Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000889 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000889
Unique NameTCONS_00000889
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3368

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000889 ID=TCONS_00000889|Name=TCONS_00000889|organism=Clytia hemisphaerica|type=transcript|length=3368bp
ACGAGATGTGGTATCCACCATCATATGACATGGTAGAAAAAGGAACAAAA
GAAAGGACACATCGGATGTGTTGGACCAATCGTAATGTGGATAACCTTTT
ACGTGTTTTTGTTTCAAACAGCGTTCGGTGATATCAAAAccTATGAAAGT
TTGGACGAAGGTGAACAGAGGCTTTTGAAATATCTGAAGAATTTTAGCGT
GAACTCGAGGCCAGTCAATATCTCATCAACAGCTGTATACGTTAATGTTA
CCATGGAAATTGTTCGACTCGATGCCGTGAGTGAAAAGGGACAGTCTGTT
CGGATGAAATTACATATTAATTATctttGGAGGAACCCATATTTAGTATG
GAATCCGCTTAACTATAAAGGTGTTTCCGAAGTCATTTTACCCGAAGGTG
AAATCTGGATACCGCCCATACGCCTCTTCAATGAAGCGAGCAAAACACAA
GGTGAATACAATGAGGACAATCACGCGCGGACCGTGCTTCTAACGAATGA
TGGCAACTGTTCACTAACCTATGCCCAGTTCTTCAAATCCACATGCGAAA
TTGATGTCAGTGATTTTCCATTTGACCAGCAATATTGCGATATGACGTTT
GGTAGTTGGAGTATGGATGAACGGTTGCTACAACTGAGAGCTGTCAAGGA
AGAAGCTATATCTGAGCAATTGTACAAGGAAAATGGTGAATGGCATTTAA
CTGAAGCCACATTGAAGACCCATGATGTCAGATATCCGATTCACCGTCAC
AAACACAGCACCATCAAACTCTCCATACTCATAAAGCGAAAGTACATCTT
TTTCATCATGAATTTGGTGGTACCATGTGCTCTCATTGCATGCATGATTT
TCTTGGTGTTTGTACTACCAGCCAAATCAGGAGAAAGAATCTCTCTTGGT
ATTACTGTCATGTTATCTATGGCTATCTTTCAAGAATTGTCGTCAGAGAA
ATTGCCAAGTAGTTCTGATAACTATCCGTTACTTGgtgtTTATTACACGA
CTTCAATGTTTGAAATTGGTATTGCCCTGGTCATGAACTGCTTCATTCTT
AATGTTTACTATCGCAACTATGAAATGCAGCCGTGGATGCGTCGATTGTT
ATTCGATAAACTCGCTCGACTCGTTCGAATCGATATCCCACATACTCGAA
CGCAGCATTACATTGATCGAATGTCGACTGGTCAGTTCCGAGAATTGAAT
CCATTGGCTGAAACCACCCTCAATAATACGGCGCACAATGCTCACAATAT
TGACGGTGAATCGGCACTTGGTAACGGGAACGGAGAAATGTcatattttc
caaaatcgacGCTCCATCGGGAAGACACACAGACTATTCAACGGAAAACC
AAGAAGTTTTCTGTCAACCAAAACGGCAGCAGTAGCGATTTGACGTACAC
CAAATCGAATTTGTCGGCAAAAATTTCACTCTCTTTGTCATCTGATCCAA
GTACGCGTATCGAAGAGCGAAAACTCTTAGGTGAGGACTGGAAAACAGCG
GCTAGAATTCTAGATCGCTGTATGTTAGCTATAGCGATTAGCGTTGGAGT
TATCTCAGCACTTACCATTTTTATGCAAGCGGCAAGGTTTCGTGAGATGT
TTATTCCTTGAGAATGCTCTCACTGCTTTGCTTACACTCAACACAAGTAA
GTGCTTGCCATCTGTTGTTGCTATGGTAAATTTTATGATGTTCAAGGAGG
AGTTATGGAGAAAGAAAGATGGTAGCACCATTACGTATTGCTAAGGTTGG
TAACCCTTGGTTACAGGAGACCTCGTTTCATGGGTTGTATAAATGACACA
GATACAATATCTATAAAAGCGAAAATTTGTTTCTACCGCAAAATAAAATG
ACTGAGTTGAAATGGTTTAGATAATGAGCTTATTAAACAAACAAAGCTAA
CTTATTATTAATAATGCTTAGCTGATAGAAAGAGGAAAGTTTGTATTTAC
TAAAATCACTTTCAAATCAAGGCCGCTTTTTACATTACGTGCTTGATGCA
AAAACATAAAGAATGGCTTTGGCGAAACAATCTTGGCCCAAACATACAAT
CAAAGTAAAAGCGTCTCTTTGCNaataattaacataatatatgcatggat
cgtgcatcgtgcatcgtgaatcgttggatcgcgcatcgtaaatagacgat
atcgcgtttagataaatgcaatgcattctggtttctcggggactctcaaa
ggaattataatgtcGATTATATAATAATCtggaatagattataattccct
tgagggtccccgagaaaccagaatgcattgcatttatctaaacgcgatat
cgtctattactcTGGTAcatctttttgtatttttcgtGTTGAGGACGGCA
GCCTTGAGAAATGAGTACCATTTAGAAAAGTCAAGTAAAGGAATTGTCAC
TTGAAGTTTTCAAATTCGCCGTAATTAGATTATACATTATATCTGGAAAA
AGAACTTGATACAGTTTTTGGGTCCCGAGTTAAATTCGTCATAAGAAAAA
CTCTACCGTGATAAAAAACTTATTTGGAACAATAATTTCTTCATAGTACA
GTTAAACATTTTGTAtgacttcaattttcaattcttttactGGACATAGA
TATGCATTGCAAAAACAAgtcaggctcggatacagagggaggctataacc
aatggaggagagtgcactttatcatcgtattaccttatatggaaactaat
tactctccacgaataagatagcctacctcctgtatccgacacTGNAtgac
ttcaattttcaattcCTTTACTGGACATAGATATGCATTGCAAAAACAAG
TCTTTTTTCAGTTGATTTTAAATTTATACGATTTGATACATAACATATTA
TTCTATATGATACGGTAGTCGTATTGGTCGGAAAGTTTTTGGAATTCCTc
acaaaaatttgataaattaaaGGTTATTTTTGCCTTTTCGTATCAGTAAG
CAAATCAATGAAAACTGCAATTGCAAACTGGCTGCAATTTGGACGTAGTT
ATCACACTCCCGACAGCTTAAATTTATAatataaataaacaaatttttaa
ttaactGGAATTTGGATTTCTAAGTTTTAGTACCAGATATGAAATCCAAA
TGCTCGACTAGATTGCAAATCTGTAAGAATTCATGCGACAGATATATTAC
GACTTTAAATTCGTGACTTAAAAAAGACATAATTTAAATTAGcactattt
atttatttatttattgaacatttgtcaatattttgctttaatttattgtt
tttatagtAATAAGTGTCGATTCTTCATAGTTTTGCAATCCTCAATATTT
GTTTTCGACCCTCGTGAGTCCTGGGACGATGACcaatttacatgtttttt
tataagcataaaaaattc
Run BLAST on NCBI

transcript from alignment at sc0000005:1369793..1412445-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000889 ID=TCONS_00000889|Name=TCONS_00000889|organism=Clytia hemisphaerica|type=transcript|length=42653bp|location=Sequence derived from alignment at sc0000005:1369793..1412445- (Clytia hemisphaerica)
ACGAGATGTGGTATCCACCATCATATGACATGGTAGAAAAAGGTAGCTAA ATTTTGTACATTTTAATTTATTGAAGGGATGGATGATGGGGGCATACAAC AAACTTTATTTTGATTCTGATCTGAAATTCAGGATAAATATTTTGTGGTT TCACTACCCATTTTTCTTTTTTAAACCATTTCACCAAAATTCTGAAATAT AGGAATGAAGTTCACAAAAAAGGGACAGGGTACTAAATATCTAGAAATCA TCAACCCATAGCTAGCTGTCAACTTTGCCTCACAAAAATGCGGGAGAGCT CCAAGTCGGAAAAATTTTCCCCCAATAATCTAATTTTTCTGAATCAGAAA ATTGAGAAATTGGGTGAATTTTCCCACAAAATCCGATTTGAAAAAAGCAT CAATTGATGTATTATGTTCATATTTACTTTGCTTGTGACATTGTCAAAAA CACAAATGTTCCAAAACGCCCTGGTGAATAATTTTATAGTGTCGCTAGTT GATGATTTTGTGATCACAATGGCCATATTTATTCAAAACAACAAACAGAA GTTTATTCAGTCATATAAAAGCACTTTTTACAGTTAGTGGAAGTATATAC CTCGATTTTAAGCCATGCTCAAAGTTCACAATAACGACTTTCATAAAACT AAAAGTCAGCGCTCTGTGGTTGTAACGTAGATACAAAATTGTTAAAATAA AATGACAAATCGAAGTATTTCCACAAACCAATCCAAAATTTGAATGAAAA ACATTAAAGTGGTCCTTGGCAAATTCTCTTACAGACAGACAGAGCCATGG CCCTTAAAGTGAATCTAAGTGAATATCTAAGTGAATCTGTACAGAGTACA GTAATCTGAGTAAGAATAATAATATAAGAGTTGTTTGAAAATTCCCTTGC GTTGCTATGGATACGAAAAATGTGACATAGCACACGCCCTGTGTTTCTCT TTTTTATAAGGGAATAGTAGTAATGATGATTTAAAATGCAGTTTTTGAGT TTCTTTTTACCGTTAGAAAGTTCACTGCACCTTTGGAATACTAACTAGAC TCTCCTAGTATTATTTCTTCAGCNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNTTCTTATGTTTTTTATCTCTTTTACAACCAAATAGAGTG TAACAGTAAGAATAGTTGGAGCGCATGTGACGTCACAAAATCAACAGAGG GGGAGTTTTTCTCCATTTTAGAGTCAAAATTGTGAGAAATTAAAGATTGA ATAACTCAATGAATAAAAGACATTATGAAGTGGTTCTTTTTTTGTTCGAT CACATTTTTTTCCTCTTTAATATTTCGAAAAAAAATCTCAGGGTTAATTC CAAACATTAATTCCCCTTTAATAAGTAATATCCTTGAGGAAGGCTGCAAG AACATCCCATAAGTAGCAGCTGCTTTAATAAAGTGCTCTGGCCAAATTTT GGGTCCAAATTATGAAACAAACGGGTGCCACACCCGATTAGTAACTACAG AAAAATTAGCTATTTCAGTTCCAGAGATATGATTCTAAATAATTGGTATT ATGGAAATGNCTACAGAAAAATTAGCTATTTCAGTTCCAGAGATATGATT CTGAATAATTGGTATTATGGAAATCTGGTGCTTTGGTCAACTTGATTCAA AATAGAACAGACTGCTACCCCACTGATCAGTGACTTTTTAAAGAAAGCAT ACCAGTGGCTGGGACCGCCAGTCTATATACAGCTATTTTTGTTCAGGGGA TTCAATATAAGACGATATGCTTCTTGTTTCAAAATCTGTAGGAAAATGGA ATTCTGAAGATACATTACACAAATCTTTTAAGAATATGTTGAAGAAAGAA TGATCTCTGTTGCTCAAAGCTGTTTATGAATGTGAGTCATTATCATACAA TATATNTGGAGCGCATGTGACGTCACAAAATCAACAGAGGGGGAGTTTTT CTCCATTTTAGAGTCAAAATTGTGAGAAATTAAAGATTGAATAACTCGAT