Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000884 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000884
Unique NameTCONS_00000884
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3696

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000884 ID=TCONS_00000884|Name=TCONS_00000884|organism=Clytia hemisphaerica|type=transcript|length=3696bp
TCCTTATCTTCATAGTTTCAGAAAGGTGTATATCTTTAACAATTATGATT
TATAGAACAgataagaaatttttttaatagaaagTTAAAAGAGGAACtga
aaaggaaatcaaaagGGGGACATTACCCTCTGAAAAGCCCTGGACGCGAG
CAATTAAGCCACCAAAGATGGAAAAAATTGATATCTTTCATCCTTGAAAA
GACTTTTCGAAATCTTGTGATAAAGAAGTATTCACAGTCGTTGGTCAATT
TTTACTGGCGCATTCAAACTTCAAGATTTCCTAAATCGAAGTGAAGTCTA
GTAATATACAAAATCGCACGTGCTTATCATGCTTGTTTTTTATATGATGG
TATTGTGTGCGGCTATGTCAACGAATCGTCATTTTTTCGCTCATTCGTAT
GATAATAACCCATATCCTGGCTTCAATCTGGGTATGTTTGGCAATCGTGG
ATATTATTTTAATCTAGccTATGAAAGTTTGGACGAAGGTGAACAGAGGC
TTTTGAAATATCTGAAGAATTTTAGCGTGAACTCGAGGCCAGTCAATATC
TCATCAACAGCTGTATACGTTAATGTTACCATGGAAATTGTTCGACTCGA
TGCCGTGAGTGAAAAGGGACAGTCTGTTCGGATGAAATTACATATTAATT
ATctttGGAGGAACCCATATTTAGTATGGAATCCGCTTAACTATAAAGGT
GTTTCCGAAGTCATTTTACCCGAAGGTGAAATCTGGATACCGCCCATACG
CCTCTTCAATGAAGCGAGCAAAACACAAGGTGAATACAATGAGGACAATC
ACGCGCGGACCGTGCTTCTAACGAATGATGGCAACTGTTCACTAACCTAT
GCCCAGTTCTTCAAATCCACATGCGAAATTGATGTCAGTGATTTTCCATT
TGACCAGCAATATTGCGATATGACGTTTGGTAGTTGGAGTATGGATGAAC
GGTTGCTACAACTGAGAGCTGTCAAGGAAGAAGCTATATCTGAGCAATTG
TACAAGGAAAATGGTGAATGGCATTTAACTGAAGCCACATTGAAGACCCA
TGATGTCAGATATCCGATTCACCGTCACAAACACAGCACCATCAAACTCT
CCATACTCATAAAGCGAAAGTACATCTTTTTCATCATGAATTTGGTGGTA
CCATGTGCTCTCATTGCATGCATGATTTTCTTGGTGTTTGTACTACCAGC
CAAATCAGGAGAAAGAATCTCTCTTGGTATTACTGTCATGTTATCTATGG
CTATCTTTCAAGAATTGTCGTCAGAGAAATTGCCAAGTAGTTCTGATAAC
TATCCGTTACTTGgtgtTTATTACACGACTTCAATGTTTGAAATTGGTAT
TGCCCTGGTCATGAACTGCTTCATTCTTAATGTTTACTATCGCAACTATG
AAATGCAGCCGTGGATGCGTCGATTGTTATTCGATAAACTCGCTCGACTC
GTTCGAATCGATATCCCACATACTCGAACGCAGCATTACATTGATCGAAT
GTCGACTGGTCAGTTCCGAGAATTGAATCCATTGGCTGAAACCACCCTCA
ATAATACGGCGCACAATGCTCACAATATTGACGGTGAATCGGCACTTGGT
AACGGGAACGGAGAAATGTcatattttccaaaatcgacGCTCCATCGGGA
