTGCGGCAACAGTAGCTGAAAT
CACCAAAGCTCTTGCAGCTTCCATCATCACTAACGCTAAAGACAATACTA
AGACCTCTATCCCAGATGAGGTTGCTGTTACTATGGCAACGGCTGCTGCT
CAACGTGTGGCGGTCAGCATTTCTTCACCTTCGCTACTAAGCAACAATAA
TAACAATGGATTTGCGCTTAACACGAGTCAGAAGAAAGCAAAACGAGTTG
ACGACGAATGGAAAGAGGTCACTCGAAGCATTCCGCATACGAAGTCAAGG
AAGATCTTGATACCAGCCGCCTTGATCAGTCGCGTTATCGGTCGTGGTGG
GTGCAACGTCAACGCAATACGTGAACACACGGGAGCACATATCGACATCG
ATACAAATCGAAAGAAAGCCAACGGTGATTGTATGGTCACCATCAAGGGT
TCGCAACAAGCTACGAAACAAGCAGGGAACTTGATCCAATCTTTGATCGA
CGATCCCGATAGCAACGTTGCGGAAATTCTCCCTACACTTCCTACTATTG
CGACGTCTCTGTCTACAAGCGTCTCATCTTCTTCTCTCATTCCTCTCATG
AAAAACCTCACCAAACCCACCACCATCGAATCGTCTCTCGACAttccaaa
aacaattcaatcACTTTCAAAATCACTTAACACGCCCAAAACTAGCGACA
AAATACCGACGCTTCGACAAATCTCGGCACCAGCAAATTTGGTGCCTCCT
ACATCGACACCTTCTTCTCAACCAGTACGAATGGTTCCTGTTGTCAACTC
GAATTCCAAGAAACTCGAAGTCGCCAAGGAATCTTCGGCGCCGTCTAGAA
CGAAAGTGAAACCTCCTGCGCTCACTACAACCACACCAAATAGTGGATGG
AAGTCCACTAATCAACAAGACACCAACACCGTGCTAAAGCAGACGTCCTC
AACGATGGCTGTCTCTACTCGCTCACAGGTGTCAGTGACACGGCAATTAT
CGAATGAAGGGAGCCAAGTGCACCAACAAATTATAACGACCATCAGTACA
ACAGTTTTCTCATCCTCTTCTCGTAATCTTCCCAAACCCATCGGTAGCAA
TCGACCCTTTCGACCAATCGCTTCTCCCACTAATGCTCTCTCGTCAACAG
CTGTGTCGAATTCAGTGGCAGCCACTCTTCATTCGACATTAAACAGTCTA
CTTTCGCAGGTGGCGACACAACGCAGTCCCATGATATGGAACGATCATCC
AGGTTCGAAGGAGCACCATGGTAGCAGTGGTGATCTGGTGGTGACGACAG
TAGCCACCTCACCCAACAATACGCTAAACGGAACGCCCATTGAACGATTC
TTACCCGCCTCTCTTTCGCAAGCTTCTTCACAGGAATCGTTCAAAGGTCA
CTCGAGAACACCTTCACTATCTCCAACTTCTAACCACTCCAATTCACCGA
CACCAGAAGAAAAACCCCACCTCAACCCCATCGGTAGTGAAAGAGGTCAC
AAGAAACCGACTGTAAACCAACAGGGCGGCTTGCAAGGTCTTACCTCGCT
ACTACAAGGATCCGACAGTGGGCAGAACTTGTGGCGTTTTGACTACAACA
TGAGGAAGTCACCTTCGTGGAAGCCAAACTCGTCTCCTGTCGGGTGGACT
GCACCCAACGAACAAGCGaaggaaatgaaaccactgctAGCGAATGGCGA
TATGGAACACCATCATCCTTCGGTTGATCACGTCATCGGGCCTGATGAAA
CACTGCAAAGTCTTCTCGAACGCCTCTCATTGTCCACTCATCTCAATCTT
TTTCAGAAAAACGAAATTGATTTGGATGCGTTGATGTTGATGTCGGAACA
AGACTATGCGGACATTGGTCTTCCGAAGGAACCACGTATCAAGTTGTTGA
ACAGCATGCGACAACTGCAAAACAGATCCACTGCTCACGTCCCTCAATCA
CCGCCCCAACAAATACCATTACTGAAGCACATCAATCCACAGCCGCTATG
GAATTCTGCAATGGATAATAACTTACATCACCCTGAAAGCCGGTTACCAC
CCGCACTTCGGAACAGTGTTCATTTTCCTGGAACACCACAGCTTGCTGCT
TCCTGGCAGACGTGGAGTAACACTATCGATCAATGAAACGGTATTCGTTG
GCAACGGAGTGTAATTGGAAATCAAGATTGTCCctttcattttcattgac
tGGAATTTTTCATT
Run BLAST on NCBI