GAATAAAAGACATTATGGTTCTTTTTTTGTTCGATCACATTTTTTTCCTC TTTAATATTTCGAAAAAAAATCTCAGGGTTAAATTCCAAACATTAATTCC CCTTTAATAAGTAATATCCTCGAGGAAGGCTGCAAGAACATCCCATAAGT AGCAGCTGCTTTAATAAAGTGCTCTGGCCAAAGTTTTGGGTCCAAATTAT GAAACAAACGGGTGCCACACCCGATTAGTAACTACAGAAAAATTAGCTAT TTCAGTTCCAGAGATATGATTCTGAATAATTGGTATTATGGAAATCNTAC AGAAAAATTAGCTATTTCAGTTCCAGAGATATGATTCTGAATAATTGGTA TTATGGAAATCTGGTGCTTTGGTCAACTTGATTCAAAATAGAACAGACTG CTACCCCACTGATCAGTGACTTTTTAAAGAAAGCATACCAGTGGCTGGGA CCGCCAGTCTATATACAGCTATTTTTGTTCAGGGGATTCAATATAAGACG ATATGCTTATTGTTTCAAAATCTGTAGGAAAATGGAATTCTGAAGATACC TTACACAAATCTTTTAAGAATATGTTGAAGAAAGAATGATCTCTGTTGCT CAAAGCTGTTTATGAATGTGAGTCATTATCATACAATATATTAACATTTT TACACTGATTTAAATTTTGAGAGATAATTAGGTGTTTCTAATTTCAGGGT TGAGCATTTATAATTTTATGACTCTGAATTTCAAATTTTCAAAAGGAAGA CAGAAAGTTTTTCTAATTGGCGTAATACAAGGTTAATTAATGAAAGAATA TAATAGAACTCTCAAAAGTATTAATTAAAAATAAATTTCATTTGATAATT AGTAAAATTTACCAGAATGGAGCAATGTACCCCCTAATGAAAGAAGTTTT GAAAATTTTATTAATTGCTATTTTTATAATTTATATTTTTTAAACATTAC ACATAGGAAATCGAACTTATTGCAACTAAGTTGAAACAATTTACCACTGA GTCTATCCTTTTTCAAGAATAGCAAATATTTAGATTGGCTGGGGCTGATT GGTTCTTTTTCCAAATTCAATTGAAATTATTTTGTATAATCAAGGGTGGA TTTCTAATTTTCAAATGAATATAATAATTTTGCATAACAAGCCAAAAATA AGATTAAATTTTACCCAGGTTAGTAAAGTTTAAAAATTTGCCTGTTATAA AGTTTATTGAGTAGGGGAAGTATTTGCCAATATGATGCTACTGTCATTTT CTCTTCTTGTGATTACTTTAAAATCAATAACATCAGAATTTAGAAAAAGA AGATGGTGTTATATATTTTGTTGGAATATATTCAACATGTTACCATAGGT TGAACAGAACCAGTGAAAATGCTTTTTGTCAGTATACTGACGAATTCCTG AGATACAAAATTCAATCAACAAAGGAATTATCACTAGAAGAAAACCGATA CCCACAAGTTCAATATGTTGGTTATGACGTTTGTGATGATTTCACAAAGC TTCAAGAGTTAGCTCAAACACTTTTATTGAATGACCAATACTTGCTATCT CCTCATGATTTGACAAATGTTACCAAGTCTTCCGTTGGCTACATTCTAAT ACAGCTACCAAAACAAATGACAAAATTCTTTAATGAGGTATACCACGATG CTGCTGTGTTAGACCTTCACTCCATCCGCCAGGCAAGTGACCAAGTGGTG AATTTTCAAATGGAGATTCTCAAGTTTCTCATTCAATATCATGAATGGAA TAATATTCTATTATTTTACAGCAATGATAAGCTATCCAAATATTACAGTG GCTTTAAAAAAATTCTTGGCGAGTTAAGAGAATCAAGGATTCCAGTACAC TTTACAAAGCTTTTTAAATATAACAGACATTATTATTGGTTTCCCAACCG AGAAAAGAAATTGACTAAGGAATGGGTTATACGTAACAAACCTACAGTTA TAGTTCTTGTCGAAAGGGATAGGGGTATTCACTCAGAATTTGATGTCTTG AACCCAATGAACATTACAACGATACGCTTTGAAGGTAAATCAAAATGCTC TAAAGTTCTGGACTCCACTATGATCTTAATAGATGTTGGTTCACTGCACT CTCTGTATTGGTCAGTAATAAAGAATATTCCAAAACTGCAATATAAAAAT ATTACGAGATCACAATTAAGTTTAGAATCTTATGCCCGTAGTTTAGGGCC TTTAGAGCAGTTTTCGGTTGATTTCATGAATAAATTTTGGGAAGTTGACC TAGACGACATCTGGGGTACCAATTTGTTTAATCCTCAAAATAGGTCTGAA TTTCTGGAACAACTTCATGTAATCAAAGACAAGTTTACATTTGATGTGAA TGATTTATATGGATATCAAACAAGAGAGGATGTCGATAAAGCAAGCTACA TATTATACAAAAAAAGATGCTCTAATATGCGTTTAATTGAAGGAAATGAC TTTAAAGATTTCAAAGAACATTATCTTGACAGTGATAAGAAAAATCTATC TGATCACTACCTAGGAAATCTTTCCAGTCAAATGCCTCCATTAAATTGTA GTCCTGGCTATTACAAAGTGTATGGAAATGTAACACAAGGATTTTCATGG AAATGTCTATTATGCAGAGAAAATTACTTCAAATCATCATATGGCAATCA ACCTTGTAAAAAATGTACTGGCAAAACATACATTGACAATGGAGAGAGAA CAGGTTGCATCGACCCTTACCAAGATATTTACATAGGTCACAACTCACAG GAATTCACTATTGTTTTGGCATCGTGCTTAACAGGTGTTGCTATCACTTT GTTGGTATTGATCATATTCATAGCAAAAAGATCGACCCCTATAGTCGTTG TATCAGATTTCTTGATATCTACAATCCATTTAGTTGACATTCTATTCATC TTTATTGTATCACCTATCATATTTTTCATCGAGCCTTCGACTGCTATGCA TTGTCTTTTTAAACCTGCTTTAATCAGCTCCTTGTATGTCGTCAATGTTG GTATTATCTTCATCAAAACACAAAAGATCCTGAAAGCCTACCTCAGTAAA GTCATATTGAGAAGCAGGGAAATCAGAAGAACAACCGCAGAACAAATTTT CGCAATCCTTATTTTTCTCGCAGTTGTTAATGTAGCCTTTGCTATCTCCA TATACTACAAGCCTGTAAATATCCTGGCGATCGAAAACCCTGAAATCTTG AAAAGGAATTTAAGTTGTAACACTTATTTTCATAGCAGTATCATTATTGG GTTAGAATTGCTAATTCAGTTGTTGTGCTCTATCCAAGCATTCCGCGGAC GAAATCTCCCAAGTGTGATGAACGAAAGTATGATTCTAGTCTATACTACT TTCGTTTTAACAGCTGTATTTGTGGCAAACTTTGGTATAGTGCAATTCCA AAAAGTTTGGTACAAGGAAATAGCACAATGTATTGCCATCATTATCAATA ATACGGTGATCATGATGTTACTATATGGACAAAAGGCATACCGTATTATC AGATATCCAACCAAAAACACAAAGGCGTATTTCCGTGATTCAAGAATGAA TAATATGAGAGTACAATCAGAGAGGGTGATAGCTCGTCCCTCATTGCCAA ATTAATCGAGAGACTTAATACTCACCCTTCTTGAATCTTACCAAAAAGTT TAACTTTCTGAGGTTCCGTCCAGCTGAGCCTCACTCCTAATGCGCAGATC GATGCAGATTTAAAGAAAGCAAATACATATAGGTATTATGTTATCGAAGT ACTGTATGTGTTATTTACTGATATGTTTAACGTAATTAACAACGATTATA TTAATGCTATTTATGTGTGCTTAATTGTATAAAATGATATTAACGTATAA ATATTTTAAACTATATCTCAGTGTAATCATTTAATGCTTTTTGTTTGTGA TTGTATTACAATTATATTATTTATTATATAATCTATTGTAACTGTGTAAT GCTCTACTGCAATATTGATATCTATTTACCCCTTTGGAGAAAAATGACAA ATCTATCCATACATGGGCTGTATTAGAGACCTAAGCTCTCCTATGAAACA CAGTTAGAAATTATTTTTTATATTTGAAGTTCAACAAATACTACTTTCAA GTTTCTTCTTTTGTGTGAGATTTTGAAGTCCAAAATGAAAAATGACTAAA ACTTTCTGAAGAGGTTCTGATTATTTTTTGAACATATATTTTGTCAAAAA GTGTATCAAAAGTCGCAATATCCAGGTTCTGTTATTTTAGATTATGTCCT CTACTGTACAGTGAATTTATTTGAAGTTTACACTGGACCTCTTTCAGTCA GTGTAAAAGGTGTGTATTAGTCAGTGTGTATTTGCATGCAGTTTTTAAGC AAAATGACAATGGCTGTTGTAAAGATTCGTCTTGGCTCTCACTNTGTGTA TTAGTCAGTATGTATTTGCATGCAGTTTTTAAGCAAAATGACAATGGCTG TTGTAAAGATTCGTCTTTGCTCTCACGTCATCGTTTTTAAGAAAAACAAA ATCAAAAAATATATTTTAATCAAGTAATTCATATTCTCTTCAAAGATTAC AAAAATTTCTTTGTAATTATTTTCACTATTGTTCTCTCTTATAATATTTT TTTTCATTTTTATAATCCCTTCTTCTAAAAATAAGGTCTCCTAAAAATTT TATCACCTATTGCTTTTTCTATTAAAATGAAACATTTTGAGATTTGAAAT TCTCCTTTGATTTCACTAAAGATAAACTTTTCTGTTTTTGGTCATACAGG TTTGAAGTGGCATGTTAGGTTTTGCTATTTTTCAATTTTTTTTTTCACTT TTGCTAATTTATGAAGACGAAGAACGAAATTTTTTGCTGATTATCACAAC TCTAATGTTTATTTTCACCATGTACAAATCTTCACTGAATATTACACAAT GCAGGCATGCACTACTTTTGAGTTCTTACAAAAACAAAAAGGAGCATATT ATAGTTGGTCTGGAAGTTTTTTTCTTTGCAGATGTTCGTAAGCTTCTTCA CATACATTATGAAATCCACACTGATTCAAAATGATATGTTTTGATATTTT GCCTCAATTATGTTTTGATCACAACTTCCTAACTTCTTAGTGGGCATAGA AAGGTGCGACAATTAATTCGGTGTAAAGGGGTGCATGCAGGGGGGGTCAA CATCCAGATACCAGACCCATAGCCGGGTGGTGGTGTCTTTTTTTCCTTTA AAAGTCTGAAAAGTCAAGTTGGTATTGATGGGGGTGGGTCCCCCTTTTTT TAGAAAAAAAGAGTTATCCTCAGTTGGTATTGATACCAAAATACCCCTTT TTTTAAATAATACGATTCAGAAAGTTGGTATCCATATCAAAATGACAGCA AAACTTTCCTAATTTTTGCCCTTATAGCTAGAAAATACCCCGGGTACATA TCACTCTAAACAGGTTTCAATTGGATTTGTTTTAGCTTTTGAGTAATAAT GACTGTAAATGAGTAATAAGTATAAATGACTTTGAAGTTTGTTTCTTTTG GACTTTTTCGATATTTTCTAGTTTTATTTTTGATCAAGCCTGAAGCAAAA ACATTTTTTCTGTGAATGCATTTGGTAATGAGTGAATCTATTCTGTTCTA AAATTATGTACTAATGATTTTTTGCACATCAATTATATTTGATTTTGCTA GCTTCATTGGGTTTGTTTTTATTATATTGTCAGTTTTCAGTCATTTTCTA TTTTAGCATATGACATTTTTTGTGTTGTGTTAAAGAAAGGGTATTTCAAA AATGAGTTTTTTTGAAGTTTCTCTTAGTTTCTCCCTGGTTGTGTGGGAAG GGGTGGGTTCCCTTTAAACAGCTTTAAACTCAAATTTGTAAGATTGGTAT TGGTACTAAATTAGGGGGTGGGTCCCATGATATTTTGTCAAATTCAAAAA GTCATGTTGGTATCGATACCAAATTAAGGGGGCGCGTCCCCCTTTTTTCT GAAAATTCTGATTTTCAAGTTGGTATCGATACCAAAATAAGGGGGTGGGT CCCATGATATTTTGTCAAATTCAAAAAGTCATGTTGGTATCGATCCCAAA