Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000951 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000951
Unique NameTCONS_00000951
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6993

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000951 ID=TCONS_00000951|Name=TCONS_00000951|organism=Clytia hemisphaerica|type=transcript|length=6993bp
acaagttaaaaagggcgcgcgatcagtgaaagttatcgtgacatgttatg
acaaaaagtatgattgataaacttggtggagttatcaaaataaatttgtt
gtcaaagagNTGACATCAGTGATGAAGATGAAGACAGTATGTCGCTCCAA
TGTCTAGACCATACCAATAACTTGACAACTCGACTTTTACTTGCTGGGGA
AGATATAAATCATGATTTATCAAATCTCACTCTTGTTGGTCCAGAAACAC
AAGCAAGACTTGAAGCCTTGTTAGAGGCAGCTGGTGTTGCAGCAGATGGA
AAAGCTTTCACTGATCCTGAAGTTCTGCGTCGACTAACTTCTTCAGTTAG
CAGTGCACTAGATGAAGCAGCTGCAGCACTGACAAGAATGAGATCACAAA
CAGGGAAACCAAATGCAACAACTTCGCAATCTGAGCAAGGCACCCGTAGC
CTTGTGGAGGCTTGCATTGAAGGAGATATAGCTGCAGTTCGTAAACTTTT
AGATGAAGGAAGAAGTGTACATGAACCAACTGATGAAGGAGAAAGTTTGT
TGTCATTGGCTTGTTCTGCTGGTTACTACGAACTTGTACAAGTGTTACTT
GCAATGAACGCCAATGTTGAAGATAGAGGTAGTAAAGGTGATTGTACTCC
TCTCATTGAGGCTGCCAGCAATGGTTTTGTTGACATTGTAAAACTTCTTC
TTCAACATGGAGCCAATGTCAATGCACAATCATCTGCTGGAAACACTTCA
CTTCATAAAGCTTGTGGTAGTGGATATGATGATGTCGTTGAACTTCTTAT
ACAACACAATGCAGATCTTGAACATCAAAATGAAAACGGACATACTCCTC
TGATGGACGCAGCTAGCAATGGTCATGTCAAAGTAGCCAAACTTTTGCTT
GATGCAGGTGCTGGAATTAATACACACTCAAGTGAATTCAAAGAAAGTGC
TTTAACTTTGGCCTGCTACAAAGGGCATGTTGATATGGTTTTCTTTTTAT
TGGAGAGAGGTGCTGACCAAGAACATAAGACAGATGAAATGCACACAGCT
TTGATGGAAGCATCAATGGATGGACATGTGGAAGTTGCAAGACTACTCTT
GGACCATGGAGCTCAGGTGAACATGCCGGCTGATAGTTTTGAATCCCCAT
TAACGCTTGCAGCATGTGGAAGTCATGTTGAATTAGCTGAGTTGTTGATT
GAGCATGGTGCAAACCTTGAAGAAGTCAACGATGAAGGGTTCACTCCACT
AATGGAAGCAGCTAGGGAAGGATACTTACCAATGGTGGCTTTGCTTTTAG
CACATGGAGCCAACTTGTATGCTCAGACAGAAGAGACACAAGAAACAGCA
TTGACACTTGCGTGTTGTGGTGGGTTTCTGGAGGTGGTGGCTTACCTTTT
GGATTGTGGTGCCGATATCGAACTTGGTGCATCTACTCCTCTCATGGAAG
CAGCTACTGAAGGTCATGTTGAACTTGTCAAATTTCTTATTGAGAAAGGT
GCAAACGTGAATGCCATCACAGCTACAGGTGATGCAGCATTGACATACGC
TGCAGAAAACGGTCATACAGACGTAGTAGAAGTATTGATTGAACAAGGTG
CCAACATTGAACATGAATCTGAGGGTGGTCGCACTCCTTTGATGAAAGCT
GCTCGTGCGGGACACCTTTGCACAGTGGAATATCTCCTCAGTCAAGGGGC
CGACGTGAATAGAAAAACCAGCGGTGGAGAGCATTCTGTTTTATCATTAG
CATGTGCTGGAGGCCATACCGCTGTTGTCGAGCTCCTTCTTGGTAGAGGT
GGTAATCCTACTATGAAATTAAAGGACAATTCAAGTATGTTGATAGAAGC
GGCCAAAGGTGGTCATGCTAACGTAGCCCACCTGCTCATGAACACTCAAA
TACATCAACAAACCTTCACTCAAACCGATACTTTACATTCTGAATATCCA
ATACATTCAAGCGCTTTACCAACGGACAGCGCTTTCCCTATCTGTCCACA
CGTTCAACACGAGCAAGATCACATCGCGCATCAACCAGATTGCCATTTTC
ATAATACGCCTGAAAATCAACATTTTGCTCATGACTTTTCACAACAAATC
ATTCAACCGTCTCCGCCTTCCGATCACTTTCAACAACAACATCCGAACGA
TGAGTTGGACGACGAGAATTACAACAACAATATCGATGTCAACACTTCAC
CAACTGATCTTTATCTTCCCAACATACCTGTCTCCCTCGCTTCTTCTCTC
TCACTCGCCAACCTTACAACTGCCGATCTGCAACATTTAGCTCAGGTTTT
ACAATACTCTTCGAATCAAAATCAAACGCTTGAAGACGTAGTAGCGGCTG
GTCAAAATGCTGAACAGATTGGTTTACAAACGATTACTTTCCCTGCAATC
GACCCTCAAGTGGAGAGTTTCACCACACAATCAGAAGTGTGTACACCATC
ACCCTCAAACACGGCAACTGCTCTCGTTACAAGTGCAGGACGAACCATCA
CTTCAACTGGCGTGCAAACTGAAGATGCAATTTCCATGATTCAAAAACTT
ACCAACAGTGTCCATCAGCTGAACGCTCTACAGACATTCGCAGCATCCCA
CAATTTGGAACTAGTGAACCTGGGTGAGATTACACTACCTCCAGCGCCTT
TCCAACTTGAAACAGAAGCGGAAGAAGGGATCATGGTAGCTGATTCTGCA
CGCACTCTACAAAACTCCATCAACGGCATGGTTCGCGAAGatCCGATCGG
TGAATGCAGCTCTTTACCGATCGGTGAATGCAGCTCTTTACCATCCATCG
AAACGACACTTCCAGTACCGGCACAATCTCCCGTCACACCTCCCCTCTCA
CCAGCCATCGATATCGACCAAAGTACGGACAGTAATCACGATACGGCGCT
CACTATCGCCTGTGCTGGTGGACACGATGAACTTGTACAACTTCTGCTGG
CCAGAGGTTCCAACATTGAACACCGCGACAAAAAGGGCTGCACGCCATTA
ATCCTAGCGGCAACAGCAGGTCACACTGCCACATGTCACATTCTTCTCGA
ACATGGAGCAGACATCGAAGCACAATCAGATCGAACCAAAGACACTGCAC
TTTCCTTAGCATGTTCCAGTGGTCGCCAAGAAGTTGTCGAATTACTCCTC
ATGTCCAATGCTAACTTTGAACACCGAAACGTCTCTGATTACACGCCTCT
CAGTTTAGCAGCTTCGGGAGGGTACGTTGGTATCATCAAAGTTCTGTTGA
ACCATGGTGCAGAGATCAATTCACGCACAGGAAGCAAGCTGGGCATCTCT
CCCCTCATGTTAGCGGCAATGAACGGTCATGTTGCGGCTGTCAAACTCCT
CTTGGATCGTGGCAGTGACGTCAATGCTCAAATCGAAACCAATAGAAATA
CAGCTTTAAcgttagcatgttttcaaggGCGAACGGAAGTTGTTGGTCTG
CTTTTAGACCGACATGCAAATGTGGAACACAGGGCCAAGACCGGATTAAC
TCCATTAATGGAAGCAGCATCAGGTGGTTACGTCGATGTGGGTCGTGTTC
TGATCGATCGCGGTGCAGATGTGAACGCCATCCCAGTCCCTTCGTCACGT
GACACTGCACTCACAATCGCTGCCGATAAAGGACACTACAAATTCGCCGA
GTTATTAGTGGTTCGTGGTGCCGTTGTTGACGTGCGTAATAAGAAAGGAT
GTACACCTCTATGGCTCTCCGCACACGGTGGGCATCTGGATGTTTGTCAG
TTGTTAGCGCGTGAAGGAGCTGATGTGAACGCCATGGACAATCGAGCAGT
CTCTGTTCTCGTAGCCGCGTTCAGAAAAGGAAACATCAAAGTGGTCAAGT
GGCTGGTCAAACATGTATCACAGTTCCCACCTGATTCTGACTGCAAACGT
TTCATTCAAACCATCTCTGATAAGGACTTACTAAAGAAATTAGACGAATG
TATGCAAATCATCAACGCGGCAAAGAAAAGACAAGAAGCAGAGGCGAACA
AGAACGCGTCCATTCTGTTGGAAGAGTTGGATCATGAGAAAAAGAAGGAG
GAGAGGCGGAAAGCGCAAGCTCAAAAGAAACGTGATAAGAAGAagcagaa
gaaaaagaaaaagagtacGGAGAAGCAGTCTGTGGATACTGAAGAAGATG
GCGAGAAAGAAGACGAGGAAGAGTTCGAACATGCAACGAGTGGATTCCCT
TTCATCAATGCTGATCAACGAACGCCCTTGATGATCAATGACGAACGACC
CGATCTTTCGACTGCTGAATTGAAACTGAAATCTCAAGTTCAACTGAAGA
GCAAGAAGAAGAGCCGTCTAAAGAGTCGCAACTCCTCTCTCAGCAAAAGT
ACGGATGAAGAGAAGGAGATGGCGGACAAAGATGTGGAAGATATCATAGA
TCCCGTATCCACCGCCATCGATGCTCTGACCAACATCGTTATCACTACTG
CTGCTCAATTTGTATCCTCTATCAAACCAACAGACACAGTGAGTGCGGCA
ACAGTAGCTGAAATCACCAAAGCTCTTGCAGCTTCCATCATCACTAACGC
TAAAGACAATACTAAGACCTCTATCCCAGATGAGGTTGCTGTTACTATGG
CAACGGCTGCTGCTCAACGTGTGGCGGTCAGCATTTCTTCACCTTCGCTA
CTAAGCAACAATAATAACAATGGATTTGCGCTTAACACGAGTCAGAAGAA
AGCAAAACGAGTTGACGACGAATGGAAAGAGGTCACTCGAAGCATTCCGC
ATACGAAGTCAAGGAAGATCTTGATACCAGCCGCCTTGATCAGTCGCGTT
ATCGGTCGTGGTGGGTGCAACGTCAACGCAATACGTGAACACACGGGAGC
ACATATCGACATCGATACAAATCGAAAGAAAGCCAACGGTGATTGTATGG
TCACCATCAAGGGTTCGCAACAAGCTACGAAACAAGCAGGGAACTTGATC
CAATCTTTGATCGACGATCCCGATAGCAACGTTGCGGAAATTCTCCCTAC
ACTTCCTACTATTGCGACGTCTCTGTCTACAAGCGTCTCATCTTCTTCTC
TCATTCCTCTCATGAAAAACCTCACCAAACCCACCACCATCGAATCGTCT
CTCGACAttccaaaaacaattcaatcACTTTCAAAATCACTTAACACGCC
CAAAACTAGCGACAAAATACCGACGCTTCGACAAATCTCGGCACCAGCAA
ATTTGGTGCCTCCTACATCGACACCTTCTTCTCAACCAGTACGAATGGTT
CCTGTTGTCAACTCGAATTCCAAGAAACTCGAAGTCGCCAAGGAATCTTC
GGCGCCGTCTAGAACGAAAGTGAAACCTCCTGCGCTCACTACAACCACAC
CAAATAGTGGATGGAAGTCCACTAATCAACAAGACACCAACACCGTGCTA
AAGCAGACGTCCTCAACGATGGCTGTCTCTACTCGCTCACAGGTGTCAGT
GACACGGCAATTATCGAATGAAGGGAGCCAAGTGCACCAACAAATTATAA
CGACCATCAGTACAACAGTTTTCTCATCCTCTTCTCGTAATCTTCCCAAA
CCCATCGGTAGCAATCGACCCTTTCGACCAATCGCTTCTCCCACTAATGC
TCTCTCGTCAACAGCTGTGTCGAATTCAGTGGCAGCCACTCTTCATTCGA
CATTAAACAGTCTACTTTCGCAGGTGGCGACACAACGCAGTCCCATGATA
TGGAACGATCATCCAGGTTCGAAGGAGCACCATGGTAGCAGTGGTGATCT
GGTGGTGACGACAGTAGCCACCTCACCCAACAATACGCTAAACGGAACGC
CCATTGAACGATTCTTACCCGCCTCTCTTTCGCAAGCTTCTTCACAGGAA
TCGTTCAAAGGTCACTCGAGAACACCTTCACTATCTCCAACTTCTAACCA
CTCCAATTCACCGACACCAGAAGAAAAACCCCACCTCAACCCCATCGGTA
GTGAAAGAGGTCACAAGAAACCGACTGTAAACCAACAGGGCGGCTTGCAA
GGTCTTACCTCGCTACTACAAGGATCCGACAGTGGGCAGAACTTGTGGCG
TTTTGACTACAACATGAGGAAGTCACCTTCGTGGAAGCCAAACTCGTCTC
CTGTCGGGTGGACTGCACCCAACGAACAAGCGaaggaaatgaaaccactg
ctAGCGAATGGCGATATGGAACACCATCATCCTTCGGTTGATCACGTCAT
CGGGCCTGATGAAACACTGCAAAGTCTTCTCGAACGCCTCTCATTGTCCA
CTCATCTCAATCTTTTTCAGAAAAACGAAATTGATTTGGATGCGTTGATG
TTGATGTCGGAACAAGACTATGCGGACATTGGTCTTCCGAAGGAACCACG
TATCAAGTTGTTGAACAGCATGCGACAACTGCAAAACAGATCCACTGCTC
ACGTCCCTCAATCACCGCCCCAACAAATACCATTACTGAAGCACATCAAT
CCACAGCCGCTATGGAATTCTGCAATGGATAATAACTTACATCACCCTGA
AAGCCGGTTACCACCCGCACTTCGGAACAGTGTTCATTTTCCTGGAACAC
CACAGCTTGCTGCTTCCTGGCAGACGTGGAGTAACACTATCGATCAATGA
AACGGTGAGTCATTCATTTGCAGGTATTCGTTGGCAACGGAGTGTAATTG
GAAATCAAGATTGTCCctttcattttcattgactggaatttttcatttca
ataatCGTCAAGACGATTCACCAAGACTTCTTCATTTCTTCGTATttcct
ttgtttacatttgtttaCTTTACCCTTTTATCAGAGATGATATGATTATG
CAGAATTTTAGAGAACAGAATTACCAGAGCCTTTTACTAGAGTCATGTTG
GAATGTTAAATTGTAGttgatttatatattatatatcaGAAAGAAATTAT
GTTCATGGAAAACTAAGTATTTGATACCGTGTCATATTTGATACCTTGCC
ACCACACAATGCACGcactttcttattttcagcCTTTTGGGGA
Run BLAST on NCBI