transcript from alignment at sc0000007:208424..234422+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000952 ID=TCONS_00000952|Name=TCONS_00000952|organism=Clytia hemisphaerica|type=transcript|length=25999bp|location=Sequence derived from alignment at sc0000007:208424..234422+ (Clytia hemisphaerica)
gcgcgcgatcagtgaaagttatcgtgacatgttatgacaaaaagtatgat tgataaacttggtggagttatcaaaataaatttgttgtcaaagagNTGAC ATCAGTGATGAAGATGAAGACAGTATGTCGGTAAGCGTTCTTTCTCAGAA ATTGAGCAtttatgaaaaatctttgaGTTGACTTAAGGCCAACAGTTTTC AGAAGTCTGACACCACTTTTACATTGACCGcaatcaaaaaattaacaata gATTTGATTGTTGTGCCAGTTTTCCCAAACAATTTTGTCTGACAATgagt gataaaaaaaatcaatgtttaccgacaactgctctaacttgggactatct gacaaaacttggggcggcaattcggccaccatttcaccgaacctccaaag tcatttcaTGGCTCCGANcaatcgtcccaagttagagcagttgaagGTAC TGCCAAAACAACAGCAGCATAAATCTTTTTGCACAGTGCAGGGAATAAGC GAGTCTGTTCGTATCGTCTGTTAGTGTTACACAGGCttgttaaaaacata aatactTTTAATAAATTTGTTCTTAGTCACAATTAGAAAACATGAAAAGG AGTACTATGATTAGGCAGTGCAGCTGGAACTTTGAggatatatatatttt tatatatgtcagatagtcccaagttagagcagttgacagtaagTGTTTAT TTCCTGAAATATACAAAATAGTATATTTAATACTAAGCATGTTAAAATTT TAATCATGTGATAGCgtaaatttaaatatattatggctaaataaaaaaca aatgatggcagttctgttttttcctgaaacccccgggaaatttttttttg ccgacttagccaTTTTACAAGTCTCGGAAAAggactcccataggaattcc gatacataaccctattggttaattttggaacggcttcaagaaaggcATAA Tgacagataattttaaaagtttctggctaggaaatgtgtggaatttatca atgttgatggtttgttgattctttaataaagaaaatttggaaTGCAGAAA GACTCTAATTTATGTATCTAATTTACCTTTAAAGAAGTTTAAAGGTAAAA AGTTTGAGAGATTTGAGCAAGGCAAAAGTCGCTAAAAAGCTAGTAAAATT GTAATCCTGGAATATCAAAGGTCCAGCTACATTGACCTATTTTTGGATTC TCTCTCTAACAGTACTTTTCAACACCAGACAGTGTACATTGGATATCTCA AATCCCTGGTGCCTCTGGTGTGGAGGCAGCAGCCacaatcaaccaaccaa aatttgtcattttaNGTACATTGGATATCTCAAACCCTGGTGCCTCTGGT GTGGAGGCAGCAGCCacaatcaaccaaccaaaatttgtcattttaatTCT TGAGATAGCGCATCGATTCATTAGGCCTTGATTTTTTCATACTAAATCTG ATGATGGGAAGAATCTCCCTAATATATATAGGGAGTCTTCGACGGGTTAT Agttcgtcatttttcagaattttcaagatttcaactctctcaagattcac tcgttcgccagctcttgcggtgagcggtcacggTGNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAAGATGTTAGG TAAATTACCTCGAATCCAAATGTGAATGATAGTGATAAATTTAAACCTCT CTATGTTTTTAGCTGttgatattttgcttcattACTCTCTGTATTGATTT CAGCTCCAATGTCTAGACCATACCAATAACTTGACAACTCGACTTTTACT TGCTGGGGAAGATATAAATCATGATTTATCAAATCTCACTCTTGTTGGTC CAGAAACACAAGCAAGACTTGAAGCCTTGTTAGAGGCAGCTGGTAAGCTC TTTTAATTCCCACTTATACATACAAGGTCTAACAGATTAGGCAATCACAA AATTCATTTGACAAGTTTCCtttattgtattgtattgtttctttatttca aaaaattacaatGAAATAGCAAATGCTAATAAACACCAACCCCTAATAGT TTTTTAATCACAGCATAACCTGCAGTTGCATGGAATTTCTATTTATTTTG TGAAATTcttaagtaatttttcaaactcTTCAAGAGAGTCTGCTAATTTA ATATCATAATATCTCGATAAGTGACTCGGGGAGCCCTTATGCTCTCTCAT TTTATTATTAGCCTTAGAGCAAAACATCCAGATAAAGTCGCTAtagttaa attgtgaaaaaatataagctgatgcaaaataatttatcttctctgatttt tggtacaagGAGTCCAAAAAGCTGATTCCTAGAaccatagtttctagagg ggtcaagaccccccttaggtaagaggaccccccccttaagtgctaacccc ccttaggaaattcatttaaaatttcacaccccccccttagaaaatcagaa aattgaaatttcgcaTAATTCAAGGAATATCCCCCTtatctaagaagacc cccccttaactggcaaccccccccttaggaaagtcgtacttttaacaccc cccttgcttttggttcatcaaaacccaagacccTTCCTAAATGTAGGGGA AAAAAACCAAAGTCGGGTGAACTCGGTGTCTAAATGCCCCTGAAAATTTT AGTACACGGGTACTTAAATGCCACTATAATATGGGGTAGTAGTAtgcaaa aattttgcaaaatccCTTTTAGTattcatatatgtctgagattttagtac caacCTTCCCCTGATCTAACATGGTTTTATTTTCTATCACTTTAGatttt acttgaaataatttccTATTTGCTTTAAAGTCAAAGTAGGGTGTTTAAAA AGGGATAACCAGCTATTTTTCTTAGATAAGTTGCAAAATGACAGACTTTT CCCTAAATAAATTGGACACACACCACATTTTGTGTGTGTTAGGGATTTAT CAAGACATAATGATAGTATTCCTAATTTAAATTTCAGGTATGTACTTCAG TTCCAATATTGAATTGCAACGTGTTCTGAAAGTATAGTAGTATACATGCA TGTCTCTTACAGCAGCAAATAATCTTTTCATTAAGAACATACCAATCTTC GCACTTATAAAACAAGTTCAGATGTATGCTTGCGCACATGCTCACGATTC CTAGGTCTTTCCAGGCAAAGACTGATAATTTAAGAAGATTTAAGATTCAA GTTTAGATATCTAATTTTGTATTTCAAAAGAACTTTCGGATATTTAGTTT TACCTTTAAAAGCCTACCAAATGCTACAAATCAATCAGAGtttccaattt tcaattttgaatgtgGCAACCAAAATAAGTTGTAGAACCGTGTTGAAAAA GGACAACAGAATCAGTAATACTTTTGATTAGATGCTTATGCTCTTTATAT CATCAACTTTCAACTCAGGTGTTGCAGCAGATGGAAAAGCTTTCACTGAT CCTGAAGTTCTGCGTCGACTAACTTCTTCAGTTAGCAGTGCACTAGATGA AGCAGCTGCAGCACTGACAAGAATGAGATCACAAACAGGGAAACCAAATG CAACAACTTCGCAATCTGAGCAAGGTAAAAGCTACAAGCTCTCCTTTAta aaagcattttctttttgaattcagACATTTCTTAAAATCTAAGTCTACAA TCAGACATTCTGTATCCAGATTAACCAGAGCTAGTTGCATCATTGTATGT CACTTAGGAAACCTCCAGCAGAATAAACAAAATTTCTCCCAATATTTTCT ATTGTATTAAACTAGCCTTGAACTAAATTCGCTTTGATCGCTGTTATTTT GAGTAATTAAATGTAAAGAaacgaacaaaaatattttcctttttaatgcT ACCCTTCACGCCGTAAAGAaacgaacaaaaatattttcttttttaatgct ACCCttccaaaaattgtaaaaaataatggtgaaattttaaagcctttttt atgaaaaaataggagaaaaagtgccctttttgaccCCTAGCGGACGCTGC TCtgcatttttaaaatttggccTGTGAATGGAACattaattaattaaaat aatttcctgtatttcccaaggaaaataatgcagggttcgaattatagctc CGCACTTTGCAAAATGTGAAGTAAATTTTAGATTTAGCGACCCAAAAAGA TTTCCCAACTTCGTAACTTTCTTAACTCGTTTATTtgttgctttatcaac tcgctacctTGCAActttattcattcatttatctattgctttcTATCAAC TCTATACTTTGCTTCATCTACAATCTCTTACTTCACATTTCTAGAGAAAT GTATTGAAGATACTTTtgcattttcttccaaacaacatcgcaaaatacta aaaatgcttcgcaaacattgaaaaaatgcGACGTTCCGTTTTTTACCTTG CTTCGCTCGGAAGAATAGTGAAGCTCTTTAaatctataattcgaaccctg tgTTCCAAGGAAAATAATGTAGAGAAAATTTCTTACATATTTGAgggaaa ttaaataaaaacaaatttgttgtattttcataggaaaattaCCTGAAACA ATTTCTTGTATTTGTAATTGACAAGGACCTAAAGCCTAAAGCAAATTATT GtactttccaaggaaaatcaacCAATAcagtttcttgtattttccaagaa aattacATTAGACAATTTTTATATATTCTATGAAAATTaactaaagtaat ttttttgctactttcaccaagctgatttttcaaaaaaaatcgctCTCTGt cttaaaaaaagataaagaataGTTATTTTGAAAGcttcaatcaaatcaaa actgccATTTTTAATCTATTTGCAAGGAAAGAAGAtctatataatataaa ataaaatctaccATAATCAAGAGTGTCGTGTAAAACTATTCTCATGCTTG GAGTACATTAGCCATCGGGCATAGACATTTGAGGGTGACTTCGAAAGACT TTGAatagctttgaaaatttgaaattaagatatttcaaaatgaaaaggaa ACAGAAAACGAGTGCTTAATTTCGAAACGCTTTTAgaaatgttcaaaaaa gaagattagaaaaaaaagaaaaattatagttTCAGGGCTTTCATTTTAAG GCTAGAAATTGACCAATTGAAAGATCAATACAGAAAAGGCACAAAAAACA ACTGCCGAATGCTTAAAAATTGCTAGCAAAAATGcttcatgcgagaatgg gagagttcaGATTTCAGCGTATTATGATATAGAAGCTTAACAACCATCCT TCATGTAATAAGGTTTCTTGACAAGAAGGCTCTGCTATTTTGGTTGATAG ATTATCcagcttttttataaaattctttttcagGCACCCGTAGCCTTGTG GAGGCTTGCATTGAAGGAGATATAGCTGCAGTTCGTAAACTTTTAGATGA AGGAAGAAGTGTACATGAACCAACTGATGAAGGAGAAAGTTTGTTGTCAT TGGCTTGNTTACCTTTAAAAGCCTACCAAATGCTACAAATCAATCAGAGt ttccaattttcaattttgaatgtgGCAACCAAAATAAGTTGTAGAACCGT GTTGAAAAAGGACAACAGAATCAGTAATACTTTTGATTAGATGCTTATGC TCTTTATATCATCAACTTTCAACTCAGGTGTTGCAGCAGATGGAAAAGCT TTCACTGATCCTGAAGTTCTGCGTCGACTAACTTCTTCAGTTAGCAGTGC ACTAGATGAAGCAGCTGCAGCACTGACAAGAATGAGATCACAAACAGGGA AACCAAATGCAACAACTTCGCAATCTGAGCAAGGTAAAAGCTACAAGCTC TCCTTTAtaaaagcattttctttttgaattcagACATTTCTTAAAATCTA AGTCTACAATCAGACATTCTGTATCCAGATTAACCAGAGCTAGTTGCATC ATTGTATGTCACTTAGGAAACCTCCAGCAGAATAAACAAAATTTCTCCCA ATATTTTCTATTGTATTAAACTAGCCTTGAACTAAATTCGCTTTGATCGC TGTTATTTTGAGTAATTAAATGTAAAGAaacgaacaaaaatattttcctt tttaatgcTACCCTTCACGCCGTAAAGAaacgaacaaaaatattttcttt tttaatgctACCCttccaaaaattgtaaaaaataatggtgaaattttaaa gccttttttatgaaaaaataggagaaaaagtgccctttttgaccCCTAGC GGACGCTGCTCtgcatttttaaaatttggccTGTGAATGGAACattaatt aattaaaataatttcctgtatttcccaaggaaaataatgcagggttcgaa ttatagctcCGCACTTTGCAAAATGTGAAGTAAATTTTAGATTTAGCGAC CCAAAAAGATTTCCCAACTTCGTAACTTTCTTAACTCGTTTATTtgttgc tttatcaactcgctacctTGCAActttattcattcatttatctattgctt tcTATCAACTCTATACTTTGCTTCATCTACAATCTCTTACTTCACATTTC TAGAGAAATGTATTGAAGATACTTTtgcattttcttccaaacaacatcgc aaaatactaaaaatgcttcgcaaacattgaaaaaatgcGACGTTCCGTTT TTTACCTTGCTTCGCTCGGAAGAATAGTGAAGCTCTTTAaatctataatt cgaaccctgtgTTCCAAGGAAAATAATGTAGAGAAAATTTCTTACATATT TGAgggaaattaaataaaaacaaatttgttgtattttcataggaaaatta CCTGAAACAATTTCTTGTATTTGTAATTGACAAGGACCTAAAGCCTAAAG CAAATTATTGtactttccaaggaaaatcaacCAATAcagtttcttgtatt ttccaaggaaaattacaTTAGACAATTTTTATATATTCTATGAAAATTaa ctaaagtaatttttttgctactttcaccaagctgatttttcaaaaaaatc gcTCTCTGtcttaaaaaaagataaagaataGTTATTTTGAAAGcttcaat caaatcaaaactgccATTTTTAATCTATTTGCAAGGAAAGAAGAtctata taatataaaataaaatctaccATAATCAAGAGTGTCGTGTAAAACTATTC TCATGCTTGGAGTACATTAGCCATCGGGCATAGACATTTGAGGGTGACTT CGAAAGACTTTGAatagctttgaaaatttgaaattaagatatttcaaaat gaaaaggaaACAGAAAACGAGTGCTTAATTTCGAAACGCTTTTAgaaatg ttcaaaaaagaagattagaaaaaaaagaaaaattatagttTCAGGGCTTT CATTTTAAGGCTAGAAATTGACCAATTGAAAGATCAATACAGAAAAGGCA CAAAAAACAACTGCCGAATGCTTAAAAATTGCTAGCAAAAATGCTTCATt cgagaatgggagagttcagatttaagcgtattataatatagaaaGCTTAA CAACCATCCTTCATGTAATAAGGTTTCTTGACAAGAAGGCTCTGCTATTT TGGTTGATAGATTATCcagcttttttataaaattctttTCCAGGCACCCG TAGCCTTGTGGAGGCTTGCATTGAAGGAGATATAGCTGCAGTTCGTAAAC TTTTAGATGAAGGAAGAAGTGTACATGAACCAACTGATGAAGGAGAAAGT TTGTTGTCATTGGCTTGTTCTGCTGGtaagtgttttttctttataatatt gAAATGCTCACATGTTCAAtctctcttttattttgattcttttgttGCTG GTACTTTGAATCTGTTAtacaatatataaaaaatacattaaacacaattt ttgtttctttctgtAACGGCTTGTTCAATTGTATTTGAATTCTTGAAAAG GTTGCACCTGAtgaaaactattttttatttaattgcaagGTTACTACGAA CTTGTACAAGTGTTACTTGCAATGAACGCCAATGTTGAAGATAGAGGTAG TAAAGGTGATTGTACTCCTCTCATTGAGGCTGCCAGCAATGGTTTTGTTG ACATTGTAAAACTTCTTCTTCAACATGGAGCCAATGTCAATGCACAATCA TCTGCTGGAAACACTTCACTTCATAAAGCTTGTGGTAGTGGATATGATGA TGTCGTTGAACTTCTTATACAACACAATGCAGATCTTGAACATCAAAATG AAAACGGACATACTCCTCTGATGGACGCAGCTAGCAATGGTCATGTCAAA GTAGCCAAACTTTTGCTTGATGCAGGTGCTGGAATTAATACACACTCAAG TGAATTCAAAGAAAGTGCTTTAACTTTGGCCTGCTACAAAGGTATGTTTT ATTTAGTTACTTGCATTTTCTTGCNAGAatggaaaatatataaaaaatgc TGCTGTATTTACAAATTCGAGGTCGACATGACGCGCCTTAATAATAATTG CATTTTTGAAAGACAATAAGATTTCTTGTTTTAAAACTGCACGAAATCCC TCTTTCATACTCGAATCAACCcctggcaaaatttgagaaatttttcataN AAGCAATGGTCATGTCAAAGTAGCCAAACTTTTGCTTGATGCAGGTGCTG GAATTAATACACACTCAAGTGAATTCAAAGAAAGTGCTTTAACTTTGGCC TGCTACAAAGGTATGTTTTATTTAGTTACTTGCATTTTCTTGCTTAGTCT CTTAGTNtaagctgaacgcatcataagccctttggataGTAAAGGGGAAA CTATCCCAAAGAACATTATAAACataaatgaattttattcttcAGGGCAT GTTGATATGGTTTTCTTTTTATTGGAGAGAGGTGCTGACCAAGAACATAA GACAGATGAAATGCACACAGCTTTGATGGAAGCATCAATGGTATCTACTT ATCTTTCATCTTGTTATctataaaaagtttttctgttCTCAACTtaagtt gagctagaatctgtctgtctgtctgtctgtctgtctgtctgtctgtctgt ctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtct gtctgtctgtTTGTCTGTCACAAAGattttagggcagcctggagacttca aaaatgattgaatttggctgaaattttgcacacttgttccttgggtgaat atttgtggattctttttttcatttttcaaaaatttttatttgttggGTCT GGGTActaatcttttgttttttttgctacaATCGGGCCGGGGGCCTATGG ATAATTTGAAGTATCTGAAGTTAAATTTTCATCGGCCACTAATTAGATAG GCTCCTGTTTTGTTTTACAAATCTCCATTGTATATTAATTACATTGAAAG TACTCAATGTTTTTCAAtgtttctttttggacctaccccggtggaggtcc tataaattaacctttgtccgtccgttcgttagttaccagcttttctcgag attgactcattagttttttctgattttttgcacaaagatgtgtaactata aaccctcgaatgtgacggagcccgattttcgaaaaaatttttgggcaaat ttgggccaaaaaacggctaaaaaacggtttttttggacttcgtgaaaaat tggtttattaattttttctgattttttgcatgaaagtagggtactatcat aggtaaaagatggctcgagcagatttttgcaaaaaaaatttgttggctca aaaaacgcatgtttatctataagaatcactattagtCATGTCATACATCA ATTAGTCAagttactgaatttttttttgtgtggtagatatttttttgctc acgagggcttacttttaaagaataatgtgtgtttagacatgaaattttgg ttgcttggtgtgtttttatagaaaaaatggccaaattcgatattttttta taagcacattatcaattacttaggtattagcttttctcgagattggctct ttcattctttatgatttttcgcacaaagatgcataactataaaccctcga aggtgacggagcctgattttcgaaaaaaatgtttttgggcaaatttgggc caaaaaatggctaaaaaacgagttttttggactttgtgaaatattggatc attgttttttatcagatttttttgcatgaaagtaggtatagaaagaattt ttctgctcaaaaaaacgcatctttatctataagaattactattaataagc atacatcaatgttcttagccaaattactaaatttttttatgagatagatg tttttttgctctcgaagtcttgaatatgaaagaatatttcaagagcatga cattttggtttctaaacgtttttttataagaaacaaacgactaattttaa tagatcgtcactatttgtgttctgaataattgtttaacggtcatgcccac gtagatatcaattatatatgtgttaaatgcataacctggtaggtccataa aagtatcacttgtatTTTTCTAGGATGGACATGTGGAAGTTGCAAGACTA CTCTTGGACCATGGAGCTCAGGTATGATTTCTCAATCATAAAATAGGAAc gaccaggggggggggggcaagcagttaATACACAacttagtaccgtggtg ggtccttttctgaaatttgcaaATTGCAGTTAATACACCAGTGTATTAAC TGTCAAAAGGGGTGGTGTTAAGACAATTTTAGAACTCAAAAAATGTATTA ACTGCCTACCAGACCATAGTTTGGCACTTCCTATAAATTTAAAACTAAGC AACCATGCAACTGGAAAAcctcaaaatctttttctgcttactcaaaatct aaaaattttaactgTTGCATTGCTTAGGTAACTGTCTGACAAGGGATTTG CACCCCGACTTACAAAAACTTTCTAATGACATAAATATGTGGCATAAGTA GTCTCAAAACAGTTAAAACCCCTTGTATTGTATCAAATTAACAGGAAAAT ACACGGTGGACCTGCATGGGACGGTTTGTCGGCCGCTGCAAACTCACTTT GGGGGTGGTGTATACATTTAATGGGTCAAAAACAGTTAATACACAGTGTA CTAAGTGTCAAGGAATGGTGgtccttttgaaaaattccaaaaagcaTTTA ATACACAAAGTGTTGTGTATTAACTGCTTGTCCCTCCCCTGGAACGACAT TTTGTAAGTTTACATTGATAAATTCATCATCTTGCAAATTTGAATATTTc gcttcctttttctttctataGGTGAACATGCCGGCTGATAGTTTTGAATC CCCATTAACGCTTGCAGCATGTGGAAGTCATGTTNTCCTTTTTCTTTGTA TAGGTGAACATGCCGGCTGATAGTTTTGAATCCCCATTAACGCTTGCAGC