TTAAGGGGGTGGGTCCCCCTTTTTTCTGAAAATTATGATTTTCAAGTTGG TATCGATACCAAAATAAGGGGGTGGGTCCCCCCTTTTTCTGAAAATCATG ATTTTCAAGTTGGTATCGATACCAAAATAAGGGGGTTGGTCCCCTCTTTT TCTGAAAATTATGATTTTCAAATTGGTATCGATACCAATTTTGGGGTGGT GGTGTTAACTTAGCTCAAAAGGTCAGGTTTTTGGGCTATGGGTTGGTATT ATAAATGTTGACCCCCCCCCCCTGGTGCATGTCCAAATTTCTTATTCAAA GAATGCTTTTTACAGTACCAATTTAGAAGTGTAAATCTATTAGAACGTTC GCGCCTAAAAGCGAGATAAATCTCACATAACAATCCACCTTTTGGTTAAC TACATATTGATCATACGCAATTCCTTTTAGTAAGTATTTCCAGGACTTGC CAATGGATTTTCGCTATTATTTATACCTACTTATATTTTGCAGCTTTAAC TATAAAGCCCACATGTTTAAAATGCTTAAAAAACGTTGAGACATCATGTG GACAGGTGTTTGCAAATGTCCATGATATGTTTCGGACACTGCTTGACTTA AATTTAATTTGATTCTAGTATCAAAGTTACGTTTTTGATTGCCTTATTGG TCGTTCTTGACTTTTGAAGGGCAATTTAACTATAAAGTATAGATTGTTAC TTGACTTAGCTTGGCTTAGTCTTTCTAAAAGGTTTCACGATAGCGTGATT ACGTGATTTGGAAATCTTTTTCTCGTGATTGCGTGATCAGAGGTCAAAAC GTGATCGTGATTCTAAAGATTTTTGAGCGGTGATGCGTGGATGCGTAATT ATCCAATTTTTTTGCCGATTTTCGTGATCGTGATTGAAGACAAAAAATTG CGTGATATCGTGATCAGACTCACCACTGGGGTAATGTTCATGAAATATTA TGATTTTTTATGAATCGTATGTTATAGAAAGTATTTTCATATTTTTTGTA TCCCTAATATTTTTTAGGGAAATAGAAAAAAACCTACTGTCGTGAGCTTG CTGTCTTTATTCGATCAAACTCATTATTATAGGTCCTCTGAATAAATAGT TAATGGACTGAGAACATAAAGTCTTAACTAAAAATTAAGAAAATATATAC GTATGGTCGTATAATTTGAAATTTGGAAAAAAATGAGACAATATTAATAG GTTGATTTATTTTATTCGAATTTAACAAGATAAAGTTGATTTGCAGTCAG GTTGTGAAAATAATAATCTTAATCGAAAATTCTAATTAATAAGAACAGAT GAGCTTTGACAAAAATATATTAGTTCTTACAAAAAAGAGGATAAAGTTTT TTTTCAAGAAGATCCAAAATTTTTTATATTCTAGCCACCGAAGCCTTATA TTCTTATAAACTTTGTTCTTCTGTTAAAAACGTGGTGCAGTTCGTGCATC GTTGTAATCACAAAATCTTTTAATGTTATGACTGTTAAGATTAAAGGTTT TATTTTTACATAAGTGTTTCTGTTTCATATCAGACATTTCATATCAGGAC AATGTCTGTCTATTGTTATATTATGCTTATATAAGCAAAAAAATGTTTCT CTTTTCCTCTTTCTGACCAATCTTGCTCCACAACCGTGTCAATTCACTGT GGAAAAGCTTGTAGGTTAAAATTGATGAGTAAGCAAACGGTATTTAAAAA TAAAACCTTTAAAGGTGAAAAAAATCGAAGCAGATGGTTATCCTAGAGAT AATTTACATAACTTTTTCTCAAACATGAATAGAAAACCTTACTTCTACCT TCAGATAAATAATAAGTAATAATAAGTAATACGAATTTTAATACCTCAAA AGTAAACATTATTTTATCTCTTCAAAGAAATGTCTCGTAATTTTAGTCTT GGCTTAAGATTGAAAAAGAAGTTTCAATTTAATCAGAAGACATTTATAGG AACATTTTACAATACTAAAGGGGAAAATATTAAATTTCATAGGGGAGTTG ATGGAGGAACGGTAGGATGCTTTGAGAAAGTTTCTATGTCATTCTCGATA AAGGGGAAAGATTTTCGGAAATCATGGGCAACAATTTGGACAGTCTGGAT TTTACTGAACGAATCTTATACTAGTTTTTCTCTCTTATAAAAAAGTTGCC CAGCTTCTATACAGTTTGTTCTCTTAGAGACCGAATCAAGGAAAATGTTT TTAAATTATTAAATAATCGTTATCCTGGGGGGGGGTNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCGGGT CGTTATCTTAGAGACCGAATCAAGGAAAATGTTTTTAAATTATTAAATAA ATTTTTAGGTCTCTCGTAATAAATGAATATTTCTGAATCTTTCCCCGTTG AACTAGGAGTAACTTTTCAATTCGAAGTTTTATTTTGATAATGTTTCTCT TTCTTGTATACTAGAAATGTTGAGTTTGATACAGCTTTGGTCAACTGTAT ATGAAAATATAATGGATTGATAGCAATTTATTTCTGACTTTCTTTTTTAG GTTTATTTTCCTGATTTTTTTTTTCGAAGTATGGAACGAAGCTATATACC TTAAGTGGATAAATCTTGGCGGGGATTAAATTCACCAAATCAAATCCCCG CCAAATTTAACAAAAAGAGAATTATGTGAAAAATCACAATTTTTTAGCCA TATTCTTTTAGTAATTTTCACCCATTTCAGTGTGACAAAATTTCCAATTC GCCAAATTAATCCCCGCCAAAAATCGTAATTTGTCCAATCGCCAAATTAA ATCCACGCCAAAATTTATCCACTTAAGGTAATAGTTTTAATTTTAAGAAC CTTTTTTTGGTTCTCCTATTACGTAATCATTATTTGAAAGATCTTGTTTT TCTTACATAATATAATTGCCACCTAATGGCTTCATCAAATATTGATACCT TACCGCTTTCTTACTATTATCACTTTTTATCTAATCTTTTGGACCACTTA ACATATTATAAATTCGGGGTGATGGTTCACTTGAAATATTGCTCATTTGT CTCAGATGGTCCGAATCTTCATGTAATTCGGACAAATTGGACATCCTCGT TCGAATTCGAATTAGCGAGGGTTAGCGTCAAAAATCAAATTTTATGGACG ATTTTTTTAACTTATTCTGTGCATGAGAAATATAAAGATTTTTATCCATT CTAAGGGTCGTTAGAGTTGACGATAAAAATGAACCCTTTTCATTGACACA GTGAGTTACAGACAGATCCATTTAAAGATGAGTTTTTTTATCATATGGGT TTATAAGAGACTTTCATTATGAAAGATCATTTCAAAATCTAATGTCTTCA ACATAACGTCTCCTCTACAAAAAATGAAAATGAATTTTAAAATAAAATTG TAGAGGTGAACTTCAAGTGTAGAGGTGTGTTATGATAGATTGTTAACCGG CTACTTTTTCGTAGTGGGCTACACGACTTTTTGCGCAATGCAATTGGTTC TTTTCGCATGACGACGGGCCTACATTNCGGGCTACACGACTTTTTGCGCA ATGCAATTGGTTCTTTTCGCATGACGACGGGCCTACATTGTCCAGAGTTG CCCGTCGTTAGGAAAATTCATTGTGACGTCACTTAGGAAAATGAACAATG TGTTGACATCATTTCTCTCATTTTTTATTTCTGACGTCAGAAATTATAAA ATTTCTCTTTTTGCTTGTTTTTTTTTCGCTTTATTTCGCTATTTTTCCTG GATAAAGCGCTAAAAATCAATCGAAGCTGAAGGAAACGGTTAACAAATAC AATAATGACCGGTTTTTTCGGGCCGTACTGAAAATATTGCCCTCGGTCAA CGCAACAACCTCGCAAGCTCGGTCGTCACTAACCCCTCAGCCCTCACTAA CCGGTCATTATTGTAATAATAAGATTTGTGTGTATGTATAACTTATTGAA AACATAAAGAAGAATTGTTCTTGTCCGCGCATATAATTATCGNTTTCTGA AACAATGGAAATACAATACTTCGCTCTCCACTGTTTCATTCGATGTTTAT CCAGAGTCTCTATAATAAATCCATGATTAGAGTAACTGGCGGTGCACGTG AATATTTTTTGTTTGGTACTTTCGGACTGCTTTTCTATGTTTTTGCGCCC TGCACCGATATGTAAAATTCGACCCTTTCTAATCATTTTAAGTGAACTTT GATATTGATGACTTTCATCGGAAGTGCGAGGTTTCAGAGCAATGATATCT TAAAGGCTAAATGACAGTTTTTGACTAAAGCAAATAAACATACTTTTGAG TTGAATTTAAACGGGACTCGTTATGGATTCAAATTATAAACTTGAAGGTT TCGTTTTTACATAAGTAAAAAAATATCGCGGCGACAGTGTCTTCCTATTG TTATGTTATGCTGATATAAGCAAAAAATATTTTTCTTTTCCTCTTTCTGA CCAATTATGCTCCACATTCGTGTCAATCCAATGCGAAAAAGCTTGTAAAT TAAAATTGATGAGTAAGCAAACGATATCACTCTTATTTAAAAACAAAACC TTTAACAATTAGTAAGAATTTGGTAAGATTTGAAGAATAGAAGCGTTCGA CTTTGCGAGAATTTTTGTTGTAGAAAGCTTAAAAATATTTCCCTAGTGGT CGACGCAACAACCTCGCAAGCTCGACGCGTTACTTAACCTCGGGCAATAT TTCTCAGTACAACCCTCACTAACCAGTCATTATTGTATTAAAGTTATATA TTATTTCGATCACCTAAACGATCAACACAGAATTTACCTTTGACGTACGA AATAGATTAGCGATAGATAATTAGTAAAAAAGATGATCTGATTTATTGTA TATTTCCCAAAATACGGTTATTTTTTGACATCATTACCTTTCGTAACGGA AGATTTTCATGGATTTCTCATTTTCCCTAAAAAACTTCTATATTTGTGCA TTTCTTTTATTCTTCCTGCGATAATCCCATTTTCGAAAAAACGAATTGTT ATTTCTCTGAAAAAGGGATTTTAGTCGTGTTTTTGTCAGTTAGCATTAAG GTCAATATACTATTTTTATTTCATTTTCTATTTTTATTCTCTCAACAAAT GTAACGAATCGAATTGGTGTAGGATTGGGATCCATAAATTTCTTTTGCCG TGTTGATCATTTGTCGCTTTTCTTTTCAAAATTTTATTTTAATTTTGCTT CAAATATTTTCTGAATTTCACTATTACAACGCTCGGCCACCATAGTATGG ATGTCGGCTATATGCTCACTATCACTGACATCCGCATTTCCAGCATAAAT TTTAGTGGCAGGGCACAAGGACCTTTAAACTATGTTTATATTATTATTAA AATCTTCAGGCTCCATAATTTTCATCTGCAAAACTAAGTAATGCAAATCG ATGGGCATGAATGTGAACAAAATAAACACGGTTTTGAACCAGGGATTTTT AATTTGTTATATTCAGCTTTACCATTTATTAATATTTATGCTTTTATCTA AAAGTTGCTACGGATTTTCGAGGAAACAACTTACAACTTATTTTGTCAAC CTTTTTTTTTCTTTTCCCTTTGATTCTNCTAAAAGTTGCTACGGATTTTC GAGGAAACAACTTACAACTTATTTTGTCAACCTTTGTTTTTCTTTTCCCT TTGATTCTCCTTTCTGAAGATACGTTATCTCGCTTGGAATCCCAGGCTTA AATGAATCCACTAGAATCTGAAGAAATTATACAACTTTTCAAGCATTCTA CTTATATTGATTGGGGAGTTCCTTTTGTTTTTCAAATCATGACTACCTCA ATGAATGAAATTGGACGTCATTTCAACAGGGGTGTAAAGGATTTTTTGAG AAAAGCCCAATCATCTTAGTATTGATGGGAGCTGTCGAAGCGAGGGATGG TAGGTGTATTTACGCTTTTCTCTTATGATTATGAAGAGGTTTATTGCAAA CATCAATTTTGAAATATCTATGATCAAAATGTAAGTTGAATCCAAACTAT CAATATGTCTTTCTTGATAACAAATTTTTTTCGCCAAAATTTGGAACAAT