transcript from alignment at sc0000007:208410..234810+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000951 ID=TCONS_00000951|Name=TCONS_00000951|organism=Clytia hemisphaerica|type=transcript|length=26401bp|location=Sequence derived from alignment at sc0000007:208410..234810+ (Clytia hemisphaerica)
acaagttaaaaagggcgcgcgatcagtgaaagttatcgtgacatgttatg acaaaaagtatgattgataaacttggtggagttatcaaaataaatttgtt gtcaaagagNTGACATCAGTGATGAAGATGAAGACAGTATGTCGGTAAGC GTTCTTTCTCAGAAATTGAGCAtttatgaaaaatctttgaGTTGACTTAA GGCCAACAGTTTTCAGAAGTCTGACACCACTTTTACATTGACCGcaatca aaaaattaacaatagATTTGATTGTTGTGCCAGTTTTCCCAAACAATTTT GTCTGACAATgagtgataaaaaaaatcaatgtttaccgacaactgctcta acttgggactatctgacaaaacttggggcggcaattcggccaccatttca ccgaacctccaaagtcatttcaTGGCTCCGANcaatcgtcccaagttaga gcagttgaagGTACTGCCAAAACAACAGCAGCATAAATCTTTTTGCACAG TGCAGGGAATAAGCGAGTCTGTTCGTATCGTCTGTTAGTGTTACACAGGC ttgttaaaaacataaatactTTTAATAAATTTGTTCTTAGTCACAATTAG AAAACATGAAAAGGAGTACTATGATTAGGCAGTGCAGCTGGAACTTTGAg gatatatatatttttatatatgtcagatagtcccaagttagagcagttga cagtaagTGTTTATTTCCTGAAATATACAAAATAGTATATTTAATACTAA GCATGTTAAAATTTTAATCATGTGATAGCgtaaatttaaatatattatgg ctaaataaaaaacaaatgatggcagttctgttttttcctgaaacccccgg gaaatttttttttgccgacttagccaTTTTACAAGTCTCGGAAAAggact cccataggaattccgatacataaccctattggttaattttggaacggctt caagaaaggcATAATgacagataattttaaaagtttctggctaggaaatg tgtggaatttatcaatgttgatggtttgttgattctttaataaagaaaat ttggaaTGCAGAAAGACTCTAATTTATGTATCTAATTTACCTTTAAAGAA GTTTAAAGGTAAAAAGTTTGAGAGATTTGAGCAAGGCAAAAGTCGCTAAA AAGCTAGTAAAATTGTAATCCTGGAATATCAAAGGTCCAGCTACATTGAC CTATTTTTGGATTCTCTCTCTAACAGTACTTTTCAACACCAGACAGTGTA CATTGGATATCTCAAATCCCTGGTGCCTCTGGTGTGGAGGCAGCAGCCac aatcaaccaaccaaaatttgtcattttaNGTACATTGGATATCTCAAACC CTGGTGCCTCTGGTGTGGAGGCAGCAGCCacaatcaaccaaccaaaattt gtcattttaatTCTTGAGATAGCGCATCGATTCATTAGGCCTTGATTTTT TCATACTAAATCTGATGATGGGAAGAATCTCCCTAATATATATAGGGAGT CTTCGACGGGTTATAgttcgtcatttttcagaattttcaagatttcaact ctctcaagattcactcgttcgccagctcttgcggtgagcggtcacggTGN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NAGAAGATGTTAGGTAAATTACCTCGAATCCAAATGTGAATGATAGTGAT AAATTTAAACCTCTCTATGTTTTTAGCTGttgatattttgcttcattACT CTCTGTATTGATTTCAGCTCCAATGTCTAGACCATACCAATAACTTGACA ACTCGACTTTTACTTGCTGGGGAAGATATAAATCATGATTTATCAAATCT CACTCTTGTTGGTCCAGAAACACAAGCAAGACTTGAAGCCTTGTTAGAGG CAGCTGGTAAGCTCTTTTAATTCCCACTTATACATACAAGGTCTAACAGA TTAGGCAATCACAAAATTCATTTGACAAGTTTCCtttattgtattgtatt gtttctttatttcaaaaaattacaatGAAATAGCAAATGCTAATAAACAC CAACCCCTAATAGTTTTTTAATCACAGCATAACCTGCAGTTGCATGGAAT TTCTATTTATTTTGTGAAATTcttaagtaatttttcaaactcTTCAAGAG AGTCTGCTAATTTAATATCATAATATCTCGATAAGTGACTCGGGGAGCCC TTATGCTCTCTCATTTTATTATTAGCCTTAGAGCAAAACATCCAGATAAA GTCGCTAtagttaaattgtgaaaaaatataagctgatgcaaaataattta tcttctctgatttttggtacaagGAGTCCAAAAAGCTGATTCCTAGAacc atagtttctagaggggtcaagaccccccttaggtaagaggacccccccct taagtgctaaccccccttaggaaattcatttaaaatttcacacccccccc ttagaaaatcagaaaattgaaatttcgcaTAATTCAAGGAATATCCCCCT tatctaagaagacccccccttaactggcaaccccccccttaggaaagtcg tacttttaacaccccccttgcttttggttcatcaaaacccaagacccTTC CTAAATGTAGGGGAAAAAAACCAAAGTCGGGTGAACTCGGTGTCTAAATG CCCCTGAAAATTTTAGTACACGGGTACTTAAATGCCACTATAATATGGGG TAGTAGTAtgcaaaaattttgcaaaatccCTTTTAGTattcatatatgtc tgagattttagtaccaacCTTCCCCTGATCTAACATGGTTTTATTTTCTA TCACTTTAGattttacttgaaataatttccTATTTGCTTTAAAGTCAAAG TAGGGTGTTTAAAAAGGGATAACCAGCTATTTTTCTTAGATAAGTTGCAA AATGACAGACTTTTCCCTAAATAAATTGGACACACACCACATTTTGTGTG TGTTAGGGATTTATCAAGACATAATGATAGTATTCCTAATTTAAATTTCA GGTATGTACTTCAGTTCCAATATTGAATTGCAACGTGTTCTGAAAGTATA GTAGTATACATGCATGTCTCTTACAGCAGCAAATAATCTTTTCATTAAGA ACATACCAATCTTCGCACTTATAAAACAAGTTCAGATGTATGCTTGCGCA CATGCTCACGATTCCTAGGTCTTTCCAGGCAAAGACTGATAATTTAAGAA GATTTAAGATTCAAGTTTAGATATCTAATTTTGTATTTCAAAAGAACTTT CGGATATTTAGTTTTACCTTTAAAAGCCTACCAAATGCTACAAATCAATC AGAGtttccaattttcaattttgaatgtgGCAACCAAAATAAGTTGTAGA ACCGTGTTGAAAAAGGACAACAGAATCAGTAATACTTTTGATTAGATGCT TATGCTCTTTATATCATCAACTTTCAACTCAGGTGTTGCAGCAGATGGAA AAGCTTTCACTGATCCTGAAGTTCTGCGTCGACTAACTTCTTCAGTTAGC AGTGCACTAGATGAAGCAGCTGCAGCACTGACAAGAATGAGATCACAAAC AGGGAAACCAAATGCAACAACTTCGCAATCTGAGCAAGGTAAAAGCTACA AGCTCTCCTTTAtaaaagcattttctttttgaattcagACATTTCTTAAA ATCTAAGTCTACAATCAGACATTCTGTATCCAGATTAACCAGAGCTAGTT GCATCATTGTATGTCACTTAGGAAACCTCCAGCAGAATAAACAAAATTTC TCCCAATATTTTCTATTGTATTAAACTAGCCTTGAACTAAATTCGCTTTG ATCGCTGTTATTTTGAGTAATTAAATGTAAAGAaacgaacaaaaatattt tcctttttaatgcTACCCTTCACGCCGTAAAGAaacgaacaaaaatattt tcttttttaatgctACCCttccaaaaattgtaaaaaataatggtgaaatt ttaaagccttttttatgaaaaaataggagaaaaagtgccctttttgaccC CTAGCGGACGCTGCTCtgcatttttaaaatttggccTGTGAATGGAACat taattaattaaaataatttcctgtatttcccaaggaaaataatgcagggt tcgaattatagctcCGCACTTTGCAAAATGTGAAGTAAATTTTAGATTTA GCGACCCAAAAAGATTTCCCAACTTCGTAACTTTCTTAACTCGTTTATTt gttgctttatcaactcgctacctTGCAActttattcattcatttatctat tgctttcTATCAACTCTATACTTTGCTTCATCTACAATCTCTTACTTCAC ATTTCTAGAGAAATGTATTGAAGATACTTTtgcattttcttccaaacaac atcgcaaaatactaaaaatgcttcgcaaacattgaaaaaatgcGACGTTC CGTTTTTTACCTTGCTTCGCTCGGAAGAATAGTGAAGCTCTTTAaatcta taattcgaaccctgtgTTCCAAGGAAAATAATGTAGAGAAAATTTCTTAC ATATTTGAgggaaattaaataaaaacaaatttgttgtattttcataggaa aattaCCTGAAACAATTTCTTGTATTTGTAATTGACAAGGACCTAAAGCC TAAAGCAAATTATTGtactttccaaggaaaatcaacCAATAcagtttctt gtattttccaagaaaattacATTAGACAATTTTTATATATTCTATGAAAA TTaactaaagtaatttttttgctactttcaccaagctgatttttcaaaaa aaatcgctCTCTGtcttaaaaaaagataaagaataGTTATTTTGAAAGct tcaatcaaatcaaaactgccATTTTTAATCTATTTGCAAGGAAAGAAGAt ctatataatataaaataaaatctaccATAATCAAGAGTGTCGTGTAAAAC TATTCTCATGCTTGGAGTACATTAGCCATCGGGCATAGACATTTGAGGGT GACTTCGAAAGACTTTGAatagctttgaaaatttgaaattaagatatttc aaaatgaaaaggaaACAGAAAACGAGTGCTTAATTTCGAAACGCTTTTAg aaatgttcaaaaaagaagattagaaaaaaaagaaaaattatagttTCAGG GCTTTCATTTTAAGGCTAGAAATTGACCAATTGAAAGATCAATACAGAAA AGGCACAAAAAACAACTGCCGAATGCTTAAAAATTGCTAGCAAAAATGct tcatgcgagaatgggagagttcaGATTTCAGCGTATTATGATATAGAAGC TTAACAACCATCCTTCATGTAATAAGGTTTCTTGACAAGAAGGCTCTGCT ATTTTGGTTGATAGATTATCcagcttttttataaaattctttttcagGCA CCCGTAGCCTTGTGGAGGCTTGCATTGAAGGAGATATAGCTGCAGTTCGT AAACTTTTAGATGAAGGAAGAAGTGTACATGAACCAACTGATGAAGGAGA AAGTTTGTTGTCATTGGCTTGNTTACCTTTAAAAGCCTACCAAATGCTAC AAATCAATCAGAGtttccaattttcaattttgaatgtgGCAACCAAAATA AGTTGTAGAACCGTGTTGAAAAAGGACAACAGAATCAGTAATACTTTTGA TTAGATGCTTATGCTCTTTATATCATCAACTTTCAACTCAGGTGTTGCAG CAGATGGAAAAGCTTTCACTGATCCTGAAGTTCTGCGTCGACTAACTTCT TCAGTTAGCAGTGCACTAGATGAAGCAGCTGCAGCACTGACAAGAATGAG ATCACAAACAGGGAAACCAAATGCAACAACTTCGCAATCTGAGCAAGGTA AAAGCTACAAGCTCTCCTTTAtaaaagcattttctttttgaattcagACA TTTCTTAAAATCTAAGTCTACAATCAGACATTCTGTATCCAGATTAACCA GAGCTAGTTGCATCATTGTATGTCACTTAGGAAACCTCCAGCAGAATAAA CAAAATTTCTCCCAATATTTTCTATTGTATTAAACTAGCCTTGAACTAAA TTCGCTTTGATCGCTGTTATTTTGAGTAATTAAATGTAAAGAaacgaaca aaaatattttcctttttaatgcTACCCTTCACGCCGTAAAGAaacgaaca aaaatattttcttttttaatgctACCCttccaaaaattgtaaaaaataat ggtgaaattttaaagccttttttatgaaaaaataggagaaaaagtgccct ttttgaccCCTAGCGGACGCTGCTCtgcatttttaaaatttggccTGTGA ATGGAACattaattaattaaaataatttcctgtatttcccaaggaaaata atgcagggttcgaattatagctcCGCACTTTGCAAAATGTGAAGTAAATT TTAGATTTAGCGACCCAAAAAGATTTCCCAACTTCGTAACTTTCTTAACT CGTTTATTtgttgctttatcaactcgctacctTGCAActttattcattca tttatctattgctttcTATCAACTCTATACTTTGCTTCATCTACAATCTC TTACTTCACATTTCTAGAGAAATGTATTGAAGATACTTTtgcattttctt ccaaacaacatcgcaaaatactaaaaatgcttcgcaaacattgaaaaaat gcGACGTTCCGTTTTTTACCTTGCTTCGCTCGGAAGAATAGTGAAGCTCT TTAaatctataattcgaaccctgtgTTCCAAGGAAAATAATGTAGAGAAA ATTTCTTACATATTTGAgggaaattaaataaaaacaaatttgttgtattt tcataggaaaattaCCTGAAACAATTTCTTGTATTTGTAATTGACAAGGA CCTAAAGCCTAAAGCAAATTATTGtactttccaaggaaaatcaacCAATA cagtttcttgtattttccaaggaaaattacaTTAGACAATTTTTATATAT TCTATGAAAATTaactaaagtaatttttttgctactttcaccaagctgat ttttcaaaaaaatcgcTCTCTGtcttaaaaaaagataaagaataGTTATT TTGAAAGcttcaatcaaatcaaaactgccATTTTTAATCTATTTGCAAGG AAAGAAGAtctatataatataaaataaaatctaccATAATCAAGAGTGTC GTGTAAAACTATTCTCATGCTTGGAGTACATTAGCCATCGGGCATAGACA TTTGAGGGTGACTTCGAAAGACTTTGAatagctttgaaaatttgaaatta agatatttcaaaatgaaaaggaaACAGAAAACGAGTGCTTAATTTCGAAA CGCTTTTAgaaatgttcaaaaaagaagattagaaaaaaaagaaaaattat agttTCAGGGCTTTCATTTTAAGGCTAGAAATTGACCAATTGAAAGATCA ATACAGAAAAGGCACAAAAAACAACTGCCGAATGCTTAAAAATTGCTAGC AAAAATGCTTCATtcgagaatgggagagttcagatttaagcgtattataa tatagaaaGCTTAACAACCATCCTTCATGTAATAAGGTTTCTTGACAAGA AGGCTCTGCTATTTTGGTTGATAGATTATCcagcttttttataaaattct ttTCCAGGCACCCGTAGCCTTGTGGAGGCTTGCATTGAAGGAGATATAGC TGCAGTTCGTAAACTTTTAGATGAAGGAAGAAGTGTACATGAACCAACTG ATGAAGGAGAAAGTTTGTTGTCATTGGCTTGTTCTGCTGGtaagtgtttt ttctttataatattgAAATGCTCACATGTTCAAtctctcttttattttga ttcttttgttGCTGGTACTTTGAATCTGTTAtacaatatataaaaaatac attaaacacaatttttgtttctttctgtAACGGCTTGTTCAATTGTATTT GAATTCTTGAAAAGGTTGCACCTGAtgaaaactattttttatttaattgc aagGTTACTACGAACTTGTACAAGTGTTACTTGCAATGAACGCCAATGTT GAAGATAGAGGTAGTAAAGGTGATTGTACTCCTCTCATTGAGGCTGCCAG CAATGGTTTTGTTGACATTGTAAAACTTCTTCTTCAACATGGAGCCAATG TCAATGCACAATCATCTGCTGGAAACACTTCACTTCATAAAGCTTGTGGT AGTGGATATGATGATGTCGTTGAACTTCTTATACAACACAATGCAGATCT TGAACATCAAAATGAAAACGGACATACTCCTCTGATGGACGCAGCTAGCA ATGGTCATGTCAAAGTAGCCAAACTTTTGCTTGATGCAGGTGCTGGAATT AATACACACTCAAGTGAATTCAAAGAAAGTGCTTTAACTTTGGCCTGCTA CAAAGGTATGTTTTATTTAGTTACTTGCATTTTCTTGCNAGAatggaaaa tatataaaaaatgcTGCTGTATTTACAAATTCGAGGTCGACATGACGCGC CTTAATAATAATTGCATTTTTGAAAGACAATAAGATTTCTTGTTTTAAAA CTGCACGAAATCCCTCTTTCATACTCGAATCAACCcctggcaaaatttga gaaatttttcataNAAGCAATGGTCATGTCAAAGTAGCCAAACTTTTGCT TGATGCAGGTGCTGGAATTAATACACACTCAAGTGAATTCAAAGAAAGTG CTTTAACTTTGGCCTGCTACAAAGGTATGTTTTATTTAGTTACTTGCATT TTCTTGCTTAGTCTCTTAGTNtaagctgaacgcatcataagccctttgga taGTAAAGGGGAAACTATCCCAAAGAACATTATAAACataaatgaatttt attcttcAGGGCATGTTGATATGGTTTTCTTTTTATTGGAGAGAGGTGCT GACCAAGAACATAAGACAGATGAAATGCACACAGCTTTGATGGAAGCATC AATGGTATCTACTTATCTTTCATCTTGTTATctataaaaagtttttctgt tCTCAACTtaagttgagctagaatctgtctgtctgtctgtctgtctgtct gtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgtctgt ctgtctgtctgtctgtctgtctgtTTGTCTGTCACAAAGattttagggca gcctggagacttcaaaaatgattgaatttggctgaaattttgcacacttg ttccttgggtgaatatttgtggattctttttttcatttttcaaaaatttt tatttgttggGTCTGGGTActaatcttttgttttttttgctacaATCGGG CCGGGGGCCTATGGATAATTTGAAGTATCTGAAGTTAAATTTTCATCGGC CACTAATTAGATAGGCTCCTGTTTTGTTTTACAAATCTCCATTGTATATT AATTACATTGAAAGTACTCAATGTTTTTCAAtgtttctttttggacctac cccggtggaggtcctataaattaacctttgtccgtccgttcgttagttac cagcttttctcgagattgactcattagttttttctgattttttgcacaaa gatgtgtaactataaaccctcgaatgtgacggagcccgattttcgaaaaa atttttgggcaaatttgggccaaaaaacggctaaaaaacggtttttttgg acttcgtgaaaaattggtttattaattttttctgattttttgcatgaaag tagggtactatcataggtaaaagatggctcgagcagatttttgcaaaaaa aatttgttggctcaaaaaacgcatgtttatctataagaatcactattagt CATGTCATACATCAATTAGTCAagttactgaatttttttttgtgtggtag atatttttttgctcacgagggcttacttttaaagaataatgtgtgtttag acatgaaattttggttgcttggtgtgtttttatagaaaaaatggccaaat tcgatatttttttataagcacattatcaattacttaggtattagcttttc tcgagattggctctttcattctttatgatttttcgcacaaagatgcataa ctataaaccctcgaaggtgacggagcctgattttcgaaaaaaatgttttt gggcaaatttgggccaaaaaatggctaaaaaacgagttttttggactttg tgaaatattggatcattgttttttatcagatttttttgcatgaaagtagg tatagaaagaatttttctgctcaaaaaaacgcatctttatctataagaat tactattaataagcatacatcaatgttcttagccaaattactaaattttt ttatgagatagatgtttttttgctctcgaagtcttgaatatgaaagaata tttcaagagcatgacattttggtttctaaacgtttttttataagaaacaa acgactaattttaatagatcgtcactatttgtgttctgaataattgttta acggtcatgcccacgtagatatcaattatatatgtgttaaatgcataacc tggtaggtccataaaagtatcacttgtatTTTTCTAGGATGGACATGTGG AAGTTGCAAGACTACTCTTGGACCATGGAGCTCAGGTATGATTTCTCAAT CATAAAATAGGAAcgaccaggggggggggggcaagcagttaATACACAac ttagtaccgtggtgggtccttttctgaaatttgcaaATTGCAGTTAATAC ACCAGTGTATTAACTGTCAAAAGGGGTGGTGTTAAGACAATTTTAGAACT CAAAAAATGTATTAACTGCCTACCAGACCATAGTTTGGCACTTCCTATAA ATTTAAAACTAAGCAACCATGCAACTGGAAAAcctcaaaatctttttctg cttactcaaaatctaaaaattttaactgTTGCATTGCTTAGGTAACTGTC TGACAAGGGATTTGCACCCCGACTTACAAAAACTTTCTAATGACATAAAT ATGTGGCATAAGTAGTCTCAAAACAGTTAAAACCCCTTGTATTGTATCAA ATTAACAGGAAAATACACGGTGGACCTGCATGGGACGGTTTGTCGGCCGC TGCAAACTCACTTTGGGGGTGGTGTATACATTTAATGGGTCAAAAACAGT TAATACACAGTGTACTAAGTGTCAAGGAATGGTGgtccttttgaaaaatt ccaaaaagcaTTTAATACACAAAGTGTTGTGTATTAACTGCTTGTCCCTC CCCTGGAACGACATTTTGTAAGTTTACATTGATAAATTCATCATCTTGCA AATTTGAATATTTcgcttcctttttctttctataGGTGAACATGCCGGCT GATAGTTTTGAATCCCCATTAACGCTTGCAGCATGTGGAAGTCATGTTNT CCTTTTTCTTTGTATAGGTGAACATGCCGGCTGATAGTTTTGAATCCCCA TTAACGCTTGCAGCATGTGGAAGTCATGTTGAATTAGCTGAGTTGTTGAT TGAGCATGGTGCAAACCTTGAAGAAGTCAACGATGAAGGGTAAGCTTGTC TCTTTGTTTTCGTTAAATTAACTTTGATAGTATATATAAGAATCTTCAAA