ATGTGGAAGTCATGTTGAATTAGCTGAGTTGTTGATTGAGCATGGTGCAA ACCTTGAAGAAGTCAACGATGAAGGGTAAGCTTGTCTCTTTGTTTTCGTT AAATTAACTTTGATAGTATATATAAGAATCTTCAAACtcggatttaaaaa aaactaatgatgctttttatgttttgtagccttttctttcttattatgTT AAACTATTGTGCTAGTAATGTACCTTATTATCTATTTCTTAAGGTTCACT CCACTAATGGAAGCAGCTAGGGAAGGATACTTACCAATGGTGGCTTTGCT TTTAGCACATGGTAAGATAATATTCCAAATATCCGGCATGACTCAGAGAA ATTACTTTTGACAATAGTAAGGTAAACTTTTTGCAAGTAGTAAATTTAGC TATGGACCGAAAGTTATAATAATTAAGTTCCAAGTTTGCTTGAACTTTCT GTtaccaacttattactaaaccatgaatttcattttttctatttgcAGGA GCCAACTTGTATGCTCAGACAGAAGAGACACAAGAAACAGCATTGACACT TGCGTGTTGTGGTGGGTTTCTGGAGGTGGTGGCTTACCTTTTGGATTGTG GTGCCGATATCGAACTTGGTGCATCTACTCCTCTCATGGAAGCAGCTACT GAAGGTCATGTTGAACTTGTCAAATTTCTTATTGAGAAAGGTAACCTTCA ATTTAATTGTATCTTCTACTTCTTACTTTTTTCCTATCTTTTCTACGTTT CGCCAAATCTAACGGTGTTAACCCATcctgaaaacatgaaaaaatcaaat cttaTATTCCcgttggaggtcctataaattaacctttgtctgttcgtccg ttcgtctgtctgttattagcttttcttgagattggctcattagttttttt cagatttttggcacaacgatgcaaaatggcaattcCCGAAATGTgccgga gcccaattttcgaaaaaaaattttccagccgAAAAAAACTGGAAGTATGC CTTCATTATATTCTTTTGTTcaaggtaggtccaatcagTATCCACTTGTT ATCAAGATAGATCTATTCTAACACGATTTTGACTTATTTCTAGGTGCAAA CGTGAATGCCATCACAGCTACAGGTGATGCAGCATTGACATACGCTGCAG AAAACGGTCATACAGACGTAGTAGAAGTATTGATTGAACAAGGTGCCAAC ATTGAACATGAATCTGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTCG TGCGGGACACCTTTGCACAGTGGAATATCTCCTCAGTCAAGGTACCAAAA TGTTTCATCATAAATCATGAATCGTTATCCATCTTTCAATTATCAACGTA AACTTAAAATCATTCTTGCCATGCTGATATAGATGATTATAAATATTTGC TATTTTAGGGGCCGACGTGAATAGAAAAACCAGCGGTGGAGAGCATTCTG TTTTATCATTAGCATGTGCTGGAGGCCATACCGCTGTTGTCGAGCTCCTT CTTGGTAGAGGTGGTAATCCTACTATGAAATTAAAGGTAAGCTTAATTGT GCCACTCTCCTAACTtcttgaaatgaattttttcaagAGTTGTTAAGTTT ATGAATCTGAAATTGTAAATATGTTCTTTTTTAGGTAAAAAGTCTTTTAA AATGAATCAAAAGAGGTagtaaagtctaattttctcaacTCAATTTTTAT TCGGCTTCTTTTATTTCCAGGACAATTCAAGTATGTTGATAGAAGCGGCC AAAGGTGGTCATGCTAACGTAGCCCACCTGCTCATGAACACTCAAATACA TCAACAAACCTTCACTCAAACCGATACTTTACATTCTGAATATCCAATAC ATTCAAGCGCTTTACCAACGGACAGCGCTTTCCCTATCTGTCCACACGTT CAACACGAGCAAGATCACATCGCGCATCAACCAGATTGCCATTTTCATAA TACGCCTGAAAATCAACATTTTGCTCATGACTTTTCACAACAAATCATTC AACCGTCTCCGCCTTCCGATCACTTTCAACAACAACATCCGAACGATGAG TTGGACGACGAGAATTACAACAACAATATCGATGTCAACACTTCACCAAC TGATCTTTATCTTCCCAACATACCTGTCTCCCTCGCTTCTTCTCTCTCAC TCGCCAACCTTACAACTGCCGATCTGCAACATTTAGCTCAGGTTTTACAA TACTCTTCGAATCAAAATCAAACGCTTGAAGACGTAGTAGCGGCTGGTCA AAATGCTGAACAGATTGGTTTACAAACGATTACTTTCCCTGCAATCGACC CTCAAGTGGAGAGTTTCACCACACAATCAGAAGTGTGTACACCATCACCC TCAAACACGGCAACTGCTCTCGTTACAAGTGCAGGACGAACCATCACTTC AACTGGCGTGCAAACTGAAGATGCAATTTCCATGATTCAAAAACTTACCA ACAGTGTCCATCAGCTGAACGCTCTACAGACATTCGCAGCATCCCACAAT TTGGAACTAGTGAACCTGGGTGAGATTACACTACCTCCAGCGCCTTTCCA ACTTGAAACAGAAGCGGAAGAAGGGATCATGGTAGCTGATTCTGCACGCA CTCTACAAAACTCCATCAACGGCATGGTTCGCGAAGGTATCACTAATTAG AAatctatttatttttgttatatcCAGTTTATGTCGTGGTAATATTCGCA GCATACtgtaatattcaaaattttgcgCGTGTGTCTTGGACCAAAATTTA AATAGAGTTGTAAGACTTTTCAATACtacaatttaaaaatttatattttc agatCCGATCGGTGAATGCAGCTCTTTACCGATCGGTGAATGCAGCTCTT TACCATCCATCGAAACGACACTTCCAGTACCGGCACAATCTCCCGTCACA CCTCCCCTCTCACCAGCCATCGATATCGACCAAAGTACGGACAGTAATCA CGATACGGCGCTCACTATCGCCTGTGCTGGTGGACACGATGAACTTGTAC AACTTCTGCTGGCCAGAGGTTCCAACATTGAACACCGCGACAAAAAGGGT GAGAATCTTCTATTTACAATTACAGATTGAATTGAATCTTTAAATTTTGC TAAAGAATTATGGCTTATTACTATTTCTTATTTCCACAGGCTGCACGCCA TTAATCCTAGCGGCAACAGCAGGTCACACTGCCACATGTCACATTCTTCT CGAACATGGAGCAGACATCGAAGCACAATCAGATCGAACCAAAGACACTG CACTTTCCTTAGCATGTTCCAGTGGTCGCCAAGAAGTTGTCGAATTACTC CTCATGTCCAATGCTAACTTTGAACACCGAAACGTCTCTGATTACACGCC TCTCAGTTTAGCAGCTTCGGGAGGGTACGTTGGTATCATCAAAGTTCTGT TGAACCATGGTGCAGAGATCAATTCACGCACAGGAAGCAAGCTGGGCATC TCTCCCCTCATGTTAGCGGCAATGAACGGTCATGTTGCGGCTGTCAAACT CCTCTTGGATCGTGGCAGTGACGTCAATGCTCAAATCGAAACCAATAGAA ATACAGCTTTAAcgttagcatgttttcaaggGCGAACGGAAGTTGTTGGT CTGCTTTTAGACCGACATGCAAATGTGGAACACAGGGCCAAGGTAagatt caaaaagtcaaagtcaAGTTTTCCTTTTGATACATTATGAAATATATCCA CTTGCCTTACTGCTTTTTTCCTAAAGATAAATTCCGAAGNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttttttcagatttttggcac aacgatgcaaaatggcaattcCCGAAATGTgccggagcccaattttcgaa aaaaaattttccagccgAAAAAAACTGGAAGTATGCCTTCATTATATTCT TTTGTTcaaggtaggtccaatcagTATCCACTTGTTATCAAGATAGATCT ATTCTAACACGATTTTGACTTATTTCTAGGTGCAAACGTGAATGCCATCA CAGCTACAGGTGATGCAGCATTGACATACGCTGCAGAAAACGGTCATACA GACGTAGTAGAAGTATTGATTGAACAAGGTGCCAACATTGAACATGAATC TGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTCGTGCGGGACACCTTT GCACAGTGGAATATCTCCTCAGTCAAGGTACCAAAATGTTTCATCATAAA TCATGAATCGTTATCCATCTTTCAATTATCAATGTAAACTTAAAATCATT CTTGCCATGCTAATATAGATGATTATAAATATTTGCTATTTTAGGGGCCG ACGTGAATAGAAAAACCAGCGGTGGAGAGCATTCTGTTTTATCATTAGCA TGTGCTGGAGGCCATACCGCTGTTGTCGAGCTCCTTCTTGGTAGAGGTGG TAATCCTACTATGAAATTAAAGGTAAGCTTAATTGTGCCACTCTCCTAAC TtcttgaaatgaattttttcaagAGTTGTTAAGTTTATGAATCTGAAATT GTAAATATGTTCTTTTTTAGGTAAAAAGTCTTTTAAAATGAATCAAAAGA GGTagtaaagtctaattttctcaacTCAATTTTTATTCGGCTTCTTTTAT TTCCAGGACAATTCAAGTATGTNAATCAAATCTTATATTCCcgttggagg tcctataaattaacctttgtctgttcgtccgttcgtctgtctgttattag cttttcttgagattggctcattagtttttttcagatttttggcacaacga tgcaaaatggcaattcCCGAAATGTgccggagcccaattttcgaaaaaaa attttccagccgAAAAAAACTGGAAGTATGCCTTCATTATATTCTTTTGT TcaaggtaggtccaatcagTATCCACTTGTTATCAAGATAGATCTATTCT AACACGATTTTGACTTATTTCTAGGTGCAAACGTGAATGCCATCACAGCT ACAGGTGATGCAGCATTGACATACGCTGCAGAAAACGGTCATACAGACGT AGTAGAAGTATTGATTGAACAAGGTGCCAACATTGAACATGAATCTGAGG GTGGTCGCACTCCTTTGATGAAAGCTGCTCGTGCGGGACACCTTTGCACA GTGGAATATCTCCTCAGTCAAGGTACCAAAATGTTTCATCATAAATCATG AATCGTTATCCATCTTTCAATTATCAACGTAAACTTAAAATCATTCTTGC CATGCTGATATAGATGATTATAAATATTTGCTATTTTAGGGGCCGACGTG AATAGAAAAACCAGCGGTGGAGAGCATTCTGTTTTATCATTAGCATGTGC TGGAGGCCATACCGCTGTTGTCGAGCTCCTTCTTGGTAGAGGTGGTAATC CTACTATGAAATTAAAGGTAAGCTTAATTGTGCCACTCTCCTAACTtctt gaaatgaattttttcaagAGTTGTTAAGTTTATGAATCTGAAATTGTAAA TATGTTCTTTTTTAGGTAAAAAGTCTTTTAAAATGAATCAAAAGAGGTag taaagtctaattttctcaacTCAATTTTTATTCGGCTTCATTTCCAGGAC AATTCAAGTATGTTGATAGAAGCGGCCAAAGGTGGTCATGCTAACGTAGC CCACCTGCTCATGAACACTCAAATACATCAACAAACCTTCACTCAAACCG ATACTTTACATTCTGAATATCCAATACATTCAAGCGCTTTACCAACGGAC AGCGCTTTCCCTATCTGTCCACACGTTCAACACGAGCAAGATCACATCGC GCATCAACCAGATTGCCATTTTCATAATACGCCTGAAAATCAACATTTTG CTCATGACTTTTCACAACAAATCATTCAACCGTCTCCGCCTTCCGATCAC TTTCAACAACAACATCCGAACGATGAGTTGGACGACGAGAATTACAACAA CAATATCGATGTCAACACTTCACCAACTGATCTTTATCTTCCCAACATAC CTGTCTCCCTCGCTTCTTCTCTCTCACTCGCCAACCTTACAACTGCCGAT CTGCAACATTTAGCTCAGGTTTTACAATACTCTTCGAATCAAAATCAAAC GCTTGAAGACGTAGTAGCGGCTGGTCAAAATGCTGAACAGATTGGTTTAC AAACGATTACTTTCCCTGCAATCGACCCTCAAGTGGAGAGTTTCACCACA CAATCAGAAGTGTGTACACCATCACCCTCAAACACGGCAACTGCTCTCGT TACAAGTGCAGGACGAACCATCACTTCAACTGGCGTGCAAACTGAAGATG CAATTTCCATGATTCAAAAACTTACCAACAGTGTCCATCAGCTGAACGCT CTACAGACATTCGCAGCATCCCACAATTTGGAACTAGTGAACCTGGGTGA GATTACACTACCTCCAGCGCCTTTCCAACTTGAAACAGAAGCGGAAGAAG GGATCATGGTAGCTGATTCTGCACGCACTCTACAAAACTCCATCAACGGC ATGGTTCGCGAAGGTATCACTAATTAGAAatctatttatttttgttatat cCAGTTTATGTCGTGGTAATATTCGCAGCATACtgtaatattcaaaattt tgcgCGTGTGTCTTGGACCAAAATTTAAATAGAGTTGTAAGACTTTTCAA TACtacaatttaaaaatttatattttcagatCCGATCGGTGAATGCAGCT CTTTACCGATCGGTGAATGCAGCTCTTTACCATCCATCGAAACGACACTT CCAGTACCGGCACAATCTCCCGTCACACCTCCCCTCTCACCAGCCATCGA TATCGACCAAAGTACGGACAGTAATCACGATACGGCGCTCACTATCGCCT GTGCTGGTGGACACGATGAACTTGTACAACTTCTGCTGGCCAGAGGTTCC AACATTGAACACCGCGACAAAAAGGGTGAGAATCTTCTATTTACAATTAC AGATTGAATTGAATCTTTAAATTTTGCTAAAGAATTATGGCTTATTACTA TTTCTTATTTCCACAGGCTGCACGCCATTAATCCTAGCGGCAACAGCAGG TCACACTGCCACATGTCACATTCTTCTCGAACATGGAGCAGACATCGAAG CACAATCAGATCGAACCAAAGACACTGCACTTTCCTTAGCATGTTCCAGT GGTCGCCAAGAAGTTGTCGAATTACTCCTCATGTCCAATGCTAACTTTGA ACACCGAAACGTCTCTGATTACACGCCTCTCAGTTTAGCAGCTTCGGGAG GGTACGTTGGTATCATCAAAGTTCTGTTGAACCATGGTGCAGAGATCAAT TCACGCACAGGAAGCAAGCTGGGCATCTCTCCCCTCATGTTAGCGGCAAT GAACGGTCATGTTGCGGCTGTCAAACTCCTCTTGGATCGTGGCAGTGACG TCAATGCTCAAATCGAAACCAATAGAAATACAGCTTTAAcgttagcatgt tttcaaggGCGAACGGAAGTTGTTGGTCTGCTTTTAGACCGACATGCAAA TGTGGAACACAGGGCCAAGGTAagattcaaaaagtcaaagtcaAGTTTTC CTTTTGATACATTATGAAATATATCCACTTGCCTTACTGCTTTTTTCCTA AAGATAAATTCCGAAGGTAGGGACCTCAAGTTCATTGGAAAGATTTCATT CTTTTCACTCAAACACAAATCTTCTTCGACCATCTCTCATAGACCGGATT AACTCCATTAATGGAAGCAGCATCAGGTGGTTACGTCGATGTGGGTCGTG TTCTGATCGATCGCGGTGCAGATGTGAACGCCATCCCAGTCCCTTCGTCA CGTGACACTGCACTCACAATCGCTGCCGATAAAGGACACTACAAATTCGC CGAGTTATTAGTGGTTCGTGGTGCCGTTGTTGACGTGCGTAATAAGAAAG GATGTACACCTCTATGGCTCTCCGCACACGGTAAGATACTTACGAACTCG AGTAAAACTTTGACTCGGCTGGTAAGAACTTTAACTAGCGCCGACTAGTA ATAAAGAATGGTCGAATTATAATTTGTGCATTTTTTCTTTACAGGTGGGC ATCTGGATGTTTGTCAGTTGTTAGCGCGTGAAGGAGCTGATGTGAACGCC ATGGACAATCGAGCAGTCTCTGTTCTCGTAGCCGCGTTCAGAAAAGGAAA CATCAAAGTGGTCAAGTGGCTGGTCAAACATGTATCACAGTTCCCACCTG ATTCTGACTGCAAACGTTTCATTCAAACCATCTCTGATAAGGTTTGTGAA GATGTTTGGTACCAAAAGTAGATCTTTTAGATAAAGAAATTTGTTGAGTG GGTCCCTTTATGAGTTTGACTTTGGATTaatgatttgaaatttcttcttt ctcaaTAGGACTTACTAAAGAAATTAGACGAATGTATGCAAATCATCAAC GCGGCAAAGAAAAGACAAGAAGCAGAGGCGAACAAGAACGCGTCCATTCT GTTGGAAGAGTTGGATCATGAGAAAAAGAAGGAGGAGAGGCGGAAAGCGC AAGCTCAAAAGAAACGTGATAAGAAGAagcagaagaaaaagaaaaagagt acGGAGAAGCAGTCTGTGGATACTGAAGAAGATGGCGAGAAAGAAGACGA GGAAGAGTTCGAACATGCAACGAGTGGATTCCCTTTCATCAATGCTGATC AACGAACGCCCTTGATGATCAATGGTACTTTTCTTTATTGTCAGAAATGT CTTTTTGATATCAACTTTATGGACTGGTGGAAACTTTTTAGGAACCAGTA TAGTATAGTTCGTAAGAGGGACCCGAACCTCccttattttgaaatctttt aaagTCTACACTTTTTGCAGGGTTAAATCTTTGAGATCTAATATCAATCG CCTATTTCATCCAGGAAGACTTCCATCTGCACACTAAAAAGGTACCTGAT AAATAGATATGAATATTTCTTAtatatttctaatatttttcaCTGGCATT GTTTTAGACGAACGACCCGATCTTTCGACTGCTGAATTGAAACTGAAATC TCAAGTTCAACTGAAGAGCAAGAAGAAGAGCCGTCTAAAGAGTCGCAACT CCTCTCTCAGCAAAAGTACGGATGAAGAGAAGGAGATGGCGGACAAAGAT GTGGAAGATATCATAGATCCCGTATCCACCGCCATCGATGCTCTGACCAA CATCGTTATCACTACTGCTGCTCAATTTGTATCCTCTATCAAGTAAGAAT TGTGGTACAGTGTTGTAACTTTTCCGTctgtagacgaaaatccgtccaGT TAAGATAAAAACACACAATTTCCGTCTTGCTAGCAAGAGGCAAATGATGA CCCACAAAACCAAAGATTGATTTTGTttatattcaaaaaagtttttcaac atTGATACACTATTCCACTATTTCCATTGAAAATAACGAGTAAGAACTTC AATCGGGTTATCTCACAATTtcatttatattattttttacagACCAACAG ACACAGTGAGTGCGGCAACAGTAGCTGAAATCACCAAAGCTCTTGCAGCT TCCATCATCACTAACGCTAAAGACAATACTAAGACCTCTATCCCAGATGA GGTTGCTGTTACTATGGCAACGGCTGCTGCTCAACGTGTGGCGGTCAGCA TTTCTTCACCTTCGCTACTAAGCAACAATAATAACAATGGATTTGCGCTT AACACGAGTCAGAAGAAAGCAAAACGAGTTGACGACGAATGGAAAGAGGT CACTCGAAGGTtggtatttttttaataattgtgATACAATTGGGAGGGGT AGGTACTGGTTTCTCAGACATATAAGAGTACTAGAAGGTTTTTGGGAAAC TTTGCATACAACCAAACTTATTCAGAGAAGTGGTATTTAGGTTTTAGTAC AGATTTTCCTAGACACCACCCTATTTTGATCTTCTCGGGACAGATTTGGc tgaattcaaaataattggGACTTTTTAAAAAGGAGgcgaaaaatgttcaa aaaatgataaaaacactAGTACTTATACAGggtgttcttgtaaaaaagta CCGTAAGTAGAAATACATTACTTTTGTGTATATGACAAAGATTTTCTGTA TGCCACCAATCATCGCCAATCACCAATCATAATCATATGATATTCACTTC ACCACTTTCTTCATTTCAGCATTCCGCATACGAAGTCAAGGAAGATCTTG ATACCAGCCGCCTTGATCAGTCGCGTTATCGGTCGTGGTGGGTGCAACGT CAACGCAATACGTGAACACACGGGAGCACATATCGACATCGATACAAATC GAAAGAAAGCCAACGGTGATTGTATGGTCACCATCAAGTAAGGAACTTTT GAACATTTCATTCATACAATGTCCTTGACGTTTACAACTTGTCTCGTGAA ATGAATTTGCTGTCTTTTTAAGATCCGATCAAATTGGAATCTAACAAATA ATTTTGACTTCTGGATTTCATATTTGAACACAAGAAAATGATTAGGTCTG GATGAAGCCATCTTCACTACAGCAATTATTACACACTCTATAAAGGTGga gaataagaaaaaaatacttaGCTATCCTCTGAAACAAttattttctctca aaattcaGGGNCAGGTGgagaataagaaaaaaatacttaGCTATCCTCTG AAACAAttattttctctcaaaattcaGGGGTTCGCAACAAGCTACGAAAC AAGCAGGGAACTTGATCCAATCTTTGATCGACGATCCCGATAGCAACGTT GCGGAAATTCTCCCTACACTTCCTACTATTGCGACGTCTCTGTCTACAAG CGTCTCATCTTCTTCTCTCATTCCTCTCATGAAAAACCTCACCAAACCCA CCACCATCGAATCGTCTCTCGACAttccaaaaacaattcaatcACTTTCA AAATCACTTAACACGCCCAAAACTAGCGACAAAATACCGACGCTTCGACA AATCTCGGCACCAGCAAATTTGGTGCCTCCTACATCGACACCTTCTTCTC AACCAGTACGAATGGTTCCTGTTGTCAACTCGAATTCCAAGAAACTCGAA GTCGCCAAGGAATCTTCGGCGCCGTCTAGAACGAAAGTGAAACCTCCTGC GCTCACTACAACCACACCAAATAGTGGATGGAAGTCCACTAATCAACAAG ACACCAACACCGTGCTAAAGCAGACGTCCTCAACGATGGCTGTCTCTACT CGCTCACAGGTGTCAGTGACACGGCAATTATCGAATGAAGGGAGCCAAGT GCACCAACAAATTATAACGACCATCAGTACAACAGTTTTCTCATCCTCTT CTCGTAATCTTCCCAAACCCATCGGTAGCAATCGACCCTTTCGACCAATC GCTTCTCCCACTAATGCTCTCTCGTCAACAGCTGTGTCGAATTCAGTGGC AGCCACTCTTCATTCGACATTAAACAGTCTACTTTCGCAGGTGGCGACAC AACGCAGTCCCATGATATGGAACGATCATCCAGGTTCGAAGGAGCACCAT GGTAGCAGTGGTGATCTGGTGGTGACGACAGTAGCCACCTCACCCAACAA TACGCTAAACGGAACGCCCATTGAACGATTCTTACCCGCCTCTCTTTCGC AAGCTTCTTCACAGGAATCGTTCAAAGGTCACTCGAGAACACCTTCACTA TCTCCAACTTCTAACCACTCCAATTCACCGACACCAGAAGAAAAACCCCA