AGTTGCAGTGGGAACATAAAATATAAAATATGGTCGGGACAACTCCTTTG TCGTAAAACGATAGATTGATTGCTCATCTTTTACCAGATATTTACACTTC ATAAGCAACCAAGTTGCTAACGGTCCAGGGCTCAAATTCCTCGTAAAATA AAAGCTTTTTGAAGTAACCTTTCTAAGTAATCCCAGGGCTGACGTGAAAA TGTTAGTTGCTTGTTATAAAAAAGTAGTGAACAACATTCGGAAATTATTA AAAAAAGTGGCTACAAAAACATGAAACTTATGTAACGTTCAAATAACAGG ACTCGAAATAACGGTCGGACATCGGACATTGTCCGACCCAAATAGCTCCA TGTCCGACCCAAAAATCATAATTTTCAAGCTAAAGCAACCCTGATCGGAC ATTTTGTTCGACCCACTTGAAATCGTTATTTCGAGCCTTGAATATGTCAT CTGGTTGGCTCTGGATGAACGTTGGATGAAATAATTTTAAAACGATTTTA TATACACGTTTATTATAATAACTAAGAAACTTTAGCCTAGCCTCTGCTTT CCTTCACTTTTGAGATTTGAAGTTCGAGTGCTCTAAGGCGAGGACAATTA AATTTACTGTTTTACGGGCCAAGCTATCCAAAAATAAGGGTCGGTCGGTC GGCGAAAAAAATAAAAGTAATAGTATAATTTCACCTATAAAATCTCCTAA AAAGGCAGCAAAGAACTACTACATCTTGACAAAAATGCGAAATAGAAAGT AAAAAGATACAAAAAGCTCGAATTCATAGATAAAATGAAAAAATGAAAAC ATAAAATTCTAAAAAACCTTGGAAAAACTACCGAAATTTTGAAATTAAAA ATGTACTACCGAGATCAATTTTATTTCATTTTGATTTTTGGCACCTCAGG GTCGGTCGGGCCCGTAAAACAACTAATCAAATTGGTCTCGCTTAAGGAAA CAAGTACCGTAGTATGTTCGAAATATAGCTAGCTCAGGGAGACTGGCACT AGCCCAATGACCTGAATAATGGTACGACAAACTAATTACAATAATGATGC AGTTTGTTTCTTCTTTATAAGAAGTGCTACATACCTTTTTGAGGGTCTAT TGTTCCTATACTTTCAGTATTTTGAGGGGAAGGGCTTTGACTCGAATCAA CTGTTTACTAAATTTTCATTTTGATGAAAATCGACGAGTCTAAGAGTTTC TTGCTTCTTATCTGATTTTGAAAAAAATTCACCCTCGACTTCAGAATTCA ATGCTGATGATAAAGTTGATATCGTTCTTCTTTTTTGGCATCTTTTTTCT TATGAAAAATGCCCCCTTGAAATAAGGGTATGTTATACTCTATTGGTACT TAGGCGCAAAAATGGGTGCTGGGTATGTGCGTTTCTTGTGGTGTTTTCCA CCTTCTAAAGTCTCTATAAGGGTTGCAAAAATCGGAAAATTTTGAATTAG TCTCTCTAAGGGACGGAAAATTTTTTATGGGAAAAAATTGTAAAAAAAGT CTCTCTTTGGCTTTTTTTAATAATGAAATAAGCCTCCTTCAAGTAACTTA TGTTTTTAGCATCTTTTAAATTCTAATTTAGAATTTTTCTTATGTAATAC GCGAAATATCAATAACAATACTGGATGAATAGTGGTAAATAAGTAAGGGG GAGTTTTCAAAAGGAGTCTATGTGTCTATGATCTAGTGCTATCATCTGTA GAAATCAAGTAATTTATAATTTTTGAGAGGTTTCTCTCAATTTTTAATAA TAATTTTTAGGATTTGTTTTGTTTTAAAAACCAATTTTCCAATAGCTAAT CATTATCATTCTCCCTTGGCTTCTGTTCAGTAGACCTTTCAAATTGTAAT TATTTCTTCAAGTCTAAAGGCGACAGTAGGGGTTATGTTTTTCTTCTTTG TAGTTTTTATCAATCATTTATTTTTCTTCAGAGAGAGAGCATAGAAATAA TGGATAAGAAAAAGCTGTAAAGACACTATTACTTAGCTTCTGGTCTTCGT ATTTTTGTATTATCATTTTCTTTCCCTTTTATTTTAGTTCGACAATCTTT TCCCCATGTAAAATCATAACGACGTATGGGGAAAATTCAAGAAAGAGATA AAAATTAATATATATTTTTCTTCTATTCAAAGACTCGTCAAAAAATTATA AAAGACACCATAAAAGTCAAGGAAAGGTTTAATTAAAAACAGAAATATTG ACGGATTTTAGTGGGGTTTATCTTGTGATTTTTCTTTTTTTGCAAAGAAA ATTGACGGAGATTTATTTTTTTTAAATTCATGGAAATGGTTTGGACAATT GTTTTGAATTGACTGGAAACTAATTATTTGAAGAAATTGAAAAATTTGAA GGTCATTGCATGACCAAATTGTTTTGACTGGAAATTGCATCATTATATTA CAATAATCGCGAAGGAAGAGCCGAGATGGTATGTGAATTTTAAACGTGAC TCCAAATTTTCCCATAAAAATACCAAATTTTTCCCTGTAAAATGGATATA TTCTTTAATATCAGAAATTTTCGTTGCGACTGAATAAAATCTTATACGCT GATCCGCGAAAATTCATTCCAATGAAAAAGAAATGGATGAATAATGGCGA TTCTCGAAATTAAATTTCCCCGAATTATACAAAATTTCGCGAATGGCCTG ACTCGCGAAATTTTCTGGCTGTGAAAATTTTTGACATTAAAGTATTCTTC TTAGTAGAGTTCACTATGCTAGTAGTTCTTTGAAAATACAAGAATTTTCT TAGAAAAAGTATCAATTTTCTTTTTTATACGCATGGGGTTTTCCCTTAAA AATGCGTCAATTTTGAAGATGTACAGTATGTATGTTCCTTTAAAATAATC AAGCTGTCGCGCTATGTATTTTTTGGACACAGAAAATGTTTGAAAAACAA CGTTGTCGCAACATTCATTAAACGTTAAAAAGACGTTGTGTTAATGTTTT TGTAGTACCAGAATCAATCATCGTAAAATTCAAACTTTAGTTATTCGAAC TTTCAGTTATTCGACGCGATTTCTATTCCCCTTGGTGCCAATTATAGACT ATATCCACCTCAGTTATTCGATTTTTTCCCTATTGGGAGATTGTCGAGTG AGAACATTGATTTTCCGTGATTAAAATACTTTTCTTCTTTAAAAAATCAG GATTCATGGCTATTTAAACTCTTCAGCAATTTTATCAAAAGTTCAATATT CTTTAACATTTTCTTTATAAATTTCATCTTTTAAAACCTGCTAATAATTT GTTCGACATAATTCAAAAAGTAAAAATTCTTTATGTTTATTACGCTCAAC GGGTGCTCGGGAAAACGAATTTTTCGGTTATTGAACGTAAATTCTTATTC CCCTTAGAGAGAATAACCGGGAGTCTACTGTATCTAATTGTACGTTTGGT AGCCGAGCGACCTATAAGGAAGGCTCTCATGGTTGGCGGATGAGGTAAAT CTGCTCTTTTTTCGTACGGAAATTTTCCGTGGCGGAATTCCCGAGTCGAG GTCGAGATTTAAAATTCACAGCTCGGATAAACCCGACAACGGCAAATAAT GTAATCATACAATTTTACGCTTTGGAAAATAGAAAACGGTTTTAAGATGT GGTATCGGCACGGAAAGGCTTAACTACACGTTTCTTTATAGAAAAAGTGA ACTATGAGCCTCGGATGTTCTTAATTTCTCGAAATTTTCATATGCTTATT ATTTTACCTAGAATAAGCATAAAATGAGTATAATTTTATAAGATTGCTCT TATAACAAAAAGCTATCTATGCTAAAAAAAATATGTCTGAGATTGATAGA ATCTCTTTTTCTTCGAAAACAATCTCGTAAACGTTACTTTGAAAATGTTA CCTAATGTTTTTTATCACAGATCATTTTTTATCAAAATAAGGCGTGGTCT GGTAAGAAGAAATGTTACCTCCTGGTATCTGATGATATTCTTTATCTGGC TAGTTGAGAAAGTTTTTGGGAAATTTTAGAACCTTATTTATTTTGATTCG ACAGATTTTGTTAGAAGTTCAAACGGATTATGAATTGTTTAGACGTTTAA AAATTTAGATAAAAGCAACAAAATTGATCCCATGATTTGGAGGGTAATTT GAAAGGTTTTCGTTTAGAGTGGTCGATCGATAAAACATCGTAAATGCATC ATCATCATCATCATTGCTCGACCGCAATCGAGACTAAAAAAAAAAGAGAC TAAAAAAAGAGAAAGTAAATGCATACGTTCCCCTCTCTCTACCCCATTAC AAAACATGTGCCTGGCGTATGCCTTCTTAATCTTTCACCATCTGGCTCTT TAGTTCGCGAAGTTTCTAATTGCAAACTTCTCTAATATGGTCTTCCAATT GGCATGTAGTTTTNTGTTTTTAAAAATAATTTAGTTTCAGCGAATGAAAG TTTGTAAATTGCCTAAATATTTTATCATGATTAGCATAATTACGCATGAA TTAACATATTTCATGCATGGATCGCGCATCGTGGATCTTAAATCGTTAGA TCGTGCATCTTAAATTACACCAACCCGTTTATTACGCTCAACGGGTGCTC AGGAAAACGAATTTTTCGGTATTTGAAATTCCCAGTTATTGAAAGTAAAT TCTTATTCCCCTTAGAGAGAATAACCTATTGTATCTAATTGTACGTTTGT TAGCCGAGCGATCTATAAGGAAGGCTCTCATGGTTGGCGGATGAGGTGAA TCTGCTCTTTTTTCGTACGGAAATTTTCCGTGGCGGAGTTCCCGAGTCGA GGTCCAGATTTAAAATTCACAGGTCGGATAAACCCGACAACGGCAAATAA TGTAATCATACAATTTTACGCTTTGGAAAATAGAAAACGGTTATAAGATG TGGTATCGGCACGGAAAGGCTTAACTACACACTTCTTTATAGAAAAAGTG AACTATGAGCCTTGGATGTTCTTAATTTCTCGAAATTTTCATATGCTTAT TATTTTAGCATAAAGCATAAAATGAGTATAATTTTATAAGATTGCTCTTA TAACAAAAAGCTTTCTATGCTAAAAAAATATGTCTGAGATTGATAGAATC TCTTTTTCTTTCAAACAATCTCGTAAACGTTACTTTGAAAAGTTTACCTA ATGTTTTTTTATCACAGATCATTTTTTATCGAAATAAGGCGTGGTCTGGT AAGAAAAAATGTTACCTCCTGGTATCTAATGATTTTCTTTATCTGGCTAA TTGAGAAAGTTTTTGGGAAATTTTAGAACCTTATTTATTTTGATTCGACA GATTTTGTTAGAAGTTCAAACGGATTATAAATTGTTTAGACGTTTAAAAA TTTAGATAAAAGCAACAAAATTGATCCCATGATTTGGAGGGTAATTTGAA AGGTTTTCGTTTAGAGTGGTCGATCGATAAAACATCGTAAATGCATCATC ATCATCATCATTGCTCGACCGCAATCGAGACTAAAAAAAAAAGAGACTAA AAAAAGAGAAAGTAAATGCATACGTTCCCCTCTCTCTACCCCATTACAAA ACATGTGCCTGGCGTATGCCTTCTTAATCTTTCACCATCTGGCTCTTTAG TTCGCGAAGTTTCTAATTGCAAACTTCTCTAATATGGTCTTCCAATTGGC ATGTAGTTTTCTCTCTTTAGCTGGATTTACAACATTTAAGTGTGAACTAA TCCATGCTTACTTTGCTCAAACCCTGTCTTTGTACAACCCCAACCGTAAT ATTGGGCACATAAGTGGAATTCCCTCAAATTTGAAAACCGCAAGTGATTT TTAAGTGCTTTAAAGTATGGTTGGAAAGTAGAGCTTATAGTATCTCAGGA TCTAAAAGCTCAAAAATGTTTCAATAAGGCTGAGAATATAGCCTGGAAGC CACTTAAACCCTTCCAAAATCGAAAAATCCAATGAAACAAAGTGGAAGTA CTGAAACTATAATTTTCTTCCGATCTTTAAATTCTGAAAAATGTTAAAAT ACCCAAAAGTCCCAATATATTTCGGCGCCGATTGTACCATAGTTCTTAGT GAAACGCAGATGTTAGAATCTACCAAAGCAGAACTGTCAATCATTGCAAA