Ctcggatttaaaaaaaactaatgatgctttttatgttttgtagccttttc tttcttattatgTTAAACTATTGTGCTAGTAATGTACCTTATTATCTATT TCTTAAGGTTCACTCCACTAATGGAAGCAGCTAGGGAAGGATACTTACCA ATGGTGGCTTTGCTTTTAGCACATGGTAAGATAATATTCCAAATATCCGG CATGACTCAGAGAAATTACTTTTGACAATAGTAAGGTAAACTTTTTGCAA GTAGTAAATTTAGCTATGGACCGAAAGTTATAATAATTAAGTTCCAAGTT TGCTTGAACTTTCTGTtaccaacttattactaaaccatgaatttcatttt ttctatttgcAGGAGCCAACTTGTATGCTCAGACAGAAGAGACACAAGAA ACAGCATTGACACTTGCGTGTTGTGGTGGGTTTCTGGAGGTGGTGGCTTA CCTTTTGGATTGTGGTGCCGATATCGAACTTGGTGCATCTACTCCTCTCA TGGAAGCAGCTACTGAAGGTCATGTTGAACTTGTCAAATTTCTTATTGAG AAAGGTAACCTTCAATTTAATTGTATCTTCTACTTCTTACTTTTTTCCTA TCTTTTCTACGTTTCGCCAAATCTAACGGTGTTAACCCATcctgaaaaca tgaaaaaatcaaatcttaTATTCCcgttggaggtcctataaattaacctt tgtctgttcgtccgttcgtctgtctgttattagcttttcttgagattggc tcattagtttttttcagatttttggcacaacgatgcaaaatggcaattcC CGAAATGTgccggagcccaattttcgaaaaaaaattttccagccgAAAAA AACTGGAAGTATGCCTTCATTATATTCTTTTGTTcaaggtaggtccaatc agTATCCACTTGTTATCAAGATAGATCTATTCTAACACGATTTTGACTTA TTTCTAGGTGCAAACGTGAATGCCATCACAGCTACAGGTGATGCAGCATT GACATACGCTGCAGAAAACGGTCATACAGACGTAGTAGAAGTATTGATTG AACAAGGTGCCAACATTGAACATGAATCTGAGGGTGGTCGCACTCCTTTG ATGAAAGCTGCTCGTGCGGGACACCTTTGCACAGTGGAATATCTCCTCAG TCAAGGTACCAAAATGTTTCATCATAAATCATGAATCGTTATCCATCTTT CAATTATCAACGTAAACTTAAAATCATTCTTGCCATGCTGATATAGATGA TTATAAATATTTGCTATTTTAGGGGCCGACGTGAATAGAAAAACCAGCGG TGGAGAGCATTCTGTTTTATCATTAGCATGTGCTGGAGGCCATACCGCTG TTGTCGAGCTCCTTCTTGGTAGAGGTGGTAATCCTACTATGAAATTAAAG GTAAGCTTAATTGTGCCACTCTCCTAACTtcttgaaatgaattttttcaa gAGTTGTTAAGTTTATGAATCTGAAATTGTAAATATGTTCTTTTTTAGGT AAAAAGTCTTTTAAAATGAATCAAAAGAGGTagtaaagtctaattttctc aacTCAATTTTTATTCGGCTTCTTTTATTTCCAGGACAATTCAAGTATGT TGATAGAAGCGGCCAAAGGTGGTCATGCTAACGTAGCCCACCTGCTCATG AACACTCAAATACATCAACAAACCTTCACTCAAACCGATACTTTACATTC TGAATATCCAATACATTCAAGCGCTTTACCAACGGACAGCGCTTTCCCTA TCTGTCCACACGTTCAACACGAGCAAGATCACATCGCGCATCAACCAGAT TGCCATTTTCATAATACGCCTGAAAATCAACATTTTGCTCATGACTTTTC ACAACAAATCATTCAACCGTCTCCGCCTTCCGATCACTTTCAACAACAAC ATCCGAACGATGAGTTGGACGACGAGAATTACAACAACAATATCGATGTC AACACTTCACCAACTGATCTTTATCTTCCCAACATACCTGTCTCCCTCGC TTCTTCTCTCTCACTCGCCAACCTTACAACTGCCGATCTGCAACATTTAG CTCAGGTTTTACAATACTCTTCGAATCAAAATCAAACGCTTGAAGACGTA GTAGCGGCTGGTCAAAATGCTGAACAGATTGGTTTACAAACGATTACTTT CCCTGCAATCGACCCTCAAGTGGAGAGTTTCACCACACAATCAGAAGTGT GTACACCATCACCCTCAAACACGGCAACTGCTCTCGTTACAAGTGCAGGA CGAACCATCACTTCAACTGGCGTGCAAACTGAAGATGCAATTTCCATGAT TCAAAAACTTACCAACAGTGTCCATCAGCTGAACGCTCTACAGACATTCG CAGCATCCCACAATTTGGAACTAGTGAACCTGGGTGAGATTACACTACCT CCAGCGCCTTTCCAACTTGAAACAGAAGCGGAAGAAGGGATCATGGTAGC TGATTCTGCACGCACTCTACAAAACTCCATCAACGGCATGGTTCGCGAAG GTATCACTAATTAGAAatctatttatttttgttatatcCAGTTTATGTCG TGGTAATATTCGCAGCATACtgtaatattcaaaattttgcgCGTGTGTCT TGGACCAAAATTTAAATAGAGTTGTAAGACTTTTCAATACtacaatttaa aaatttatattttcagatCCGATCGGTGAATGCAGCTCTTTACCGATCGG TGAATGCAGCTCTTTACCATCCATCGAAACGACACTTCCAGTACCGGCAC AATCTCCCGTCACACCTCCCCTCTCACCAGCCATCGATATCGACCAAAGT ACGGACAGTAATCACGATACGGCGCTCACTATCGCCTGTGCTGGTGGACA CGATGAACTTGTACAACTTCTGCTGGCCAGAGGTTCCAACATTGAACACC GCGACAAAAAGGGTGAGAATCTTCTATTTACAATTACAGATTGAATTGAA TCTTTAAATTTTGCTAAAGAATTATGGCTTATTACTATTTCTTATTTCCA CAGGCTGCACGCCATTAATCCTAGCGGCAACAGCAGGTCACACTGCCACA TGTCACATTCTTCTCGAACATGGAGCAGACATCGAAGCACAATCAGATCG AACCAAAGACACTGCACTTTCCTTAGCATGTTCCAGTGGTCGCCAAGAAG TTGTCGAATTACTCCTCATGTCCAATGCTAACTTTGAACACCGAAACGTC TCTGATTACACGCCTCTCAGTTTAGCAGCTTCGGGAGGGTACGTTGGTAT CATCAAAGTTCTGTTGAACCATGGTGCAGAGATCAATTCACGCACAGGAA GCAAGCTGGGCATCTCTCCCCTCATGTTAGCGGCAATGAACGGTCATGTT GCGGCTGTCAAACTCCTCTTGGATCGTGGCAGTGACGTCAATGCTCAAAT CGAAACCAATAGAAATACAGCTTTAAcgttagcatgttttcaaggGCGAA CGGAAGTTGTTGGTCTGCTTTTAGACCGACATGCAAATGTGGAACACAGG GCCAAGGTAagattcaaaaagtcaaagtcaAGTTTTCCTTTTGATACATT ATGAAATATATCCACTTGCCTTACTGCTTTTTTCCTAAAGATAAATTCCG AAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttttt cagatttttggcacaacgatgcaaaatggcaattcCCGAAATGTgccgga gcccaattttcgaaaaaaaattttccagccgAAAAAAACTGGAAGTATGC CTTCATTATATTCTTTTGTTcaaggtaggtccaatcagTATCCACTTGTT ATCAAGATAGATCTATTCTAACACGATTTTGACTTATTTCTAGGTGCAAA CGTGAATGCCATCACAGCTACAGGTGATGCAGCATTGACATACGCTGCAG AAAACGGTCATACAGACGTAGTAGAAGTATTGATTGAACAAGGTGCCAAC ATTGAACATGAATCTGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTCG TGCGGGACACCTTTGCACAGTGGAATATCTCCTCAGTCAAGGTACCAAAA TGTTTCATCATAAATCATGAATCGTTATCCATCTTTCAATTATCAATGTA AACTTAAAATCATTCTTGCCATGCTAATATAGATGATTATAAATATTTGC TATTTTAGGGGCCGACGTGAATAGAAAAACCAGCGGTGGAGAGCATTCTG TTTTATCATTAGCATGTGCTGGAGGCCATACCGCTGTTGTCGAGCTCCTT CTTGGTAGAGGTGGTAATCCTACTATGAAATTAAAGGTAAGCTTAATTGT GCCACTCTCCTAACTtcttgaaatgaattttttcaagAGTTGTTAAGTTT ATGAATCTGAAATTGTAAATATGTTCTTTTTTAGGTAAAAAGTCTTTTAA AATGAATCAAAAGAGGTagtaaagtctaattttctcaacTCAATTTTTAT TCGGCTTCTTTTATTTCCAGGACAATTCAAGTATGTNAATCAAATCTTAT ATTCCcgttggaggtcctataaattaacctttgtctgttcgtccgttcgt ctgtctgttattagcttttcttgagattggctcattagtttttttcagat ttttggcacaacgatgcaaaatggcaattcCCGAAATGTgccggagccca attttcgaaaaaaaattttccagccgAAAAAAACTGGAAGTATGCCTTCA TTATATTCTTTTGTTcaaggtaggtccaatcagTATCCACTTGTTATCAA GATAGATCTATTCTAACACGATTTTGACTTATTTCTAGGTGCAAACGTGA ATGCCATCACAGCTACAGGTGATGCAGCATTGACATACGCTGCAGAAAAC GGTCATACAGACGTAGTAGAAGTATTGATTGAACAAGGTGCCAACATTGA ACATGAATCTGAGGGTGGTCGCACTCCTTTGATGAAAGCTGCTCGTGCGG GACACCTTTGCACAGTGGAATATCTCCTCAGTCAAGGTACCAAAATGTTT CATCATAAATCATGAATCGTTATCCATCTTTCAATTATCAACGTAAACTT AAAATCATTCTTGCCATGCTGATATAGATGATTATAAATATTTGCTATTT TAGGGGCCGACGTGAATAGAAAAACCAGCGGTGGAGAGCATTCTGTTTTA TCATTAGCATGTGCTGGAGGCCATACCGCTGTTGTCGAGCTCCTTCTTGG TAGAGGTGGTAATCCTACTATGAAATTAAAGGTAAGCTTAATTGTGCCAC TCTCCTAACTtcttgaaatgaattttttcaagAGTTGTTAAGTTTATGAA TCTGAAATTGTAAATATGTTCTTTTTTAGGTAAAAAGTCTTTTAAAATGA ATCAAAAGAGGTagtaaagtctaattttctcaacTCAATTTTTATTCGGC TTCATTTCCAGGACAATTCAAGTATGTTGATAGAAGCGGCCAAAGGTGGT CATGCTAACGTAGCCCACCTGCTCATGAACACTCAAATACATCAACAAAC CTTCACTCAAACCGATACTTTACATTCTGAATATCCAATACATTCAAGCG CTTTACCAACGGACAGCGCTTTCCCTATCTGTCCACACGTTCAACACGAG CAAGATCACATCGCGCATCAACCAGATTGCCATTTTCATAATACGCCTGA AAATCAACATTTTGCTCATGACTTTTCACAACAAATCATTCAACCGTCTC CGCCTTCCGATCACTTTCAACAACAACATCCGAACGATGAGTTGGACGAC GAGAATTACAACAACAATATCGATGTCAACACTTCACCAACTGATCTTTA TCTTCCCAACATACCTGTCTCCCTCGCTTCTTCTCTCTCACTCGCCAACC TTACAACTGCCGATCTGCAACATTTAGCTCAGGTTTTACAATACTCTTCG AATCAAAATCAAACGCTTGAAGACGTAGTAGCGGCTGGTCAAAATGCTGA ACAGATTGGTTTACAAACGATTACTTTCCCTGCAATCGACCCTCAAGTGG AGAGTTTCACCACACAATCAGAAGTGTGTACACCATCACCCTCAAACACG GCAACTGCTCTCGTTACAAGTGCAGGACGAACCATCACTTCAACTGGCGT GCAAACTGAAGATGCAATTTCCATGATTCAAAAACTTACCAACAGTGTCC ATCAGCTGAACGCTCTACAGACATTCGCAGCATCCCACAATTTGGAACTA GTGAACCTGGGTGAGATTACACTACCTCCAGCGCCTTTCCAACTTGAAAC AGAAGCGGAAGAAGGGATCATGGTAGCTGATTCTGCACGCACTCTACAAA ACTCCATCAACGGCATGGTTCGCGAAGGTATCACTAATTAGAAatctatt tatttttgttatatcCAGTTTATGTCGTGGTAATATTCGCAGCATACtgt aatattcaaaattttgcgCGTGTGTCTTGGACCAAAATTTAAATAGAGTT GTAAGACTTTTCAATACtacaatttaaaaatttatattttcagatCCGAT CGGTGAATGCAGCTCTTTACCGATCGGTGAATGCAGCTCTTTACCATCCA TCGAAACGACACTTCCAGTACCGGCACAATCTCCCGTCACACCTCCCCTC TCACCAGCCATCGATATCGACCAAAGTACGGACAGTAATCACGATACGGC GCTCACTATCGCCTGTGCTGGTGGACACGATGAACTTGTACAACTTCTGC TGGCCAGAGGTTCCAACATTGAACACCGCGACAAAAAGGGTGAGAATCTT CTATTTACAATTACAGATTGAATTGAATCTTTAAATTTTGCTAAAGAATT ATGGCTTATTACTATTTCTTATTTCCACAGGCTGCACGCCATTAATCCTA GCGGCAACAGCAGGTCACACTGCCACATGTCACATTCTTCTCGAACATGG AGCAGACATCGAAGCACAATCAGATCGAACCAAAGACACTGCACTTTCCT TAGCATGTTCCAGTGGTCGCCAAGAAGTTGTCGAATTACTCCTCATGTCC AATGCTAACTTTGAACACCGAAACGTCTCTGATTACACGCCTCTCAGTTT AGCAGCTTCGGGAGGGTACGTTGGTATCATCAAAGTTCTGTTGAACCATG GTGCAGAGATCAATTCACGCACAGGAAGCAAGCTGGGCATCTCTCCCCTC ATGTTAGCGGCAATGAACGGTCATGTTGCGGCTGTCAAACTCCTCTTGGA TCGTGGCAGTGACGTCAATGCTCAAATCGAAACCAATAGAAATACAGCTT TAAcgttagcatgttttcaaggGCGAACGGAAGTTGTTGGTCTGCTTTTA GACCGACATGCAAATGTGGAACACAGGGCCAAGGTAagattcaaaaagtc aaagtcaAGTTTTCCTTTTGATACATTATGAAATATATCCACTTGCCTTA CTGCTTTTTTCCTAAAGATAAATTCCGAAGGTAGGGACCTCAAGTTCATT GGAAAGATTTCATTCTTTTCACTCAAACACAAATCTTCTTCGACCATCTC TCATAGACCGGATTAACTCCATTAATGGAAGCAGCATCAGGTGGTTACGT CGATGTGGGTCGTGTTCTGATCGATCGCGGTGCAGATGTGAACGCCATCC CAGTCCCTTCGTCACGTGACACTGCACTCACAATCGCTGCCGATAAAGGA CACTACAAATTCGCCGAGTTATTAGTGGTTCGTGGTGCCGTTGTTGACGT GCGTAATAAGAAAGGATGTACACCTCTATGGCTCTCCGCACACGGTAAGA TACTTACGAACTCGAGTAAAACTTTGACTCGGCTGGTAAGAACTTTAACT AGCGCCGACTAGTAATAAAGAATGGTCGAATTATAATTTGTGCATTTTTT CTTTACAGGTGGGCATCTGGATGTTTGTCAGTTGTTAGCGCGTGAAGGAG CTGATGTGAACGCCATGGACAATCGAGCAGTCTCTGTTCTCGTAGCCGCG TTCAGAAAAGGAAACATCAAAGTGGTCAAGTGGCTGGTCAAACATGTATC ACAGTTCCCACCTGATTCTGACTGCAAACGTTTCATTCAAACCATCTCTG ATAAGGTTTGTGAAGATGTTTGGTACCAAAAGTAGATCTTTTAGATAAAG AAATTTGTTGAGTGGGTCCCTTTATGAGTTTGACTTTGGATTaatgattt gaaatttcttctttctcaaTAGGACTTACTAAAGAAATTAGACGAATGTA TGCAAATCATCAACGCGGCAAAGAAAAGACAAGAAGCAGAGGCGAACAAG AACGCGTCCATTCTGTTGGAAGAGTTGGATCATGAGAAAAAGAAGGAGGA GAGGCGGAAAGCGCAAGCTCAAAAGAAACGTGATAAGAAGAagcagaaga aaaagaaaaagagtacGGAGAAGCAGTCTGTGGATACTGAAGAAGATGGC GAGAAAGAAGACGAGGAAGAGTTCGAACATGCAACGAGTGGATTCCCTTT CATCAATGCTGATCAACGAACGCCCTTGATGATCAATGGTACTTTTCTTT ATTGTCAGAAATGTCTTTTTGATATCAACTTTATGGACTGGTGGAAACTT TTTAGGAACCAGTATAGTATAGTTCGTAAGAGGGACCCGAACCTCcctta ttttgaaatcttttaaagTCTACACTTTTTGCAGGGTTAAATCTTTGAGA TCTAATATCAATCGCCTATTTCATCCAGGAAGACTTCCATCTGCACACTA AAAAGGTACCTGATAAATAGATATGAATATTTCTTAtatatttctaatat ttttcaCTGGCATTGTTTTAGACGAACGACCCGATCTTTCGACTGCTGAA TTGAAACTGAAATCTCAAGTTCAACTGAAGAGCAAGAAGAAGAGCCGTCT AAAGAGTCGCAACTCCTCTCTCAGCAAAAGTACGGATGAAGAGAAGGAGA TGGCGGACAAAGATGTGGAAGATATCATAGATCCCGTATCCACCGCCATC GATGCTCTGACCAACATCGTTATCACTACTGCTGCTCAATTTGTATCCTC TATCAAGTAAGAATTGTGGTACAGTGTTGTAACTTTTCCGTctgtagacg aaaatccgtccaGTTAAGATAAAAACACACAATTTCCGTCTTGCTAGCAA GAGGCAAATGATGACCCACAAAACCAAAGATTGATTTTGTttatattcaa aaaagtttttcaacatTGATACACTATTCCACTATTTCCATTGAAAATAA CGAGTAAGAACTTCAATCGGGTTATCTCACAATTtcatttatattatttt ttacagACCAACAGACACAGTGAGTGCGGCAACAGTAGCTGAAATCACCA AAGCTCTTGCAGCTTCCATCATCACTAACGCTAAAGACAATACTAAGACC TCTATCCCAGATGAGGTTGCTGTTACTATGGCAACGGCTGCTGCTCAACG TGTGGCGGTCAGCATTTCTTCACCTTCGCTACTAAGCAACAATAATAACA ATGGATTTGCGCTTAACACGAGTCAGAAGAAAGCAAAACGAGTTGACGAC GAATGGAAAGAGGTCACTCGAAGGTtggtatttttttaataattgtgATA CAATTGGGAGGGGTAGGTACTGGTTTCTCAGACATATAAGAGTACTAGAA GGTTTTTGGGAAACTTTGCATACAACCAAACTTATTCAGAGAAGTGGTAT TTAGGTTTTAGTACAGATTTTCCTAGACACCACCCTATTTTGATCTTCTC GGGACAGATTTGGctgaattcaaaataattggGACTTTTTAAAAAGGAGg cgaaaaatgttcaaaaaatgataaaaacactAGTACTTATACAGggtgtt cttgtaaaaaagtaCCGTAAGTAGAAATACATTACTTTTGTGTATATGAC AAAGATTTTCTGTATGCCACCAATCATCGCCAATCACCAATCATAATCAT ATGATATTCACTTCACCACTTTCTTCATTTCAGCATTCCGCATACGAAGT CAAGGAAGATCTTGATACCAGCCGCCTTGATCAGTCGCGTTATCGGTCGT GGTGGGTGCAACGTCAACGCAATACGTGAACACACGGGAGCACATATCGA CATCGATACAAATCGAAAGAAAGCCAACGGTGATTGTATGGTCACCATCA AGTAAGGAACTTTTGAACATTTCATTCATACAATGTCCTTGACGTTTACA ACTTGTCTCGTGAAATGAATTTGCTGTCTTTTTAAGATCCGATCAAATTG GAATCTAACAAATAATTTTGACTTCTGGATTTCATATTTGAACACAAGAA AATGATTAGGTCTGGATGAAGCCATCTTCACTACAGCAATTATTACACAC TCTATAAAGGTGgagaataagaaaaaaatacttaGCTATCCTCTGAAACA AttattttctctcaaaattcaGGGNCAGGTGgagaataagaaaaaaatac ttaGCTATCCTCTGAAACAAttattttctctcaaaattcaGGGGTTCGCA ACAAGCTACGAAACAAGCAGGGAACTTGATCCAATCTTTGATCGACGATC CCGATAGCAACGTTGCGGAAATTCTCCCTACACTTCCTACTATTGCGACG TCTCTGTCTACAAGCGTCTCATCTTCTTCTCTCATTCCTCTCATGAAAAA CCTCACCAAACCCACCACCATCGAATCGTCTCTCGACAttccaaaaacaa ttcaatcACTTTCAAAATCACTTAACACGCCCAAAACTAGCGACAAAATA CCGACGCTTCGACAAATCTCGGCACCAGCAAATTTGGTGCCTCCTACATC GACACCTTCTTCTCAACCAGTACGAATGGTTCCTGTTGTCAACTCGAATT CCAAGAAACTCGAAGTCGCCAAGGAATCTTCGGCGCCGTCTAGAACGAAA GTGAAACCTCCTGCGCTCACTACAACCACACCAAATAGTGGATGGAAGTC CACTAATCAACAAGACACCAACACCGTGCTAAAGCAGACGTCCTCAACGA TGGCTGTCTCTACTCGCTCACAGGTGTCAGTGACACGGCAATTATCGAAT GAAGGGAGCCAAGTGCACCAACAAATTATAACGACCATCAGTACAACAGT TTTCTCATCCTCTTCTCGTAATCTTCCCAAACCCATCGGTAGCAATCGAC CCTTTCGACCAATCGCTTCTCCCACTAATGCTCTCTCGTCAACAGCTGTG TCGAATTCAGTGGCAGCCACTCTTCATTCGACATTAAACAGTCTACTTTC GCAGGTGGCGACACAACGCAGTCCCATGATATGGAACGATCATCCAGGTT CGAAGGAGCACCATGGTAGCAGTGGTGATCTGGTGGTGACGACAGTAGCC ACCTCACCCAACAATACGCTAAACGGAACGCCCATTGAACGATTCTTACC CGCCTCTCTTTCGCAAGCTTCTTCACAGGAATCGTTCAAAGGTCACTCGA GAACACCTTCACTATCTCCAACTTCTAACCACTCCAATTCACCGACACCA GAAGAAAAACCCCACCTCAACCCCATCGGTAGTGAAAGAGGTCACAAGAA ACCGACTGTAAACCAACAGGGCGGCTTGCAAGGTCTTACCTCGCTACTAC AAGGTTATTTCAGATTTATATTTTAATATGTTCAGTCCCCTTTGTGATCG ATATGATTTTATCTTTATCTTTTACGTGTATTTCTTTAAAGTATAATTCC GGCAGTTACTGTCATATAATGCAATATCATTAATTCTCTCTTCTTTATGG GTTTAGGATCCGACAGTGGGCAGAACTTGTGGCGTTTTGACTACAACATG AGGAAGTCACCTTCGTGGAAGCCAAACTCGTCTCCTGTCGGGTGGACTGC ACCCAACGAACAAGCGaaggaaatgaaaccactgctAGCGAATGGCGATA TGGAACACCATCATCCTTCGGTTGATCACGTCATCGGGCCTGATGAAACA CTGCAAAGTCTTCTCGAACGCCTCTCATTGTCCACTCATCTCAATCTTTT TCAGGTAAGCAGTTGCTTCCAAATTGATGCCTCATACATCTTGTTGTTAT CCAACGTTTGCTTCACAATTGACACGCAAACTTTAAGTCTTCGTTGCTTC TATTGAATTTTCATTTCTCTTCTCGTTTAGAAAAACGAAATTGATTTGGA TGCGTTGATGTTGATGTCGGAACAAGACTATGCGGACATTGGTCTTCCGA AGGAACCACGTATCAAGTTGTTGAACAGCATGCGACAACTGCAAAACAGA TCCACTGCTCACGTCCCTCAATCACCGCCCCAACAAATACCATTACTGAA GCACATCAATCCACAGCCGCTATGGAATTCTGCAATGGATAATAACTTAC ATCACCCTGAAAGCCGGTTACCACCCGCACTTCGGAACAGTGTTCATTTT CCTGGAACACCACAGCTTGCTGTAAGACactttaatcaaactttgtgtAT TTCATGTCGctcttttccatttttttgttgCTGTTCGTTGTCTTTGGTGA CTATCACTAATTTAATACTTGTGAGGTGCCTATGATTGCTCAAAGCTGTG TCACGCTGGTGCATTGCAATCTTCAGAAAATTTAAGTGCGATACTAATGA TTCTATTTGCCCGTGttcactttgcaattttttacaaaatatttcctAAA TTCTCCTTAGGCTTCCTGGCAGACGTGGAGTAACACTATCGATCAATGAA ACGGTGAGTCATTCATTTGCAGGTTCACACTAATACAAACTGCTTCTAAG CACATGCTTTTGAGTTTACATGAGTTTGAAATTACTTATGGAGGTGATAC AATCACCAGTGCTATCTGAACCATAGCAAGGCGAACTAATAAAAGGCGAC TTGGTTCGAGTTTGCGAAGTACATGCTTTTGAACTTATATGACTTTGATC TTACTACCAGTTcaaatcgcagacctctacaaaactaCAGATAGTATTAG GAGCACGACTTTGTTAAAGGATGTGATCAGCCTAACTATTTTgttcttgt tttcattttgacgaacttcttttttactttctcCCTCAGGTATTCGTTGG CAACGGAGTGTAATTGGAAATCAAGATTGTCCctttcattttcattgact GGAATTTTTCATTNTTTACTTTCTCCCTCAGGTATTCGTTGGCAACGGAG TGTAATTGGAAATCAAGATTGTCCctttcattttcattgactggaatttt tcatttcaataatCGTCAAGACGATTCACCAAGACTTCTTCATTTCTTCG TATttcctttgtttacatttgtttaCTTTACCCTTTTATCAGAGATGATA TGATTATGCAGAATTTTAGAGAACAGAATTACCAGAGCCTTTTACTAGAG TCATGTTGGAATGTTAAATTGTAGttgatttatatattatatatcaGAAA GAAATTATGTTCATGGAAAACTAAGTATTTGATACCGTGTCATATTTGAT ACCTTGCCACCACACAATGCACGcactttcttattttcagcCTTTTGGGG A