CCTCAACCCCATCGGTAGTGAAAGAGGTCACAAGAAACCGACTGTAAACC AACAGGGCGGCTTGCAAGGTCTTACCTCGCTACTACAAGGTTATTTCAGA TTTATATTTTAATATGTTCAGTCCCCTTTGTGATCGATATGATTTTATCT TTATCTTTTACGTGTATTTCTTTAAAGTATAATTCCGGCAGTTACTGTCA TATAATGCAATATCATTAATTCTCTCTTCTTTATGGGTTTAGGATCCGAC AGTGGGCAGAACTTGTGGCGTTTTGACTACAACATGAGGAAGTCACCTTC GTGGAAGCCAAACTCGTCTCCTGTCGGGTGGACTGCACCCAACGAACAAG CGaaggaaatgaaaccactgctAGCGAATGGCGATATGGAACACCATCAT CCTTCGGTTGATCACGTCATCGGGCCTGATGAAACACTGCAAAGTCTTCT CGAACGCCTCTCATTGTCCACTCATCTCAATCTTTTTCAGGTAAGCAGTT GCTTCCAAATTGATGCCTCATACATCTTGTTGTTATCCAACGTTTGCTTC ACAATTGACACGCAAACTTTAAGTCTTCGTTGCTTCTATTGAATTTTCAT TTCTCTTCTCGTTTAGAAAAACGAAATTGATTTGGATGCGTTGATGTTGA TGTCGGAACAAGACTATGCGGACATTGGTCTTCCGAAGGAACCACGTATC AAGTTGTTGAACAGCATGCGACAACTGCAAAACAGATCCACTGCTCACGT CCCTCAATCACCGCCCCAACAAATACCATTACTGAAGCACATCAATCCAC AGCCGCTATGGAATTCTGCAATGGATAATAACTTACATCACCCTGAAAGC CGGTTACCACCCGCACTTCGGAACAGTGTTCATTTTCCTGGAACACCACA GCTTGCTGTAAGACactttaatcaaactttgtgtATTTCATGTCGctctt ttccatttttttgttgCTGTTCGTTGTCTTTGGTGACTATCACTAATTTA ATACTTGTGAGGTGCCTATGATTGCTCAAAGCTGTGTCACGCTGGTGCAT TGCAATCTTCAGAAAATTTAAGTGCGATACTAATGATTCTATTTGCCCGT GttcactttgcaattttttacaaaatatttcctAAATTCTCCTTAGGCTT CCTGGCAGACGTGGAGTAACACTATCGATCAATGAAACGGTGAGTCATTC ATTTGCAGGTTCACACTAATACAAACTGCTTCTAAGCACATGCTTTTGAG TTTACATGAGTTTGAAATTACTTATGGAGGTGATACAATCACCAGTGCTA TCTGAACCATAGCAAGGCGAACTAATAAAAGGCGACTTGGTTCGAGTTTG CGAAGTACATGCTTTTGAACTTATATGACTTTGATCTTACTACCAGTTca aatcgcagacctctacaaaactaCAGATAGTATTAGGAGCACGACTTTGT TAAAGGATGTGATCAGCCTAACTATTTTgttcttgttttcattttgacga acttcttttttactttctcCCTCAGGTATTCGTTGGCAACGGAGTGTAAT TGGAAATCAAGATTGTCCctttcattttcattgactGGAATTTTTCATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000571XLOC_000571Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000952-exon-sc0000007-1491911889:208424..208553TCONS_00000952-exon-sc0000007-1491911889:208424..208553Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:208424..208553TCONS_00000952-exon-sc0000007-1510915933:208424..208553Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:208424..208553TCONS_00000952-exon-sc0000007-1575043694:208424..208553Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:211627..211765TCONS_00000952-exon-sc0000007-1491911889:211627..211765Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:211627..211765TCONS_00000952-exon-sc0000007-1510915933:211627..211765Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:211627..211765TCONS_00000952-exon-sc0000007-1575043694:211627..211765Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:215501..215656TCONS_00000952-exon-sc0000007-1491911889:215501..215656Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:215501..215656TCONS_00000952-exon-sc0000007-1510915933:215501..215656Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:215501..215656TCONS_00000952-exon-sc0000007-1575043694:215501..215656Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:217417..217548TCONS_00000952-exon-sc0000007-1491911889:217417..217548Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:217417..217548TCONS_00000952-exon-sc0000007-1510915933:217417..217548Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:217417..217548TCONS_00000952-exon-sc0000007-1575043694:217417..217548Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:217763..218164TCONS_00000952-exon-sc0000007-1491911889:217763..218164Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:217763..218164TCONS_00000952-exon-sc0000007-1510915933:217763..218164Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:217763..218164TCONS_00000952-exon-sc0000007-1575043694:217763..218164Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:218619..218713TCONS_00000952-exon-sc0000007-1491911889:218619..218713Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:218619..218713TCONS_00000952-exon-sc0000007-1510915933:218619..218713Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:218619..218713TCONS_00000952-exon-sc0000007-1575043694:218619..218713Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:220297..220344TCONS_00000952-exon-sc0000007-1491911889:220297..220344Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:220297..220344TCONS_00000952-exon-sc0000007-1510915933:220297..220344Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:220297..220344TCONS_00000952-exon-sc0000007-1575043694:220297..220344Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:221127..221248TCONS_00000952-exon-sc0000007-1491911889:221127..221248Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:221127..221248TCONS_00000952-exon-sc0000007-1510915933:221127..221248Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:221127..221248TCONS_00000952-exon-sc0000007-1575043694:221127..221248Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:221417..221484TCONS_00000952-exon-sc0000007-1491911889:221417..221484Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:221417..221484TCONS_00000952-exon-sc0000007-1510915933:221417..221484Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:221417..221484TCONS_00000952-exon-sc0000007-1575043694:221417..221484Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:221672..221863TCONS_00000952-exon-sc0000007-1491911889:221672..221863Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:221672..221863TCONS_00000952-exon-sc0000007-1510915933:221672..221863Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:221672..221863TCONS_00000952-exon-sc0000007-1575043694:221672..221863Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:225203..225400TCONS_00000952-exon-sc0000007-1491911889:225203..225400Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:225203..225400TCONS_00000952-exon-sc0000007-1510915933:225203..225400Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:225203..225400TCONS_00000952-exon-sc0000007-1575043694:225203..225400Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:225518..225645TCONS_00000952-exon-sc0000007-1491911889:225518..225645Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:225518..225645TCONS_00000952-exon-sc0000007-1510915933:225518..225645Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:225518..225645TCONS_00000952-exon-sc0000007-1575043694:225518..225645Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:226771..227686TCONS_00000952-exon-sc0000007-1491911889:226771..227686Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:226771..227686TCONS_00000952-exon-sc0000007-1510915933:226771..227686Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:226771..227686TCONS_00000952-exon-sc0000007-1575043694:226771..227686Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:227853..228098TCONS_00000952-exon-sc0000007-1491911889:227853..228098Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:227853..228098TCONS_00000952-exon-sc0000007-1510915933:227853..228098Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:227853..228098TCONS_00000952-exon-sc0000007-1575043694:227853..228098Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:228190..228692TCONS_00000952-exon-sc0000007-1491911889:228190..228692Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:228190..228692TCONS_00000952-exon-sc0000007-1510915933:228190..228692Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:228190..228692TCONS_00000952-exon-sc0000007-1575043694:228190..228692Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:228866..229103TCONS_00000952-exon-sc0000007-1491911889:228866..229103Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:228866..229103TCONS_00000952-exon-sc0000007-1510915933:228866..229103Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:228866..229103TCONS_00000952-exon-sc0000007-1575043694:228866..229103Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:229218..229414TCONS_00000952-exon-sc0000007-1491911889:229218..229414Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:229218..229414TCONS_00000952-exon-sc0000007-1510915933:229218..229414Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:229218..229414TCONS_00000952-exon-sc0000007-1575043694:229218..229414Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:229532..229847TCONS_00000952-exon-sc0000007-1491911889:229532..229847Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:229532..229847TCONS_00000952-exon-sc0000007-1510915933:229532..229847Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:229532..229847TCONS_00000952-exon-sc0000007-1575043694:229532..229847Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:230131..230365TCONS_00000952-exon-sc0000007-1491911889:230131..230365Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:230131..230365TCONS_00000952-exon-sc0000007-1510915933:230131..230365Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:230131..230365TCONS_00000952-exon-sc0000007-1575043694:230131..230365Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:230616..230882TCONS_00000952-exon-sc0000007-1491911889:230616..230882Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:230616..230882TCONS_00000952-exon-sc0000007-1510915933:230616..230882Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:230616..230882TCONS_00000952-exon-sc0000007-1575043694:230616..230882Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:231293..231460TCONS_00000952-exon-sc0000007-1491911889:231293..231460Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:231293..231460TCONS_00000952-exon-sc0000007-1510915933:231293..231460Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:231293..231460TCONS_00000952-exon-sc0000007-1575043694:231293..231460Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:231801..232912TCONS_00000952-exon-sc0000007-1491911889:231801..232912Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:231801..232912TCONS_00000952-exon-sc0000007-1510915933:231801..232912Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:231801..232912TCONS_00000952-exon-sc0000007-1575043694:231801..232912Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:233066..233313TCONS_00000952-exon-sc0000007-1491911889:233066..233313Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:233066..233313TCONS_00000952-exon-sc0000007-1510915933:233066..233313Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:233066..233313TCONS_00000952-exon-sc0000007-1575043694:233066..233313Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:233440..233730TCONS_00000952-exon-sc0000007-1491911889:233440..233730Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:233440..233730TCONS_00000952-exon-sc0000007-1510915933:233440..233730Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:233440..233730TCONS_00000952-exon-sc0000007-1575043694:233440..233730Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:233970..234012TCONS_00000952-exon-sc0000007-1491911889:233970..234012Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:233970..234012TCONS_00000952-exon-sc0000007-1510915933:233970..234012Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:233970..234012TCONS_00000952-exon-sc0000007-1575043694:233970..234012Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1491911889:234349..234422TCONS_00000952-exon-sc0000007-1491911889:234349..234422Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1510915933:234349..234422TCONS_00000952-exon-sc0000007-1510915933:234349..234422Clytia hemisphaericaexon
TCONS_00000952-exon-sc0000007-1575043694:234349..234422TCONS_00000952-exon-sc0000007-1575043694:234349..234422Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:208424..234422 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.765207 0.212482 0.495121 0.690478 0.0445744 1.89524 1.34261 0.540167 2.14393 0.952273 0.0759408 1.98339 1.10121 1.50287 0.394877 1.03714 2.75948e-06 1.88135e-07 0 0.451902 0.828894 0.0118426 3.20692e-07 0 0.167427 4.85434e-07
Blast
BLAST of TCONS_00000952 vs. Swiss-Prot (Human)
Match: ANKH1 (Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1)