AATCTTAGCAAAAGTTGAAATAGAATTAGCCTCAAACTATAACCTAATTT GTAATAATTTGAATTAACCTAAGCTTTCAAAAAAGTGTCTATTTTTTGAC AGCTTAGACTAAAATATGTAAGGGTCCCCAAAACGACCCCCAGATATATT ACGATTGACGAAAAATGTATTGTCTTAAAAAACGTAATTTTGAATGAGAG TATTTCTTTCGGGACTACACTCTTTTTTCAGAATTTCAAGGTCTACGGTT ATCAATCATTTCCTTTCAATGCGACCTTGAAAAATCGCCGACTTGTTACC CATTTTCGAGGTTAGGACTATAGCGTCAGTCTTTTGCCCAAACAACAGGG GGGGGGCACGCAGTTACTACAAGACAGTATGACACTTACTACCGTGGTGG TACTGTATTCAGAAGTTATGAAAACAGTTACTACACAGTGTAGTAAATGC TGTTTGGGGGTGGTGCCAAACACTAAAACTTGCACTTTTGGTGTAGCAGG TGCTTATATTTTAATTCTTTTCAAAGAACTTTCAAAATTTGTGAAAAAAT TCTTTGTTAAAAAAATATTTTTGTTATAAATGGACGAAAAAAATTTGAAA TTTTTCTCAGACCAAACTTTGAAATTATGTTTACCCTAATTATCATTAAA ATGTTCTCAACAGCTATTTAACCAAGTAAATTAAAAGAAAATCTAGCACA AAAATGGATTTAGGTTGAAAAATAATCGCAACTTAGGGTAATTTTGAGTA CCGGTATGTTTTTGATGATATCACTCAAAAACAGGGGTGGTACCTGGAAA TCTTTTCTGAAAACAGTTACTACCAAGGTGTAGTAACTGCAAAGGGTGGT GGTCTTGAAAAAAAGTGTTGGAAAAGCACTTACTACACATCATGTCTTGT AGTAACTGCGTGCCCCCCCCTGCAAACAAAAGGTTTGTCATGCCAAATTC GCGGGCTCCCTCCCAAAAAATCGGGCCACTTTCTTGTCAAAGAATAGAAA TTGCTACTCTTCCATCCATTGGTTTTATGTGACCGATTATGTAAAAGCGG GCGCATTCGTAATTTTGTTGATTGTGCCTACTATTTTTGGATAGTTTATA AATATCTAAGTTGCGATTGGTTCTCGATCTGTAGTTTTTGACAGTGTTTT AATCAACGAATTGCGATTTATATTGCATTCTTTCGATCGCTTTCAATTAG TAAATTTTGATGAGGCTTGGCCGCTGTTATTTCTTTGGTGCCGTAAGCCT CGTTTTTCTTAATTTTAGGGCAAAATGAGGTACTTTTATGCCTTATATCC AATTTTTTTTGGGCGATTTTGAGCCCTATTGTTCTTGTAAAATTGTTCTT ATAAAAAAGAGTATAATTGCTACAATCATGGGCGTATTTCTTATTTGAGA AAAAGCTCAAAAAATGTTCAAATTATGCTGCGAATAAAGCCCGGAAATTT CCAATGTTATAAAGCGAGAGTACTTAAATCGCCTTTCTCGCAACAACTTT AAATTCTGAAAAACCCAAAAATCTCAATATATTTCGGTCATGATGGTAGT ATCTAGTTTGTTTGTAGTTGTTGAGACAGTCGGACTTGTTAGGAACAAGG TGCTAGATACACCAATCTAAAAATAACATGAAAGTGATAAAAATTCTAAA ATTTTCAATTAGTTTTTTTACTCTTGGTTATAATTTTTTTAAATCAAGCT ACATAATAACTGTATTTTGAAGAATAATAAGCTGATAAGACGATAAGCTG TATGATGAACTTTTTTTATAAGAAGTTGAATATTTCAAGGAAAGAGAGCT TAGGGTACCTGAACCTCTTTTTCTTCAAAATCAATGGTGATTTATTTTGG ATAAATGGGCCTCCCCAATGGGCTCGGCGGAAGTGGGGCGACTGCTTTTG AGAAAAGGAGATTTTTTTCTCAAATTCCTAGTGAATTCTATCCCATTTGA GCCTTCAGTCTCCCCACTTTTACGGTTGTTCCGCCGGGTATGCGCCATAT TGACATGACTTGTCGCCGATAAAACAGTTTTTGAGCTTTTTCTCTCGCTT ATTTCAAGATCTCGTCTAAATAGCATATTATGCTCTATCCTAGGATAATA TAGCCTATCTGTTTTTGTTTCATTTTTTCACGTCTTTCTATTATGGCAAA CTTGTTATCACTATATATTTTCAGTGATAAATGTATCTGTACGGTTGTTG GTCTTTTTTTAGGCCAAGATTATTGAAAGAGATTCGGGGGATTCCTGCTT CAAGACTGAAAGAGGAAAAGAAATATTCTTTTTTCTTTCTTTATTCTAGC TTAAATTTAATACTATTCTGATTCAGGTCAAAGATAAAGTTTCCTTATTT TCTTTGTAAAGGGGAAGTTTAATACAGCAACACAACTGAAAAAAAAACAG ACATGATTTCATATTTGGGCTCGATTTTGTAGATTTTGTTTTTATGTAAC ATTTTTCGTTCTCTAACTTTTTTGAGATTCATGCTTTCGTACGAGAAAAA ATATTAGGATTGGTATTTTAAGTTCAATTTGAGAGATTGGTATATGATTG TCTAAGCTGAACTCTTCTTTGTTTGGTATCAGTTCGAACCTACACGTTTT TTTTTATAAGAACAAACTATATAAGAACATAAGGCTTCGAGGCCCAAAAA TTTAAGAACATTCTAAGAACATTCTAAGGCTTTGGAGACNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGAGACTTAAAAACATGC ATTTTCTTAAGAAATTACGTCAAAATGCTCAAAAAATGCTGAAAATAAGA ACATTTTAAGAACATTTTTAGGCTTGAAATCCTAAAAACTGAGAACATCC GAAGGCTTCGAAAATTTTTGACGTTCTTATAAAAAAAAAACGTGTATTTT ACAAGCATGTCTTTTACATGTTTTACTTTAACCCTTAAGAGAAAGGGTAT TGTTCTCAAATTGTTCTGATTTGAGTAACTCTTCAGCCGTTGCATGCCTA TATTATTCTATTTGAGTAAAAAAATATAAAATTTTGACAATTGAAAAAAT GAAGATGAAAAAAAAATCGATCAACAACGACAACGACAACGTCAGTCAAC CTGTCGTTTCTGGTCGGACAAAGTTATGAAAAAGTTAAATTCAAGCTATG TTAAAACGTTTAAAAAAGTTATTCTGTCAGTTTATTCGTCAGCATCGGTG CGAAACTAAAGACAGTTTGAAGACTTCAAAAATTTGGATTTGAATTTTTA ATGGGTACACTAACTTCGAATTCGAATATTTTAGATTTTCCTTTTTTTTC ATTTTGACTGTTGTGTCCTATAGAATTGGGCCTTTAAAAGAATTGGCAAA TAGATATCGAATTGAAGTCAATACGGTTTGCACGTCCGAATATATAAACC AGTGAATGTTTGGATTTTTTTTAAATTTTCGACGAATGAACTTTTGTTCT CCGTTCTTATTTCATGTTTCTTGGAATTAGAGAAAGAAAATTTTTAGCAC ACTTCAGAATGGATAAAAAGTAAAAACACTCTCTACCCTTTTCTAGCTGG TAATGTATTTGTAGGGGTTGTTGAATCTTTTAGGCTTTTTAAAGACTTTT AAGATAAATTTTATTTGTTTTTCGAAAGTTTTTCTACCTTTTTCTTTTTC TGAGACTTTTCCACGTGATGCTTATTTTTGTAAGAACTAGTGAAAGTTTG CTGAGCCCTGGCTGTTCGTTTCGTTCCTAAATTGTCCTTATGCTATTCCT ATTTTTGGGGTAAAGATTGATTAAGTTATTCCAGACTCAGAGCTGTTTTC AAATCGCTTTTAAAGGTTCTATTTTTACATAAGTGTTCCCGTTTCATATC AAACACATGTTTCATTTCAGAACAGTGTCTCCCTATTGTTATATAGTGCT GAATAAACAAAAGATTGTTTTTCTTTTCCACTCCTGACCAATCTTGCTCC ACTATTTGAAAGCGCTTGTAAATTAGAATTGATGAGTAAGCAAACGATAT CACTCTTATTTAAAAACAAAACCTTTAAAGTTAAACATTTTCGAGCTTCA TTGTTCTTATATAAAAATCGTTTTTACAAAAAGGGCCTACGTTTCTAGAA ATCCAGAGTAGTCACTAGATTCTAAGGGTAAACTCCAAAGGGCTAGGTCA TTTTAAATAATAGGAGTGACAAATGTACACGAACACTTATGGAAAAAGCA ACTGACAAATGTATGCTTTAGAAGTAGACAAAAGCTCCATTATCAAGAAC AACAAAAGAAAAATTGACTTAGAAATTAGGTATAAAAACTAAGAAAAAAA TACATTATTTTTTGAAGTCATTTATTGCTTATGATCCGGGGGGTACTAGG GTTGCAAGCTGACGGGGGGTGCCGCCTGACTTTCGAACTTTGGACCCTTA CCGGGACTAAAAAGGAGAAAACAAAGGGAAATCTTGGGAATTTTACGACC CTTACCGGGACAAATTTGACTTGACCAAATTTCGATCTTTCAGGGGGTAA AAAGTTGAAATTTTCCTATGATTTTTCCGACCTTTAGCGGCGGGACTTTG GAAGTCCAAAAAAGATACCCTTAAGGGCGGCACATACCGTACCCTCCATT TGCCTAAGTACCCCCCCCCCCGGGTTTTGNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAT AATAGAAAAAGTGTACCTAATCTATCTTCGATAGAAGGAAAACTTTTATA AATAGTGCATTATCGAAACATTATCAAAATATATCTCAAATAATAATAAT GTATACAAGTTCAAGGCACACGACGGCCTCTGAGAACCGGATCTTTATTA CAATTGTCTTGTCTCGAATCTTTTCGGATGTTTTTTCCAAGCTTCGTTGA GTCTTTCTTTAAAGATTTTGACAGTCTTTGCCTCTACAACGTATCTTGGT AATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT ATACTCCTGTAAAAGAACGAGTTGGTTTGTGCGCCTCGGAATCCATCTTT ACCAAAATTTGGTATCAGCTCATCATTGTGTCTCCTGTTCGGACGTGTTC GAATCGATAATTTACTTGGAAGAGTATTTTTATCGTAGTAGTGGAGTTGT TTGTATACTTGGACCATATCACAAAAGAGTCTCCTGAATTCAAGCGTGGG GAGGTCAAGTATGCGCAAGCGTTCTTCATAGGACATATCTTTGCAGATAG GCACGAGTCTTGTGGCGCGTCTTTGTACACCCTCGATCAAATTAACATAT TTTCGTAGGACATAGTTTAGGTGACCATACCGACTGAGCATACTCCAAGT GCGGACGGACAAACGAAGTATATAGTACTAGGAAGATGGATGGATTCAGA TGTTCAAAGCTCCTGTTGATCACTCCTAGTATTGAATTTGCCTTCTTTAC CTGCTTTGCAATATGCTCCTCGAATGTAAGTTCTGAGTCGATCACAATCC CAAGATCTTTCTCTTCAAAAACATGTTCAAGCTGATTTCCATCCAAACAA TATGGATAGGCATGTTTGATATTAGAGAATTTGCCAATAGTTAGTACGTG ACATTTGTCGGGATGGAAATTTAATAACCATTCTTTCGACCACTTGACTA GCGCGTCTATATCCTGTTGGATNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTCAT CAGCAAAAAGGAGTATAAATGATGATATCACTCTTTCAGGAAGATCGTTG ATGTAAAGAACGAACAATAACGGTCCAAGGACACTACCCTGTGGGGTACC ACTAATAACGTGATCCGTTGTCGAAAATGATTTATTTACTTTCACTGATT GGGTTCGTCCATTTAAAAATGATTTTACCCAAGACATTATCGGACCATCT ATGCCGTATGCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTCTCGCGGCGATGATTTCATCCATTTTCTATGTAGACGCTTTTT CTTTGCTATTTCAGTTCTGAGATCTTTTGGAATAGGAATTCTTCCTCTCT