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000571XLOC_000571Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000951-exon-sc0000007-1491911889:208410..208553TCONS_00000951-exon-sc0000007-1491911889:208410..208553Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:208410..208553TCONS_00000951-exon-sc0000007-1510915933:208410..208553Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:208410..208553TCONS_00000951-exon-sc0000007-1575043694:208410..208553Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:211627..211765TCONS_00000951-exon-sc0000007-1491911889:211627..211765Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:211627..211765TCONS_00000951-exon-sc0000007-1510915933:211627..211765Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:211627..211765TCONS_00000951-exon-sc0000007-1575043694:211627..211765Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:213292..213447TCONS_00000951-exon-sc0000007-1491911889:213292..213447Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:213292..213447TCONS_00000951-exon-sc0000007-1510915933:213292..213447Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:213292..213447TCONS_00000951-exon-sc0000007-1575043694:213292..213447Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:217417..217548TCONS_00000951-exon-sc0000007-1491911889:217417..217548Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:217417..217548TCONS_00000951-exon-sc0000007-1510915933:217417..217548Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:217417..217548TCONS_00000951-exon-sc0000007-1575043694:217417..217548Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:217763..218164TCONS_00000951-exon-sc0000007-1491911889:217763..218164Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:217763..218164TCONS_00000951-exon-sc0000007-1510915933:217763..218164Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:217763..218164TCONS_00000951-exon-sc0000007-1575043694:217763..218164Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:218619..218713TCONS_00000951-exon-sc0000007-1491911889:218619..218713Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:218619..218713TCONS_00000951-exon-sc0000007-1510915933:218619..218713Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:218619..218713TCONS_00000951-exon-sc0000007-1575043694:218619..218713Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:220297..220344TCONS_00000951-exon-sc0000007-1491911889:220297..220344Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:220297..220344TCONS_00000951-exon-sc0000007-1510915933:220297..220344Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:220297..220344TCONS_00000951-exon-sc0000007-1575043694:220297..220344Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:221127..221248TCONS_00000951-exon-sc0000007-1491911889:221127..221248Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:221127..221248TCONS_00000951-exon-sc0000007-1510915933:221127..221248Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:221127..221248TCONS_00000951-exon-sc0000007-1575043694:221127..221248Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:221417..221484TCONS_00000951-exon-sc0000007-1491911889:221417..221484Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:221417..221484TCONS_00000951-exon-sc0000007-1510915933:221417..221484Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:221417..221484TCONS_00000951-exon-sc0000007-1575043694:221417..221484Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:221672..221863TCONS_00000951-exon-sc0000007-1491911889:221672..221863Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:221672..221863TCONS_00000951-exon-sc0000007-1510915933:221672..221863Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:221672..221863TCONS_00000951-exon-sc0000007-1575043694:221672..221863Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:222267..222464TCONS_00000951-exon-sc0000007-1491911889:222267..222464Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:222267..222464TCONS_00000951-exon-sc0000007-1510915933:222267..222464Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:222267..222464TCONS_00000951-exon-sc0000007-1575043694:222267..222464Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:222582..222709TCONS_00000951-exon-sc0000007-1491911889:222582..222709Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:222582..222709TCONS_00000951-exon-sc0000007-1510915933:222582..222709Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:222582..222709TCONS_00000951-exon-sc0000007-1575043694:222582..222709Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:222894..223809TCONS_00000951-exon-sc0000007-1491911889:222894..223809Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:222894..223809TCONS_00000951-exon-sc0000007-1510915933:222894..223809Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:222894..223809TCONS_00000951-exon-sc0000007-1575043694:222894..223809Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:223976..224221TCONS_00000951-exon-sc0000007-1491911889:223976..224221Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:223976..224221TCONS_00000951-exon-sc0000007-1510915933:223976..224221Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:223976..224221TCONS_00000951-exon-sc0000007-1575043694:223976..224221Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:224313..224815TCONS_00000951-exon-sc0000007-1491911889:224313..224815Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:224313..224815TCONS_00000951-exon-sc0000007-1510915933:224313..224815Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:224313..224815TCONS_00000951-exon-sc0000007-1575043694:224313..224815Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:228866..229103TCONS_00000951-exon-sc0000007-1491911889:228866..229103Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:228866..229103TCONS_00000951-exon-sc0000007-1510915933:228866..229103Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:228866..229103TCONS_00000951-exon-sc0000007-1575043694:228866..229103Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:229218..229414TCONS_00000951-exon-sc0000007-1491911889:229218..229414Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:229218..229414TCONS_00000951-exon-sc0000007-1510915933:229218..229414Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:229218..229414TCONS_00000951-exon-sc0000007-1575043694:229218..229414Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:229532..229847TCONS_00000951-exon-sc0000007-1491911889:229532..229847Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:229532..229847TCONS_00000951-exon-sc0000007-1510915933:229532..229847Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:229532..229847TCONS_00000951-exon-sc0000007-1575043694:229532..229847Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:230131..230365TCONS_00000951-exon-sc0000007-1491911889:230131..230365Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:230131..230365TCONS_00000951-exon-sc0000007-1510915933:230131..230365Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:230131..230365TCONS_00000951-exon-sc0000007-1575043694:230131..230365Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:230616..230882TCONS_00000951-exon-sc0000007-1491911889:230616..230882Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:230616..230882TCONS_00000951-exon-sc0000007-1510915933:230616..230882Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:230616..230882TCONS_00000951-exon-sc0000007-1575043694:230616..230882Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:231293..231460TCONS_00000951-exon-sc0000007-1491911889:231293..231460Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:231293..231460TCONS_00000951-exon-sc0000007-1510915933:231293..231460Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:231293..231460TCONS_00000951-exon-sc0000007-1575043694:231293..231460Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:231801..232912TCONS_00000951-exon-sc0000007-1491911889:231801..232912Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:231801..232912TCONS_00000951-exon-sc0000007-1510915933:231801..232912Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:231801..232912TCONS_00000951-exon-sc0000007-1575043694:231801..232912Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:233066..233313TCONS_00000951-exon-sc0000007-1491911889:233066..233313Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:233066..233313TCONS_00000951-exon-sc0000007-1510915933:233066..233313Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:233066..233313TCONS_00000951-exon-sc0000007-1575043694:233066..233313Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:233440..233730TCONS_00000951-exon-sc0000007-1491911889:233440..233730Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:233440..233730TCONS_00000951-exon-sc0000007-1510915933:233440..233730Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:233440..233730TCONS_00000951-exon-sc0000007-1575043694:233440..233730Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:233970..234031TCONS_00000951-exon-sc0000007-1491911889:233970..234031Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:233970..234031TCONS_00000951-exon-sc0000007-1510915933:233970..234031Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:233970..234031TCONS_00000951-exon-sc0000007-1575043694:233970..234031Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1491911889:234441..234810TCONS_00000951-exon-sc0000007-1491911889:234441..234810Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1510915933:234441..234810TCONS_00000951-exon-sc0000007-1510915933:234441..234810Clytia hemisphaericaexon
TCONS_00000951-exon-sc0000007-1575043694:234441..234810TCONS_00000951-exon-sc0000007-1575043694:234441..234810Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:208410..234810 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.219854 2.66014 3.19265e-06 0.0667111 0.0280625 0.00900816 0.000477816 0.0649619 0.0762016 0.0249073 0.072707 0.336458 0.149312 0.00872722 0.000589567 0.011055 0.0471113 0.0415439 0.437263 0.374129 0.988634 0.354041 0.0365764 0.394335 0.0338253 0.00843562 0.000445474 0.582659 1.52376 0.0808361
Blast
BLAST of TCONS_00000951 vs. Swiss-Prot (Human)
Match: ANKH1 (Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1)