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 396/533 (74.30%), Postives = 458/533 (85.93%), Query Frame = 2
Query:  281 DGKAFTDPEVLRRLTSSVSSALDEAAAALTRMRSQTGKPNATTSQSEQGTRSLVEACIEGDIAAVRKLLDEGRSVHEPTDEGESLLSLACSAGYYELVQVLLAMNANVEDRGSKGDCTPLIEAASNGFVDIVKLLLQHGANVNAQSSAGNTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGASTPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1879
            DGKAF DPEVLRRLTSSVS ALDEAAAALTRM+++      + +  +  TRSL EAC +GD+ AVRKLLDEGRSV+E T+EGESLL LACSAGYYEL QVLLAM+ANVEDRG+KGD TPL+ A+S G++DIVKLLL H A+VN+QS+ GNT+L  AC  G+ D+V++L+   A++E  NENGHTPLM+AAS GHV+VA++LLD GAGINTHS+EFKESALTLACYKGH+DMV FLLE GADQEHKTDEMHTALMEA MDGHVEVARLLLD GAQVNMPADSFESPLTLAACG HVELA LLIE GANLEEVNDEG+TPLMEAAREG+  MVALLLA GAN+ AQTEETQETALTLACCGGF EV  +L+  GADIELG STPLMEA+ EGH+ELVK+L+  GANV+A TATGD ALTYA ENGHTDV +VL++ GA++EHESEGGRTPLMKAARAGHLCTV++L+S+GA+VNR T+  +H+V+SLACAGGH AVVELLL  G +PT +LKD S+MLIEAAKGGH NV   L++
Sbjct:  162 DGKAFADPEVLRRLTSSVSCALDEAAAALTRMKAEN-----SHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLD 689          