TTCTCCAACCCTCACCTCCAATCGTTTTGAGCGGGATGAAACGGTTTTGC TCACTAAAGTCGATCCTTTGAAAAGAAAAAATCGAATTTTTTTTTCAAAT GATAGACTCTTGGAAAGTTTATGCACGTGTCACGGGAGAAATGAAGTTGA GTGATATTTTGATTTGCGTAGTATTGGATTATCCCTTTAAGATAAAGCAA TAAATCGAAACTGCTAAGTAATATAGAAACATTAACTTTTAAGACAAGTA GAAAATCTTCATTAGAAGAATAATGAAAAATGATACAGTTAGAGTAAAAG TGATACTTTTCACTCCAATAACAAACTGACATTTTACTTTGATGAAAAGT TTTTCTTTATTGAAGAGCAGTGAAAAGTTGATAAAAACGCTTGGTTGAGC AACGGCAGTTACAGGGGGCCCCCTTACAGAAGGTACTGAAAATTGATAAG GAGAGTTTTTTTGTTATATCTCCCCATACAAGAAATGTTGAGTACCTTCT GTAGCCACCTTTTTAAGAGTTTCTGTTGGACCATTATTTTTTTCAGATTT TTTGCATGATAGTTGTCTGAGGGAGCCTCATTTTCAAAGAAAGTTAATTG GTAAATGGTAGCTGAAGCAAATTCTCCAAAAAATATTTTTGTCTCAAAAT CTGAACTAGCTGTTTGTTTTCTGAAGCATCGTGAACTGAGCCATGAAGAA CACCGGTATTCAGTGAAAAAGAATAACTTTCATGTAAAATAATGGGAAAA AACAACTTAAAACGGCTAAAAAGTGCAAAAGAAATCAAAATTTTGATCCT CGGGTATCAATCAGGCCAAAATAAACGCCCATCAGTTTGGGTGAAGACAA GGCGTTGTAAGTTTAAGTCTTTGATCTAGGTATTGGAATAGTTACTAATT CATCATTCGTTTAATTGTTGTTTTTGTTTTGTTACCATAGGAACAAAAGA AAGGACACATCGGATGTGTTGGACCAATCGTAATGTGGATAACCTTTTAC GTGTTTTTGTTTCAAACAGCGTTCGGTGATATCAAAAGTAAGTCTCCCCT ATATTCTACTGATCAATTATTAAATACACTGTTACGGATTTAGAGGAACA GAATCGAAACCTTATTTTAGCTTTTGTAGTTAAGCCTGGTGTATCAGAGT TTGAGGCACGTGCAGACTGGAATCTAGGAAATACGACCAAAAGTTACCCT ATGGACCAATGTAAAAGACGCGAGTTGCAATAACAATCCAGTCCTCTCGT ATTTTTACTTTGATCCTGAGAAATCGAAAATTTTAATTACGTTTGAGGAA AAGTGTAAAGTGAGTATCAGGTTGGGCTTAAAATAAAACCTGCGAATGGA CTACTTTTTTTCGGGCTCAGTCTCAGCAATAACAAATAATTTATGACGTA ATTTTTAACAAAGTTGTTCCAATGTTTTAAGAAAGGACTTATATCGATTT TACGGGAACACTAATTTTGGTACAAGATTTTGTAGGGAAAAGTTGTGTGA AAAGTAACGAAAATGTCTCCGGGCAACGAAGTTTTTCCCCGTCGAAGTTC TCCCGACATTTTTCTCTGACATTTTCCCCGATGAGCTACCTTATCGGGGA AAACTTCGTCGGGGAAAAGTGACGAAATTTTGGACAAGTGACGAATTTTT TCCCCGACGAAAATTTTCCCCGGCCTTAATGCGTTTACCAACTACCAGCA AGTGACGAATTTTTCCCCGACGAAAATTTTCACCGACGAAAATTTTCCCC GACGAAGTTTTCCCCGATAAGATTACGCAGTAATAAACTTTGAATAAAGA GAAAAATCTATGTTTTTAAGAATCCTAGGAAATATATCTTTAATTAAAAC TTCATAGTTAAGGCAACCCCTTTTTTCAGTGGGTTCCCTTTTCTGTTTGA ATATTTTCCCCGTTAGGGATTTAGTATTGTTTTTATTTAACGGCCAAGTT GAATAAGAAAATTAGAAATAGAAAGAAACGTTTCTATAAAAGGTTCAACT TTTTCACATTATGGACTAAGGGTTTTTTGTGTTGCTTGAGAAAAAGGGGA TTCAGTATTACTATTGGGGAAAACTTGAATTATTGATTGGACCAACCAAG AAAAAAAAGTCTTAAAATAATAAGATGATGAAAAATAATGAAAATAAAAA TGGAAGATCACAAATAGAAGTGAAAATATATATAACAAAACAACGACAAA AATCAATATATTATACATCGCACAAAGTTAGGAAAAAGAAAAGTAGATGG GAAATTAATTACTTTGAGATTTTTTTTGCGCCAATAATTATCTTTCCTAA ATTTGTCAATTTTTTTCTTTTTTCTTGAGTAGGATTTGTATTTTTTTTAA AGATAAATCGAAAAAAGGAAAACCTATCTATCGCTGAAGAAGGAAATTAC GTTTTGATTTTTATCAGCTCTTGTAATTGTAAAATGGATTTTTTGACCTC TGAAATATTATGTTTAAGATTTTATCGGATTTTATGGCATACTACTATTT ACTTCCTAGTTATTTTGTTATAAATTGATGCTTAGTTTTGATTTAACGGT ATAATCAAATGGTTTGAGACCTTTGACCTTTAGATTCCTCTTTTCGTCCA AATCTTTGTTCGTAAATAATCTCAAGTGAAGATTATTTAAGATTACAAGA TTTTTGACTTAAAGCGCTCTCTAAAGATAATTTCCTTCGAAATGAAAACA CAGAGCTACCTTATCTGCATATCGGATTAGGATCTTTGCTTCCTAAGAAT AATCTTATAGTGTCAAATTGATTTTCCTTGTTTAAACTTGTAATACTAAA TCCTAACCACCCTAACACTTTTTCTCAACATTTCTAACGTTGAAGTTCTA TCATTATTGCTTTTCTACTCGTAGAGGTTAGAATTTTGTATTACAAGTTT AAACAAGGAAAAATCAATTTGATACTATAAGATCATTCTTAGGAAGCTAA GATCTTAATCCGATATGCAGATAAGGTAACTCTGTGTTTTCGTTTCGAAG GATATGACCTTTAGAGTGCAGTTATTTCCCTAAATATTTTGATTATATTA ATGGCTAATGAATGTGATTTTTACACACTTTCGTTTTCTAATACTTTTCT TCAAACTAAATAACATGTATGATGAGATTGGTCCAGAAATTGAAGATTGT AGGATTTTAAGATAACTCTAAAATATAATATTGAACGTTAGGCATACTTG GGTGTGGTACTATTGTCTTTATCAAGGTGCCAAGACAACCAAGTCGTACT TTTATAAGAACTCTTCGTTCAATGGCTTAATTATTATTTGGTTGTGCTTA TAAAAAGATTTAACAAATTACCTAATATTATACTGACTACCAAACTGAGG AAAAAGGTTTCGAAGGGAACATTTCTTCCCCCCCTCTCACGGTTATGGTA CGACCAAATCTAGTTTCAAGCTTGATTTTTCTTTTGTAATTATATTCTTT TTGTTTTCTTTTCTTGTTTTTAGACCTTTTTTTGTAACACCTTTTCTTTT GGCACTTCTTGCCTTCATCTATATGTTATCACCAGAAATCATCTTAAAAT CAACTTTTCGGATCTTCACTGTTAGATAGAATTTGATCATAATACCAAAG TGTCGACGTTTAAAAAGCTTTTTAATAATAGTTTTTGAAGAATAAGGGGT GTTGAGAAATATTACTTCAATGCTGATAGAAAAGGCTGCAAGAATTATTC CTTATCTTCATAGTTTCAGAAAGGTGTATATCTTTAACAATTATGATTTA TAGAACAGATAAGAAATTTTTTTAATAGAAAGTTAAAAGAGGAACTGAAA AGGAAATCAAAAGGGGGACATTACCCTCTGAAAAGCCCTGGACGCGAGCA ATTAAGCCACCAAAGATGGAAAAAATTGATATCTTTCATCCTTGAAAAGA CTTTTCGAAATCTTGTGATAAAGAAGTATTCACAGTCGTTGGTCAATTTT TACTGGCGCATTCAAACTTCAAGATTTCCTAAATCGAAGTGAAGTCTAGT AATATACAAAATCGCACGTGCTTATCATGCTTGTTTTTTATATGATGGTA TTGTGTGCGGCTATGTCAACGAATCGTCATTTTTTCGCTCATTCGTATGA TAATAACCCATATCCTGGCTTCAATCTGGGTATGTTTGGCAATCGTGGAT ATTATTTTAATCTAGGTCCGTTGTAGTCATTCATTGCTTCGTTCATTTTT TAACCTCGTTGCCTCTCTCAAACTGTTTCATATATATACCAGCCAGTCTG TTTACCATAAGTGTTAAATCATCTGGCTTTTTCATATGGAAACCATATCA GTATGATTTAAACTGAGTTTGTTTGTGGGTGGTTTCCACCTGGTAGCAAG AAAAGTGCACTCTAATGAGAGCTGGAATATCCGATTCTTTGCTTACTTTC GGCTAGTACGATTTTTTGAATCTGTCGGTAAATATTACCTTCAATCAAAC TTAATTGAACAACTCGTACCAGTGTTCGGAAATTCCTTGCTAATACACCT TTTCGACCGTAGCCACCAATTGCCGCGTGGGCATTTTTTTTTTGTCCGTT AATCACCCTAAAACCGTCCCAGTCTTTNTCCGATTCTTTGCTTACTTTCG GCTAGTACGATTTTTTGAATCTGTCGGTAAATGTTACCTTCAATCAAACT TAAGTGAATAACTCGTACCAGTGTTCGGAAATTCCTTGCTAATACACCTT TTCGACCGTAGCCACCAATTGCCGCGTGGGCATTTTTTTTTGTCCGCTTT ACCACCCTAAAACCGTTCCAGTCTTTTTTTTGCACCTATAGGCAATAGAA AAAAGTCTAAAAAAGCATTAGACTAGCAAACTAGTCTGTTAATTAATCAT ATCAGAGGGGGGGACATAAAGGCGGCGGGCGTTTGCTAGAATAGGAGCTG CGTAGGAGAGCGAGCAAAAGTTAGTGAGAGGCTGCTGATTAATAGGCACG TACCTGACCGCGCGACTACGGTCGAAAAGGTGTATCAAACTTATGTGTCC TTTCCCATCCGTCATCTTTATAGATTTGATATTTTATAAAGATGATCATT TCTCCCTATATTGTTGTCACAAATCGAACAGTTTGGTGCATCCAGACTTT CAAGCTCTTTCTCAGCCAAAACCATAAGATTTAACATTAAATTATATCGT TGTCGATTTGATCATAGACTTCACAGCCGTGATTTATTCAAACCCCTGTT ATTTTCATTTTTTAGCCTATGAAAGTTTGGACGAAGGTGAACAGAGGCTT TTGAAATATCTGAAGAATTTTAGCGTGAACTCGAGGCCAGTCAATATCTC ATCAACAGCTGTATACGTTAATGTTACCATGGAAATTGTTCGACTCGATG CCGTGGTAGGTTTTACTCATATAGCCCGGTTTTTTTATTAGTTATCGGGT GTGTAAAATCCTGCTTTGGGCGAGGTTTTATCGATTTGGAAAGGAGCGGA AAATGACATTCGGTCTCCACATGACGTTTTTTCGGTCAATGAAATTGCAA GTAACTTGACTGTCGGATAAGCTTCATATTTTCTGCAAGGCTGACGTATA ACCGGATAAGATTTACATATTTTCTCTAAAGTCTACTTATAGTGTAAAAG CTTTTACCCCCAACTAAGAGGTCTTAATAAACATTCGGTTGTCTGGTGAT TGTATATTGATGGTTGTCTATAGTTAGGGACTGTACACCCTGGTAGAGGA GCAGATTATTTTCGTCTTTTTTAAATCACTTATTGGTTTCCTTACGACTT TATTAAAAGCAAAGACTATTCGATTCTTAGTTTCCATCTGCTTTGACTAC CCTTACTAGTAATATAGATATTGGGTGTAACAATATGGTCGAATATATTC GTATACCGGCGCCGTCTCTAGTTTAAGAATCAGTTCTTTATCTCGTCTAG ATTTTTATTTCTAAAGATCCTCATCTTATTGTCCCCCATATGAACCCTTC AAATTATTTCATTTTCTTTTCAAATATTCGTAGATTATTTTATCTTAGGT TTTCTTCCTTTATTTTCTTATAGAGTGAAAAGGGACAGTCTGTTCGGATG