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 396/533 (74.30%), Postives = 458/533 (85.93%), Query Frame = 1
Query:  295 DGKAFTDPEVLRRLTSSVSSALDEAAAALTRMRSQTGKPNATTSQSEQGTRSLVEACIEGDIAAVRKLLDEGRSVHEPTDEGESLLSLACSAGYYELVQVLLAMNANVEDRGSKGDCTPLIEAASNGFVDIVKLLLQHGANVNAQSSAGNTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGASTPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1893
            DGKAF DPEVLRRLTSSVS ALDEAAAALTRM+++      + +  +  TRSL EAC +GD+ AVRKLLDEGRSV+E T+EGESLL LACSAGYYEL QVLLAM+ANVEDRG+KGD TPL+ A+S G++DIVKLLL H A+VN+QS+ GNT+L  AC  G+ D+V++L+   A++E  NENGHTPLM+AAS GHV+VA++LLD GAGINTHS+EFKESALTLACYKGH+DMV FLLE GADQEHKTDEMHTALMEA MDGHVEVARLLLD GAQVNMPADSFESPLTLAACG HVELA LLIE GANLEEVNDEG+TPLMEAAREG+  MVALLLA GAN+ AQTEETQETALTLACCGGF EV  +L+  GADIELG STPLMEA+ EGH+ELVK+L+  GANV+A TATGD ALTYA ENGHTDV +VL++ GA++EHESEGGRTPLMKAARAGHLCTV++L+S+GA+VNR T+  +H+V+SLACAGGH AVVELLL  G +PT +LKD S+MLIEAAKGGH NV   L++
Sbjct:  162 DGKAFADPEVLRRLTSSVSCALDEAAAALTRMKAEN-----SHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLD 689          