HSP 2 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 330/492 (67.07%), Postives = 391/492 (79.47%), Query Frame = 2
Query: 2558 NALQTFAASHNLELVNLGEITLPPAPFQLETEAEEGIMVADSARTLQNSINGMV----REDPIGECSSLPIGECSSLPSI-ETTLPVPAQSPVTPPLSPAIDIDQSTDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLVKHVSQFPPDSDCKRFIQTISDKDLLKKLDECMQIINAAKKRQEAEANKNASILLEELD 4018
            N+L+    S N ++V   +I +      L  +  +G+MVA  A+TL ++++ ++       P G  SS    EC +  S  +TT  V +QS   PP+ P++DID  T+SNHDTALT+ACAGGH+ELV +L+AR + IEHRDKKG TPLILAATAGH     ILL+ G DIEAQS+RTKDT LSLACS GRQEVV+LLL   AN EHRNVSDYTPLSLAASGGYV IIK+LLN GAEINSRTGSKLGISPLMLAAMNGHV AVKLLLD GSD+NAQIETNRNTALTLACFQGR EVV LLLDR ANVEHRAKTGLTPLMEAASGGY +VGRVL+D+GADVNA PVPSSRDTALTIAADKGHYKF ELL+ RGA +DVRNKKG TPLWL+++GGH DV QLL + GADV+A DNR ++ L++AFRKG++KVV++LVK V+QFP D +C R+I TI+DK+LLKK  +C++ I  AK +Q AEANKNASILL+ELD
Sbjct:  947 NSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPDGLMVATPAQTLTDTLDDLIAAVSTRVPTGSNSSSQTTECLTPESCSQTTSNVASQS--MPPVYPSVDIDAHTESNHDTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVKEVNQFPSDIECMRYIATITDKELLKKCHQCVETIVKAKDQQAAEANKNASILLKELD 1436          