AAATTACATATTAATTATGTAAGTAATGAAACATTTTGTGTCTAACTTTT TTATCCCTAAACTAACCCTCCTTATCTGATCTCTAAGACTGAGAGTACAC TATCCAGTTTTATCATCTCTACCATTGTTGCCGGCACCATGAAGTCATAT AGGGCCAGATAGGCAAACTTTAAGCTTTCCCAGTAGAGTAAAAACAAAAG ATTGTGCCCTTTTTGTATCGGTTACCGGTAATCTTTTTCTTATTTTCAGC TTTGGAGGAACCCATATTTAGTATGGAATCCGCTTAACTATAAAGGTGTT TCCGAAGTCATTTTACCCGAAGGTGAAATCTGGATACCGCCCATACGCCT CTTCAATGAGTAAGCACATTTTTCATCACCCTAAAACGCCCTGAAATATT AAAAATCGAAATTGAGAATGAACTTTATTTGGTAGTCCAATTCAGTTAAA TTGCGCCCCTGTTGCCAACTGTCTTTTTTTCCCCTCTTTGTAATTATTTT CCCTGAAAATGTTCCTGGAAGCTCAACTTACATCATTTTAGGGGCCTCGA ATTCATCCAAGTTTTTTTTCTGTAGGATTTCCTACAAAAAACTAAAAGTC CCAAGACATTTTGACGTTCAACAAACAGCCGCTTTCAACTTTATCTACCG TCTTTATTGTTCGAAATCTCTTGCACTGCGATCCTTTTGCCACCTTTCCT CTTCTTTTCCTCTTTCTTCAAACTCGCCCTTTTTTACCCACAGTTTTAAT TTATTTTAAAGAAAGAAATGTTGTAAATGCCTAATGGGGCATTATTCTTT TTCGCCGTAATGAAACCAACTGCACCTAAGATAGTGATTCCACTGAAGTA CAGAAAACTAGTAAAGAATCTCAATTAGTATTATTGCATTAATTTTCAAA AGATTAACTTTTGTGTTTTTGCGAATTTCGGCGAAATTGCCGACTCAGGG AATTAAATCCACGCATTCTGTAACTCTTTTTTTTCGAGGGAAAATAACAC TCGAAATCTTCTTTACGGAAAATTGGGATCTTTTTTAGCTGATTTTTAGT CCAGAAATTTTAGGCATTACTAACGGGCAAAATAATCTTTCTCGTTAAAA TCATCAAGACAATCCCTAAAAATGATGCTGAAAAATATTTCTCTTTGAAT TTCCTGACTGACTTAGAGAAGTCTCTAAATACGGGAATATTGCTTTCTTT TAAAAAGAAAAACTGTTTTTATAATGACTCTCTTGGTTAGGGGTTAGTTC CAAGAATCTTTCTTAGCTTTTATCCAACAAGACTAGAAAAGAAAAAATAA TATTTAAACAGCGGTTTTGATCTGAATATTCTTTCCCAAAAAATTTGTTC TATATTTAGGGTACTATTAGGCAGGTGCCTCAAAAGAAATATGTAGATGT TAATTTTTTATTCTCGCCCCCTCTTTTTCATATCATTTCTTCCACATTTA CTTTTCACTTAAAAATATATTTGGAAAAAGTCATATCAGTACGAAAAGAT TAATTTTATACATTTAGAATGCGTACACTTTACTTTCCGAAAAAAAAACC CATGGGGCCTAAAAATAGAACAAAAGATACAATGCTAGTAAAACACCCAA AAGCCTGGAGCTATCCTATTATGTAGATTTTCACATCCTCGAATTAAAAA ACACTTTCAAAATATTATAAACCTTTTTTACCCTGGTGATTTTTAGAAAA CTAAAACTTTGTACCTTTCCTATCTTCCAAGCTTTTCAATTCTTTCATGC AGAGCGAGCAAAACACAAGGTGAATACAATGAGGACAATCACGCGCGGAC CGTGCTTCTAACGAATGATGGCAACTGTTCACTAACCTATGCCCAGTTCT TCAAATCCACATGCGAAATTGATGTCAGTGATTTTCCATTTGACCAGCAA TATTGCGATATGACGTTTGGTAGTTGGAGTATGGATGAACGGTTGCTACA ACTGAGAGCTGTCAAGGAAGAAGCTATATCTGAGCAATTGTACAAGGAAA ATGGTGAATGGCATTTAACTGAAGCCACATTGAAGACCCATGATGTACGT TTTCCTTGATCATATTTTTAGTTTTAGTTGAATTTCGGTTTCTGGAAAGA GTACCACTTCCAGACTAGAATCCAGTTGTATTCTTAGAATTAAGAGTAGA TGTACAATCAAATTGTAAGACAAAGTAGAATACAAGCTTCACCCCCTCCC CNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNGTCCCCCCCGTTTATTGAAATTTCAAAAATT TTCCAACCCCCCCGTTTATTCCAACCCCCCGTTTATTTGGCACCTAAGAG TAAGTCCATGATTGTATAAACGTCATCGATCAAAGGTGTAACCTTTTGTT TTGGTGCTTTATAAATTTTTACGATTAAATCTTAAACCTGCTAGCCTAGA AGAGGACTAGTAAGTACTCTTAGAATGAAAATAAGAATTGTATTCTGAGG GAATTCTTAGTTTCAATTACTATCAACCAGACAGATCTTCCTCGATTTTA ATAAATCATAGTAAAGATATTCTTTTTTTATGCTGACAGAATAGAGTTAA CAAAAGAATTTCTCAAAATTTGTCCTATCACGTGACGAAAGTAACTTCTT TTGTTTAAAGATAAAGTAGTGTGTCTTTTGTTTTTAAATCAGAAAATTCA ATGGGATTGGGGAAGATAGCACGATATTTTGCAGTGAGGATTTGTTTATT TGATTATTTTCAGTGGGGACAAAAATTGGACGATGATTTTCCACCGGGGA CGATATTTTGGCAAAATTTTTCTTTTTCTGTGAGAAGGGGGTGTCTTCAA ATCAAGGTAGTTTGAACTGTAAGAAAAATTTTCCTTTTATAGGTCAGATA TCCGATTCACCGTCACAAACACAGCACCATCAAACTCTCCATACTCATAA AGCGAAAGTACATCTTTTTCATCATGAATTTGGTGGTACCATGTGCTCTC ATTGCATGCATGATTTTCTTGGTGTTTGTACTACCAGCCAAATCAGGAGA AAGAATCTCTCTTGGTATTACTGTCATGTTATCTATGGCTATCTTTCAAG AATTGTCGTCAGAGAAATTGCCAAGTAGTTCTGATAACTATCCGTTACTT GGTATGTATTACTACAAAACTTTGAAATATCTTTCCAACTAGTTTTGATA GATTTTCAATTTTGTGCTCGCTGAAAAAACTGACTGCTAGTAGAATTTCT AACAATTTTTTTAAAGGTTGGAAATTAGGAGGACAAAAATATAGCGTTTT AAAAGCGTATGAGAACCACTTTTCACAGAAAAAGAACTTCTACCTAAATC TTCACTCTTAATTAAAGAGTATGTCAGACATACAAGAATCACACATGGCA ATAACCTTTCTGTTATCAAAATTCATTACATNTTCTGAGGGAATTCTTAG TTTCAATTACTATCAACCAGACAGATCTTCCTCGATTTTAATAAATCATA GTAAAGATATTCTTTTTTTATGCTGACAGAATAGAGTTAACAAAAGAATT TCTCAAAATTTGTCCTATCACGTGACGAAAGTAACTTCTTTTGTTTAAAG ATAAAGTAGTGTGTCTTTTGTTTTTAAATCAGAAAATTCAATGGGATTGG GGAAGATAGCACGATATTTTGCAGTGAGGATTTGTTTATTTGATTATTTT CAGTGGGGACAAAAATTGGACGATGATTTTCCACCGGGGACGATATTTTG GCAAAATTTTTCTTTTTCTGTGAGAAGGGGGTGTCTTCAAATCAAGGTAG TTTGAACTGTAAGAAAAATTTTCCTTTTATAGGTCAGATATCCGATTCAC CGTCACAAACACAGCACCATCAAACTCTCCATACTCATAAAGCGAAAGTA CATCTTTTTCATCATGAATTTGGTGGTACCATGTGCTCTCATTGCATGCA TGATTTTCTTGGTGTTTGTACTACCAGCCAAATCAGGAGAAAGAATCTCT CTTGGTATTACTGTCATGTTATCTATGGCTATCTTTCAAGAATTGTCGTC AGAGAAATTGCCAAGTAGTTCTGATAACTATCCGTTACTTGGTATGTATT ACTACAAAACTTTGAAATATCTTTCCAACTAGTTTTGATAGATTTTCAAT TTTGTGCTCGCTGAAAAAACTGACTGCTAGTAGAATTTCTAACAATTTTT TTAAAGGTTGGAAATTAGGAGGACAAAAATATAGCGTTTTAAAAGCGTAT GAGAACCACTTTTCACAGAAAAAGAACTTCTACCTAAATCTTCACTCTTA ATTAAAGAGTATGTCAGACATACAAGAATCACACATGGCAATAACCTTTC TGTTATCAAAATTCATTACATTATGAAATTCCTGATCGAACTTGATCCAC ATATTTCTTTTTATTTTCAGGTGTTTATTACACGACTTCAATGTTTGAAA TTGGTATTGCCCTGGTCATGAACTGCTTCATTCTTAATGTTTACTATCGC AACTATGAAATGCAGCCGTGGATGCGTCGATTGTTATTCGATAAACTCGC TCGACTCGTTCGAATCGATATCCCACATACTCGAACGCAGCATTACATTG ATCGAATGTCGACTGGTCAGTTCCGAGAATTGAATCCATTGGCTGAAACC ACCCTCAATAATACGGCGCACAATGCTCACAATATTGACGGTGAATCGGC ACTTGGTAACGGGAACGGAGAAATGTCATATTTTCCAAAATCGACGCTCC ATCGGGAAGACACACAGACTATTCAACGGAAAACCAAGAAGTTTTCTGTC AACCAAAACGGCAGCAGTAGCGATTTGACGTACACCAAATCGAATTTGTC GGCAAAAATTTCACTCTCTTTGTCATCTGATCCAAGTACGCGTATCGAAG AGCGAAAACTCTTAGGTGAGGACTGGAAAACAGCGGCTAGAATTCTAGAT CGCTGTATGTTAGCTATAGCGATTAGCGTTGGAGTTATCTCAGCACTTAC CATTTTTATGCAAGCGGCAAGGTTTCGTGAGATGTTTATTCCTTGAGAAT GCTCTCACTGCTTTGCTTACACTCAACACAAGTAAGTGCTTGCCATCTGT TGTTGCTATGGTAAATTTTATGATGTTCAAGGAGGAGTTATGGAGAAAGA AAGATGGTAGCACCATTACGTATTGCTAAGGTTGGTAACCCTTGGTTACA GGAGACCTCGTTTCATGGGTTGTATAAATGACACAGATACAATATCTATA AAAGCGAAAATTTGTTTCTACCGCAAAATAAAATGACTGAGTTGAAATGG TTTAGATAATGAGCTTATTAAACAAACAAAGCTAACTTATTATTAATAAT GCTTAGCTGATAGAAAGAGGAAAGTTTGTATTTACTAAAATCACTTTCAA ATCAAGGCCGCTTTTTACATTACGTGCTTGATGCAAAAACATAAAGAATG GCTTTGGCGAAACAATCTTGGCCCAAACATACAATCAAAGTAAAAGCGTC TCTTTGCNAATAATTAACATAATATATGCATGGATCGTGCATCGTGCATC GTGAATCGTTGGATCGCGCATCGTAAATAGACGATATCGCGTTTAGATAA ATGCAATGCATTCTGGTTTCTCGGGGACTCTCAAAGGAATTATAATGTCG ATTATATAATAATCTGGAATAGATTATAATTCCCTTGAGGGTCCCCGAGA AACCAGAATGCATTGCATTTATCTAAACGCGATATCGTCTATTACTCTGG TACATCTTTTTGTATTTTTCGTGTTGAGGACGGCAGCCTTGAGAAATGAG TACCATTTAGAAAAGTCAAGTAAAGGAATTGTCACTTGAAGTTTTCAAAT TCGCCGTAATTAGATTATACATTATATCTGGAAAAAGAACTTGATACAGT TTTTGGGTCCCGAGTTAAATTCGTCATAAGAAAAACTCTACCGTGATAAA AAACTTATTTGGAACAATAATTTCTTCATAGTACAGTTAAACATTTTGTA TGACTTCAATTTTCAATTCTTTTACTGGACATAGATATGCATTGCAAAAA