HSP 2 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 330/492 (67.07%), Postives = 391/492 (79.47%), Query Frame = 1
Query: 2572 NALQTFAASHNLELVNLGEITLPPAPFQLETEAEEGIMVADSARTLQNSINGMV----REDPIGECSSLPIGECSSLPSI-ETTLPVPAQSPVTPPLSPAIDIDQSTDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLVKHVSQFPPDSDCKRFIQTISDKDLLKKLDECMQIINAAKKRQEAEANKNASILLEELD 4032
            N+L+    S N ++V   +I +      L  +  +G+MVA  A+TL ++++ ++       P G  SS    EC +  S  +TT  V +QS   PP+ P++DID  T+SNHDTALT+ACAGGH+ELV +L+AR + IEHRDKKG TPLILAATAGH     ILL+ G DIEAQS+RTKDT LSLACS GRQEVV+LLL   AN EHRNVSDYTPLSLAASGGYV IIK+LLN GAEINSRTGSKLGISPLMLAAMNGHV AVKLLLD GSD+NAQIETNRNTALTLACFQGR EVV LLLDR ANVEHRAKTGLTPLMEAASGGY +VGRVL+D+GADVNA PVPSSRDTALTIAADKGHYKF ELL+ RGA +DVRNKKG TPLWL+++GGH DV QLL + GADV+A DNR ++ L++AFRKG++KVV++LVK V+QFP D +C R+I TI+DK+LLKK  +C++ I  AK +Q AEANKNASILL+ELD
Sbjct:  947 NSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPDGLMVATPAQTLTDTLDDLIAAVSTRVPTGSNSSSQTTECLTPESCSQTTSNVASQS--MPPVYPSVDIDAHTESNHDTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVKEVNQFPSDIECMRYIATITDKELLKKCHQCVETIVKAKDQQAAEANKNASILLKELD 1436          