HSP 3 Score: 209.534 bits (532), Expect = 8.891e-54
Identity = 135/363 (37.19%), Postives = 204/363 (56.20%), Query Frame = 2
Query: 2858 STDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINS-------------------------RTGSKL------GISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVN-AMDNRAVSVLVAAFRKGNIKVVKWLVKH 3850
            S  +  +TALT ACAGG  ++V++LL  G+NIE  ++ G TPL+ AA+AGH     +LL+HGA I   S+  K++AL+LAC  G  ++V  LL + A+ EH+    +T L  A   G+V + ++LL+ GA++N                            G+ L      G +PLM AA  GH   V LLL +G+++NAQ E  + TALTLAC  G +EV   L+   A++E       TPLMEA+  G++++ + L+  GA+V+A    ++ DTALT A + GH   A++L+  GA ++  ++ G TPL  +A  GHL   Q L  +GA+VN A  N   +V+  A   G++ VV+ L+ H
Sbjct:  300 SQSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCS---TPLMEASQEGHLELVKYLLASGANVHA--TTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAH 657          

HSP 4 Score: 199.519 bits (506), Expect = 8.330e-51
Identity = 141/364 (38.74%), Postives = 207/364 (56.87%), Query Frame = 2
Query:  728 NTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDE-----GFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGAST---PLMEAATEGHVELVKFLIEKGANVNA--ITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADV----NRKTSGGEHSVLSLACAGGHTAVVELLL 1777
            +T+L  AC  G++++V +LI  +A +EH+++ G TPL+ AA+ GHV V ++LLD G  I   S   K++ L+LAC  G  ++V  LL RGA++EH                     R + D+            +PL+LAA G +V + ++L+  GA   E+N       G +PLM AA  G++P V LLL  G+++ AQ E  + TALTLAC  G  EVV+ LLD  A++E  A T   PLMEAA+ G+ E+ + L++KGA+VNA  + ++ D ALT AA+ GH    E+LI +GA+I+  ++ G TPL  A+  GH   V+ L+  GADV    NRK      + L  A   GH  VV+ L+
Sbjct: 1056 DTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEH---------------------RNVSDY------------TPLSLAASGGYVNIIKILLNAGA---EINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKI-----TPLMSAFRKGHVKVVQYLV 1378          