CAAGTCAGGCTCGGATACAGAGGGAGGCTATAACCAATGGAGGAGAGTGC ACTTTATCATCGTATTACCTTATATGGAAACTAATTACTCTCCACGAATA AGATAGCCTACCTCCTGTATCCGACACTGNATGACTTCAATTTTCAATTC CTTTACTGGACATAGATATGCATTGCAAAAACAAGTCTTTTTTCAGTTGA TTTTAAATTTATACGATTTGATACATAACATATTATTCTATATGATACGG TAGTCGTATTGGTCGGAAAGTTTTTGGAATTCCTCACAAAAATTTGATAA ATTAAAGGTTATTTTTGCCTTTTCGTATCAGTAAGCAAATCAATGAAAAC TGCAATTGCAAACTGGCTGCAATTTGGACGTAGTTATCACACTCCCGACA GCTTAAATTTATAATATAAATAAACAAATTTTTAATTAACTGGAATTTGG ATTTCTAAGTTTTAGTACCAGATATGAAATCCAAATGCTCGACTAGATTG CAAATCTGTAAGAATTCATGCGACAGATATATTACGACTTTAAATTCGTG ACTTAAAAAAGACATAATTTAAATTAGCACTATTTATTTATTTATTTATT GAACATTTGTCAATATTTTGCTTTAATTTATTGTTTTTATAGTAATAAGT GTCGATTCTTCATAGTTTTGCAATCCTCAATATTTGTTTTCGACCCTCGT GAGTCCTGGGACGATGACCAATTTACATGTTTTTTTATAAGCATAAAAAA TTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000521XLOC_000521Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000889-exon-sc0000005-1575043694:1412404..1412445TCONS_00000889-exon-sc0000005-1575043694:1412404..1412445Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1575043694:1382309..1382405TCONS_00000889-exon-sc0000005-1575043694:1382309..1382405Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1575043694:1377991..1378130TCONS_00000889-exon-sc0000005-1575043694:1377991..1378130Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1575043694:1377278..1377322TCONS_00000889-exon-sc0000005-1575043694:1377278..1377322Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1575043694:1376937..1377046TCONS_00000889-exon-sc0000005-1575043694:1376937..1377046Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1575043694:1375252..1375543TCONS_00000889-exon-sc0000005-1575043694:1375252..1375543Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1575043694:1372505..1372763TCONS_00000889-exon-sc0000005-1575043694:1372505..1372763Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1575043694:1369793..1372175TCONS_00000889-exon-sc0000005-1575043694:1369793..1372175Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1412404..1412445TCONS_00000889-exon-sc0000005-1510915933:1412404..1412445Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1382309..1382405TCONS_00000889-exon-sc0000005-1510915933:1382309..1382405Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1377991..1378130TCONS_00000889-exon-sc0000005-1510915933:1377991..1378130Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1377278..1377322TCONS_00000889-exon-sc0000005-1510915933:1377278..1377322Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1376937..1377046TCONS_00000889-exon-sc0000005-1510915933:1376937..1377046Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1375252..1375543TCONS_00000889-exon-sc0000005-1510915933:1375252..1375543Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1372505..1372763TCONS_00000889-exon-sc0000005-1510915933:1372505..1372763Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1510915933:1369793..1372175TCONS_00000889-exon-sc0000005-1510915933:1369793..1372175Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1412404..1412445TCONS_00000889-exon-sc0000005-1491911889:1412404..1412445Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1382309..1382405TCONS_00000889-exon-sc0000005-1491911889:1382309..1382405Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1377991..1378130TCONS_00000889-exon-sc0000005-1491911889:1377991..1378130Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1377278..1377322TCONS_00000889-exon-sc0000005-1491911889:1377278..1377322Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1376937..1377046TCONS_00000889-exon-sc0000005-1491911889:1376937..1377046Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1375252..1375543TCONS_00000889-exon-sc0000005-1491911889:1375252..1375543Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1372505..1372763TCONS_00000889-exon-sc0000005-1491911889:1372505..1372763Clytia hemisphaericaexon
TCONS_00000889-exon-sc0000005-1491911889:1369793..1372175TCONS_00000889-exon-sc0000005-1491911889:1369793..1372175Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:1369793..1412445 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.00211844 1.93056 0.954591 0.412961 0.793172 0.353572 4.43989 3.58846 1.88827 3.37922 0.66908 3.68986 1.75787 0.924055 0.266642 0.494108 1.43305 0.682793 7.40499 5.45842 1.84169 2.60508 2.27619 1.69322e-07 0.600196 0.056901 0.0298849 0.878442 1.16619 0.981635
Blast
BLAST of TCONS_00000889 vs. Swiss-Prot (Human)
Match: ACHA7 (Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens GN=CHRNA7 PE=1 SV=5)

HSP 1 Score: 207.608 bits (527), Expect = 4.568e-57
Identity = 144/498 (28.92%), Postives = 245/498 (49.20%), Query Frame = 1
Query:  157 EGEQRLLKYL-KNFSVNSRPVNISSTAVYVNVTMEIVRLDAVSEKGQSVRMKLHINYLWRNPYLVWNPLNYKGVSEVILPEGEIWIPPIRLFNEASKTQGEYNEDNHARTVLLTNDGNCSLTYAQFFKSTCEIDVSDFPFDQQYCDMTFGSWSMDERLLQLRAVKEEAISEQLYKENGEWHLTEATLKTHDVRYPIHRHKHSTIKLSILIKRKYIFFIMNLVVPCALIACMIFLVFVLPAKSGERISLGITVMLSMAIFQELSSEKLPSSSDNYPLLGVYYTTSMFEIGIALVMNCFILNVYYRNYE---MQPWMRRLLFDKLARLVRIDIP-----HTRTQHYIDRMSTG--QFRELNPXXXXXXXXXXXXXXXIDGESAL-----GNGNGEMSYFPKSTLH-REDTQTIQRKTKKFSVNQNGSSSDLTYTKSNLSAKISLSLSSDPSTRIEERKLLGEDWKTAARILDR-CMLAIAISVGVISALTIFMQAARFRE 1596
            E +++L K L KN++   RPV   S  + V  ++ ++++  V EK Q +   + +   W + YL WN   Y GV  V  P+G+IW P I L+N A +    ++   H   VL+ + G+C       FKS+C IDV  FPFD Q+C + FGSWS     L L+ ++E  IS   Y  NGEW L     K  +  Y   +  +  +  ++ ++R+ +++ +NL++PC LI+ +  LVF+LPA SGE+ISLGITV+LS+ +F  L +E +P++SD+ PL+  Y+ ++M  +G+++V+   +L  ++ + +   M  W R +L +  A  +R+  P         QH   R S    +   + P   +  N        +DG   +     G   G M+  P    H     Q  +       + +     ++ Y  +    +             +E + +  +WK AA ++DR C++A ++   +I  + I M A  F E
Sbjct:   24 EFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE---RFDATFHT-NVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQ-MQEADISG--YIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILE-----EVRYIANRFRCQ-------------DESEAVCSEWKFAACVVDRLCLMAFSV-FTIICTIGILMSAPNFVE 495          
The following BLAST results are available for this feature:
BLAST of TCONS_00000889 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ACHA74.568e-5728.92Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top