HSP 3 Score: 209.534 bits (532), Expect = 9.672e-54
Identity = 135/363 (37.19%), Postives = 204/363 (56.20%), Query Frame = 1
Query: 2872 STDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINS-------------------------RTGSKL------GISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVN-AMDNRAVSVLVAAFRKGNIKVVKWLVKH 3864
            S  +  +TALT ACAGG  ++V++LL  G+NIE  ++ G TPL+ AA+AGH     +LL+HGA I   S+  K++AL+LAC  G  ++V  LL + A+ EH+    +T L  A   G+V + ++LL+ GA++N                            G+ L      G +PLM AA  GH   V LLL +G+++NAQ E  + TALTLAC  G +EV   L+   A++E       TPLMEA+  G++++ + L+  GA+V+A    ++ DTALT A + GH   A++L+  GA ++  ++ G TPL  +A  GHL   Q L  +GA+VN A  N   +V+  A   G++ VV+ L+ H
Sbjct:  300 SQSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCS---TPLMEASQEGHLELVKYLLASGANVHA--TTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAH 657          

HSP 4 Score: 199.519 bits (506), Expect = 9.035e-51
Identity = 141/364 (38.74%), Postives = 207/364 (56.87%), Query Frame = 1
Query:  742 NTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIEHGANLEEVNDE-----GFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGAST---PLMEAATEGHVELVKFLIEKGANVNA--ITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADV----NRKTSGGEHSVLSLACAGGHTAVVELLL 1791
            +T+L  AC  G++++V +LI  +A +EH+++ G TPL+ AA+ GHV V ++LLD G  I   S   K++ L+LAC  G  ++V  LL RGA++EH                     R + D+            +PL+LAA G +V + ++L+  GA   E+N       G +PLM AA  G++P V LLL  G+++ AQ E  + TALTLAC  G  EVV+ LLD  A++E  A T   PLMEAA+ G+ E+ + L++KGA+VNA  + ++ D ALT AA+ GH    E+LI +GA+I+  ++ G TPL  A+  GH   V+ L+  GADV    NRK      + L  A   GH  VV+ L+
Sbjct: 1056 DTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEH---------------------RNVSDY------------TPLSLAASGGYVNIIKILLNAGA---EINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKI-----TPLMSAFRKGHVKVVQYLV 1378          