HSP 5 Score: 192.586 bits (488), Expect = 1.221e-48
Identity = 126/357 (35.29%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  527 ESLLSLACSAGYYELVQVLLAMNANVEDRGSKGDCTPLIEAASNGFVDIVKLLLQHGANVNAQSS-AGNTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHSSEF-----------------------------------KESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMP--ADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGASTPLMEAATEGHVELVKFLIEK 1483
            ++ L+LAC+ G+ ELV VL+A +A +E R  KG  TPLI AA+ G V +V++LL  G ++ AQS    +T L  AC  G  +VV+LL+   A+ EH+N + +TPL  AAS G+V + K+LL+AGA IN+ +                                      + +ALTLAC++G  ++V  LL+R A+ EH+     T LMEA+  G+ EV R+LLD GA VN P    S ++ LT+AA   H +  ELLI  GA+++  N +G TPL  A+  G+  +V LL+  GA+                            +D   + ++   TPLM A  +GHV++V++L+++
Sbjct: 1056 DTALTLACAGGHEELVSVLIARDAKIEHRDKKG-FTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGAD----------------------------VDAADNRKI---TPLMSAFRKGHVKVVQYLVKE 1380          

HSP 6 Score: 190.274 bits (482), Expect = 6.255e-48
Identity = 119/323 (36.84%), Postives = 188/323 (58.20%), Query Frame = 2
Query: 2882 ALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVNAM-DNRAVSVLVAAFRKGNIKVVKWLVK 3847
            +L  AC+ G    V+ LL  G ++    ++G + L LA +AG+     +LL   A++E + ++   T L  A S G  ++V+LLL+ +A+   ++ +  T L+ A +GG+V I+KVLLN GA I     ++ G +PLM AA  GHV   ++LLD G+ +N      + +ALTLAC++G  ++V  LL+  A+ EH+     T LMEA   G+V+V R+L+D GA VN +P   S ++ LT+AA  GH + A LL+ RGA ++  N +G TPL  +A  GH ++  LL  +GA++NA  +    + L  A   G  +V  +L+K
Sbjct:  208 SLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFVDIVKVLLNEGANIEDH--NENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVN-MPA-DSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIK 526          

HSP 7 Score: 186.422 bits (472), Expect = 7.696e-47
Identity = 122/325 (37.54%), Postives = 194/325 (59.69%), Query Frame = 2
Query: 2876 DTALTIACAGGHDELVQLLLARGSNIEHRDKKG-CTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGC-TPLWLSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLV 3844
            ++ L +AC+ G+ EL Q+LLA  +N+E R  KG  TPL+ A++ G+     +LL H AD+ +QS  T +TAL+ AC+ G  ++V++LL   AN E  N + +TPL  AAS G+V + +VLL+HGA IN+ + ++   S L LA   GH+  V+ LL+ G+D   + +   +TAL  AC  G  EV  LLLD  A V   A +  +PL  AA GG+V++  +LI+RGA++    V     T L  AA +GH +   LL+ +GA ++ + ++   T L L+  GG  +V   L + GAD+   +    + L+ A ++G++++VK+L+
Sbjct:  239 ESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQS-ATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHS-NEFKESALTLACYKGHLDMVRFLLEAGADQEHKTD-EMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEE--VNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADI---ELGCSTPLMEASQEGHLELVKYLL 555          

HSP 8 Score: 163.31 bits (412), Expect = 8.554e-40
Identity = 114/327 (34.86%), Postives = 171/327 (52.29%), Query Frame = 2
Query: 2849 IDQSTDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGS----------------------------KLGIS-PLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLL 3742
            I+  ++   ++ALT+AC  GH ++V+ LL  G++ EH+  +  T L+ A   GH     +LL+ GA +   +D + ++ L+LA   G  E+  LL+   AN E  N   YTPL  AA  G+  ++ +LL  GA IN++T                              +LG S PLM A+  GH+  VK LL  G++V+A   T  +TALT AC  G T+V  +LL   A++EH ++ G TPLM+AA  G++   + LI +GA+VN     ++  T +++A   GH    ELL+  GA    R K G T L  +A GGH +V   L
Sbjct:  364 INTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPAD-SFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLASGANVHATTATG-DTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRA-TANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYL 687          

HSP 9 Score: 154.836 bits (390), Expect = 3.481e-37
Identity = 120/369 (32.52%), Postives = 177/369 (47.97%), Query Frame = 2
Query:  902 INTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPAD-SFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADI------ELGASTPLMEAATEGHVELVKFLIEKGANVNA-ITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVN-------RKTS------------------GGEH---------SVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSM--LIEAAKGGHANVAHLLM 1876
            I+ H+    ++ALTLAC  GH ++V  L+ R A  EH+  +  T L+ A+  GHV V  +LLD G  +   ++ + ++PL+LA  G   E+ +LL+  GAN E  N   +TPL  AA                                   GG++ ++  LL+ GA+I      +LG S PLM AA  GHV  VK L++ G+++NA I    + ALT A   G  +VV +L+++ AN+EH ++ G TPLM+AA  G+      LL +GADVN       R T+                   G H         + L LA  GGH  VV+LL+  G +  +   DN  +  L+ A + GH  V   L+
Sbjct: 1047 IDAHTESNHDTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAA----------------------------------SGGYVNIIKILLNAGAEINSRTGSKLGIS-PLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGAD--VDAADNRKITPLMSAFRKGHVKVVQYLV 1378          

HSP 10 Score: 154.451 bits (389), Expect = 4.874e-37
Identity = 95/263 (36.12%), Postives = 143/263 (54.37%), Query Frame = 2
Query: 2876 DTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTG-------------------------------SKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIP 3571
            ++ LT+A  GGH EL  LL+ RG+N+E  + +G TPL+ AA  GH     +LL  GA+I AQ++ T++TAL+LAC  G  EV + L+ + A+ E   +   TPL  A+  G++ ++K LL  GA +++ T                                S+ G +PLM AA  GH+  V+ L+ +G++VN     N +T ++LAC  G   VV LLL   A+  HR K G T L+EAA GG+ +V   L+D   +V ++P
Sbjct:  439 ESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIE---LGCSTPLMEASQEGHLELVKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDYPNNVLSVP 698          

HSP 11 Score: 147.902 bits (372), Expect = 4.861e-35
Identity = 99/297 (33.33%), Postives = 155/297 (52.19%), Query Frame = 2
Query:  413 QSEQGTRSLVEACIEGDIAAVRKLLDEGRSVHEPTDE-GESLLSLACSAGYYELVQVLLAMNANVEDRGSKGDCTPLIEAASNGFVDIVKLLLQHGANVNAQSSAG------------------------------------NTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHS-SEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIE 1189
            + ++G   L+ A   G +  V  LLD+G  +   ++   ++ LSLACS G  E+V +LLA  AN E R +  D TPL  AAS G+V+I+K+LL  GA +N+++ +                                     NT+L  AC  G  +VV LL+   A++EH+ + G TPLM+AAS G+ +V ++LLD GA +N       +++ALT+A  KGH      L+ RGA  + +  + +T L  AS  GH +V +LL+  GA V+   +   +PL  A    HV++ + L++
Sbjct: 1084 RDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHR-NVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVK 1379          

HSP 12 Score: 122.865 bits (307), Expect = 1.785e-27
Identity = 85/254 (33.46%), Postives = 123/254 (48.43%), Query Frame = 2
Query: 1136 LTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGAS----TPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHE--SEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1879
            LTLA  G H EL  +LI   A +E  + +GFTPL+ AA  G++                                   VV  LLD G DIE  +     TPL  A + G  E+V  L+ +GAN      +    L+ AA  G+ +++++L+  GA I     S+ G +PLM AA  GH+  V+ LL  G+D+N +     ++ L+LAC  G   VV LLL R  N   + K   + L+EAA GG+A V  +L++
Sbjct: 1059 LTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHV----------------------------------GVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLD 1278          

HSP 13 Score: 100.908 bits (250), Expect = 7.246e-21
Identity = 43/101 (42.57%), Postives = 73/101 (72.28%), Query Frame = 2
Query: 4682 KKAKRVDDEWKEVTRSIPHTKSRKILIPAALISRVIGRGGCNVNAIREHTGAHIDIDTNRKKANGDCMVTIKGSQQATKQAGNLIQSLIDDPDSNVAEILP 4984
            K+ ++ ++ WKEV R     +S+K+ +PA+++SR++GRGGCN+ AI++ TGAHID+D  + K NG+ M+TI+G  ++T+ A  LI +LI DP   + +++P
Sbjct: 1681 KRGQKREEGWKEVVR-----RSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDK-NGERMITIRGGTESTRYAVQLINALIQDPAKELEDLIP 1775          

HSP 14 Score: 99.7525 bits (247), Expect = 1.583e-20
Identity = 77/244 (31.56%), Postives = 114/244 (46.72%), Query Frame = 2
Query: 3254 NSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTG-LTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLW----------------------------------LSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLVKHVSQ--FPPDS 3874
            NS    ++    L  A  +G V AV+ LLD G  VN   E    + L LAC  G  E+  +LL  HANVE R   G +TPLM A+SGGY+D+ ++L+   ADVN+    ++ +TALT A   G     ++L+  GA ++  N+ G TPL                                   L+ + GHLD+ + L   GAD     +   + L+ A   G+++V + L+   +Q   P DS
Sbjct:  197 NSHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGE-SLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNS--QSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADS 437          

HSP 15 Score: 99.7525 bits (247), Expect = 1.610e-20
Identity = 53/121 (43.80%), Postives = 74/121 (61.16%), Query Frame = 2
Query: 1517 DAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1879
            D ALT A   GH ++V VLI + A IEH  + G TPL+ AA AGH+  VE LL +G D+  ++   + + LSLAC+GG   VV+LLL RG N   +   + + L  AA GG+ N+  +L+N
Sbjct: 1056 DTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLN 1176          

HSP 16 Score: 94.3597 bits (233), Expect = 7.129e-19
Identity = 51/128 (39.84%), Postives = 73/128 (57.03%), Query Frame = 2
Query: 2858 STDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNH 3241
            +T +  DTALT AC  GH ++  +LL  G+++EH  + G TPL+ AA AGH  T   L+  GA++   +     T +SLAC+ G   VVELLL   A+  HR     T L  AA GG+  ++  LL++
Sbjct:  563 ATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDY 690          
The following BLAST results are available for this feature:
BLAST of TCONS_00000952 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ANKH18.891e-5474.30Ankyrin repeat and KH domain-containing protein 1 ... [more]
back to top