HSP 5 Score: 192.586 bits (488), Expect = 1.321e-48
Identity = 126/357 (35.29%), Postives = 191/357 (53.50%), Query Frame = 1
Query:  541 ESLLSLACSAGYYELVQVLLAMNANVEDRGSKGDCTPLIEAASNGFVDIVKLLLQHGANVNAQSS-AGNTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHSSEF-----------------------------------KESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMP--ADSFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGASTPLMEAATEGHVELVKFLIEK 1497
            ++ L+LAC+ G+ ELV VL+A +A +E R  KG  TPLI AA+ G V +V++LL  G ++ AQS    +T L  AC  G  +VV+LL+   A+ EH+N + +TPL  AAS G+V + K+LL+AGA IN+ +                                      + +ALTLAC++G  ++V  LL+R A+ EH+     T LMEA+  G+ EV R+LLD GA VN P    S ++ LT+AA   H +  ELLI  GA+++  N +G TPL  A+  G+  +V LL+  GA+                            +D   + ++   TPLM A  +GHV++V++L+++
Sbjct: 1056 DTALTLACAGGHEELVSVLIARDAKIEHRDKKG-FTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGAD----------------------------VDAADNRKI---TPLMSAFRKGHVKVVQYLVKE 1380          

HSP 6 Score: 190.274 bits (482), Expect = 6.767e-48
Identity = 119/323 (36.84%), Postives = 188/323 (58.20%), Query Frame = 1
Query: 2896 ALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLLAREGADVNAM-DNRAVSVLVAAFRKGNIKVVKWLVK 3861
            +L  AC+ G    V+ LL  G ++    ++G + L LA +AG+     +LL   A++E + ++   T L  A S G  ++V+LLL+ +A+   ++ +  T L+ A +GG+V I+KVLLN GA I     ++ G +PLM AA  GHV   ++LLD G+ +N      + +ALTLAC++G  ++V  LL+  A+ EH+     T LMEA   G+V+V R+L+D GA VN +P   S ++ LT+AA  GH + A LL+ RGA ++  N +G TPL  +A  GH ++  LL  +GA++NA  +    + L  A   G  +V  +L+K
Sbjct:  208 SLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNTALTYACAGGFVDIVKVLLNEGANIEDH--NENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVN-MPA-DSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIK 526          

HSP 7 Score: 186.422 bits (472), Expect = 8.318e-47
Identity = 122/325 (37.54%), Postives = 194/325 (59.69%), Query Frame = 1
Query: 2890 DTALTIACAGGHDELVQLLLARGSNIEHRDKKG-CTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGC-TPLWLSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLV 3858
            ++ L +AC+ G+ EL Q+LLA  +N+E R  KG  TPL+ A++ G+     +LL H AD+ +QS  T +TAL+ AC+ G  ++V++LL   AN E  N + +TPL  AAS G+V + +VLL+HGA IN+ + ++   S L LA   GH+  V+ LL+ G+D   + +   +TAL  AC  G  EV  LLLD  A V   A +  +PL  AA GG+V++  +LI+RGA++    V     T L  AA +GH +   LL+ +GA ++ + ++   T L L+  GG  +V   L + GAD+   +    + L+ A ++G++++VK+L+
Sbjct:  239 ESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQS-ATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHS-NEFKESALTLACYKGHLDMVRFLLEAGADQEHKTD-EMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEE--VNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADI---ELGCSTPLMEASQEGHLELVKYLL 555          

HSP 8 Score: 163.31 bits (412), Expect = 9.193e-40
Identity = 114/327 (34.86%), Postives = 171/327 (52.29%), Query Frame = 1
Query: 2863 IDQSTDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTGS----------------------------KLGIS-PLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLWLSAHGGHLDVCQLL 3756
            I+  ++   ++ALT+AC  GH ++V+ LL  G++ EH+  +  T L+ A   GH     +LL+ GA +   +D + ++ L+LA   G  E+  LL+   AN E  N   YTPL  AA  G+  ++ +LL  GA IN++T                              +LG S PLM A+  GH+  VK LL  G++V+A   T  +TALT AC  G T+V  +LL   A++EH ++ G TPLM+AA  G++   + LI +GA+VN     ++  T +++A   GH    ELL+  GA    R K G T L  +A GGH +V   L
Sbjct:  364 INTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPAD-SFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLASGANVHATTATG-DTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRA-TANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYL 687          

HSP 9 Score: 154.836 bits (390), Expect = 3.734e-37
Identity = 120/369 (32.52%), Postives = 177/369 (47.97%), Query Frame = 1
Query:  916 INTHSSEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPAD-SFESPLTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADI------ELGASTPLMEAATEGHVELVKFLIEKGANVNA-ITATGDAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVN-------RKTS------------------GGEH---------SVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSM--LIEAAKGGHANVAHLLM 1890
            I+ H+    ++ALTLAC  GH ++V  L+ R A  EH+  +  T L+ A+  GHV V  +LLD G  +   ++ + ++PL+LA  G   E+ +LL+  GAN E  N   +TPL  AA                                   GG++ ++  LL+ GA+I      +LG S PLM AA  GHV  VK L++ G+++NA I    + ALT A   G  +VV +L+++ AN+EH ++ G TPLM+AA  G+      LL +GADVN       R T+                   G H         + L LA  GGH  VV+LL+  G +  +   DN  +  L+ A + GH  V   L+
Sbjct: 1047 IDAHTESNHDTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAA----------------------------------SGGYVNIIKILLNAGAEINSRTGSKLGIS-PLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGAD--VDAADNRKITPLMSAFRKGHVKVVQYLV 1378          

HSP 10 Score: 154.451 bits (389), Expect = 5.228e-37
Identity = 95/263 (36.12%), Postives = 143/263 (54.37%), Query Frame = 1
Query: 2890 DTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNHGAEINSRTG-------------------------------SKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTGLTPLMEAASGGYVDVGRVLIDRGADVNAIP 3585
            ++ LT+A  GGH EL  LL+ RG+N+E  + +G TPL+ AA  GH     +LL  GA+I AQ++ T++TAL+LAC  G  EV + L+ + A+ E   +   TPL  A+  G++ ++K LL  GA +++ T                                S+ G +PLM AA  GH+  V+ L+ +G++VN     N +T ++LAC  G   VV LLL   A+  HR K G T L+EAA GG+ +V   L+D   +V ++P
Sbjct:  439 ESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIE---LGCSTPLMEASQEGHLELVKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDYPNNVLSVP 698          

HSP 11 Score: 147.902 bits (372), Expect = 5.206e-35
Identity = 99/297 (33.33%), Postives = 155/297 (52.19%), Query Frame = 1
Query:  427 QSEQGTRSLVEACIEGDIAAVRKLLDEGRSVHEPTDE-GESLLSLACSAGYYELVQVLLAMNANVEDRGSKGDCTPLIEAASNGFVDIVKLLLQHGANVNAQSSAG------------------------------------NTSLHKACGSGYDDVVELLIQHNADLEHQNENGHTPLMDAASNGHVKVAKLLLDAGAGINTHS-SEFKESALTLACYKGHVDMVFFLLERGADQEHKTDEMHTALMEASMDGHVEVARLLLDHGAQVNMPADSFESPLTLAACGSHVELAELLIE 1203
            + ++G   L+ A   G +  V  LLD+G  +   ++   ++ LSLACS G  E+V +LLA  AN E R +  D TPL  AAS G+V+I+K+LL  GA +N+++ +                                     NT+L  AC  G  +VV LL+   A++EH+ + G TPLM+AAS G+ +V ++LLD GA +N       +++ALT+A  KGH      L+ RGA  + +  + +T L  AS  GH +V +LL+  GA V+   +   +PL  A    HV++ + L++
Sbjct: 1084 RDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHR-NVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDVRNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVK 1379          

HSP 12 Score: 122.865 bits (307), Expect = 1.903e-27
Identity = 85/254 (33.46%), Postives = 123/254 (48.43%), Query Frame = 1
Query: 1150 LTLAACGSHVELAELLIEHGANLEEVNDEGFTPLMEAAREGYLPMVALLLAHGANLYXXXXXXXXXXXXXXCCGGFLEVVAYLLDCGADIELGAS----TPLMEAATEGHVELVKFLIEKGANVNAITATGDAALTYAAENGHTDVVEVLIEQGANIEHE--SEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1893
            LTLA  G H EL  +LI   A +E  + +GFTPL+ AA  G++                                   VV  LLD G DIE  +     TPL  A + G  E+V  L+ +GAN      +    L+ AA  G+ +++++L+  GA I     S+ G +PLM AA  GH+  V+ LL  G+D+N +     ++ L+LAC  G   VV LLL R  N   + K   + L+EAA GG+A V  +L++
Sbjct: 1059 LTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHV----------------------------------GVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLD 1278          

HSP 13 Score: 100.908 bits (250), Expect = 7.695e-21
Identity = 43/101 (42.57%), Postives = 73/101 (72.28%), Query Frame = 1
Query: 4696 KKAKRVDDEWKEVTRSIPHTKSRKILIPAALISRVIGRGGCNVNAIREHTGAHIDIDTNRKKANGDCMVTIKGSQQATKQAGNLIQSLIDDPDSNVAEILP 4998
            K+ ++ ++ WKEV R     +S+K+ +PA+++SR++GRGGCN+ AI++ TGAHID+D  + K NG+ M+TI+G  ++T+ A  LI +LI DP   + +++P
Sbjct: 1681 KRGQKREEGWKEVVR-----RSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDK-NGERMITIRGGTESTRYAVQLINALIQDPAKELEDLIP 1775          

HSP 14 Score: 99.7525 bits (247), Expect = 1.681e-20
Identity = 77/244 (31.56%), Postives = 114/244 (46.72%), Query Frame = 1
Query: 3268 NSRTGSKLGISPLMLAAMNGHVAAVKLLLDRGSDVNAQIETNRNTALTLACFQGRTEVVGLLLDRHANVEHRAKTG-LTPLMEAASGGYVDVGRVLIDRGADVNAIPVPSSRDTALTIAADKGHYKFAELLVVRGAVVDVRNKKGCTPLW----------------------------------LSAHGGHLDVCQLLAREGADVNAMDNRAVSVLVAAFRKGNIKVVKWLVKHVSQ--FPPDS 3888
            NS    ++    L  A  +G V AV+ LLD G  VN   E    + L LAC  G  E+  +LL  HANVE R   G +TPLM A+SGGY+D+ ++L+   ADVN+    ++ +TALT A   G     ++L+  GA ++  N+ G TPL                                   L+ + GHLD+ + L   GAD     +   + L+ A   G+++V + L+   +Q   P DS
Sbjct:  197 NSHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGE-SLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNS--QSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADS 437          

HSP 15 Score: 99.7525 bits (247), Expect = 1.710e-20
Identity = 53/121 (43.80%), Postives = 74/121 (61.16%), Query Frame = 1
Query: 1531 DAALTYAAENGHTDVVEVLIEQGANIEHESEGGRTPLMKAARAGHLCTVEYLLSQGADVNRKTSGGEHSVLSLACAGGHTAVVELLLGRGGNPTMKLKDNSSMLIEAAKGGHANVAHLLMN 1893
            D ALT A   GH ++V VLI + A IEH  + G TPL+ AA AGH+  VE LL +G D+  ++   + + LSLAC+GG   VV+LLL RG N   +   + + L  AA GG+ N+  +L+N
Sbjct: 1056 DTALTLACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLN 1176          

HSP 16 Score: 94.3597 bits (233), Expect = 7.563e-19
Identity = 51/128 (39.84%), Postives = 73/128 (57.03%), Query Frame = 1
Query: 2872 STDSNHDTALTIACAGGHDELVQLLLARGSNIEHRDKKGCTPLILAATAGHTATCHILLEHGADIEAQSDRTKDTALSLACSSGRQEVVELLLMSNANFEHRNVSDYTPLSLAASGGYVGIIKVLLNH 3255
            +T +  DTALT AC  GH ++  +LL  G+++EH  + G TPL+ AA AGH  T   L+  GA++   +     T +SLAC+ G   VVELLL   A+  HR     T L  AA GG+  ++  LL++
Sbjct:  563 ATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDY 690          
The following BLAST results are available for this feature:
BLAST of TCONS_00000951 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ANKH19.672e-5474.30Ankyrin repeat and KH domain-containing protein 1 ... [more]
back to top