AGACACACAGACTATTCAACGGAAAACCAAGAAGTTTTCTGTCAACCAAA
ACGGCAGCAGTAGCGATTTGACGTACACCAAATCGAATTTGTCGGCAAAA
ATTTCACTCTCTTTGTCATCTGATCCAAGTACGCGTATCGAAGAGCGAAA
ACTCTTAGGTGAGGACTGGAAAACAGCGGCTAGAATTCTAGATCGCTGTA
TGTTAGCTATAGCGATTAGCGTTGGAGTTATCTCAGCACTTACCATTTTT
ATGCAAGCGGCAAGGTTTCGTGAGATGTTTATTCCTTGAGAATGCTCTCA
CTGCTTTGCTTACACTCAACACAAGTAAGTGCTTGCCATCTGTTGTTGCT
ATGGTAAATTTTATGATGTTCAAGGAGGAGTTATGGAGAAAGAAAGATGG
TAGCACCATTACGTATTGCTAAGGTTGGTAACCCTTGGTTACAGGAGACC
TCGTTTCATGGGTTGTATAAATGACACAGATACAATATCTATAAAAGCGA
AAATTTGTTTCTACCGCAAAATAAAATGACTGAGTTGAAATGGTTTAGAT
AATGAGCTTATTAAACAAACAAAGCTAACTTATTATTAATAATGCTTAGC
TGATAGAAAGAGGAAAGTTTGTATTTACTAAAATCACTTTCAAATCAAGG
CCGCTTTTTACATTACGTGCTTGATGCAAAAACATAAAGAATGGCTTTGG
CGAAACAATCTTGGCCCAAACATACAATCAAAGTAAAAGCGTCTCTTTGC
Naataattaacataatatatgcatggatcgtgcatcgtgcatcgtgaatc
gttggatcgcgcatcgtaaatagacgatatcgcgtttagataaatgcaat
gcattctggtttctcggggactctcaaaggaattataatgtcGATTATAT
AATAATCtggaatagattataattcccttgagggtccccgagaaaccaga
atgcattgcatttatctaaacgcgatatcgtctattactcTGGTAcatct
ttttgtatttttcgtGTTGAGGACGGCAGCCTTGAGAAATGAGTACCATT
TAGAAAAGTCAAGTAAAGGAATTGTCACTTGAAGTTTTCAAATTCGCCGT
AATTAGATTATACATTATATCTGGAAAAAGAACTTGATACAGTTTTTGGG
TCCCGAGTTAAATTCGTCATAAGAAAAACTCTACCGTGATAAAAAACTTA
TTTGGAACAATAATTTCTTCATAGTACAGTTAAACATTTTGTAtgacttc
aattttcaattcttttactGGACATAGATATGCATTGCAAAAACAAgtca
ggctcggatacagagggaggctataaccaatggaggagagtgcactttat
catcgtattaccttatatggaaactaattactctccacgaataagatagc
ctacctcctgtatccgacacTGNAtgacttcaattttcaattcCTTTACT
GGACATAGATATGCATTGCAAAAACAAGTCTTTTTTCAGTTGATTTTAAA
TTTATACGATTTGATACATAACATATTATTCTATATGATACGGTAGTCGT
ATTGGTCGGAAAGTTTTTGGAATTCCTcacaaaaatttgataaattaaaG
GTTATTTTTGCCTTTTCGTATCAGTAAGCAAATCAATGAAAACTGCAATT
GCAAACTGGCTGCAATTTGGACGTAGTTATCACACTCCCGACAGCTTAAA
TTTATAatataaataaacaaatttttaattaactGGAATTTGGATTTCTA
AGTTTTAGTACCAGATATGAAATCCAAATGCTCGACTAGATTGCAAATCT
GTAAGAATTCATGCGACAGATATATTACGACTTTAAATTCGTGACTTAAA
AAAGACATAATTTAAATTAGcactatttatttatttatttattgaacatt
tgtcaatattttgctttaatttattgtttttatagtAATAAGTGTCGATT
CTTCATAGTTTTGCAATCCTCAATATTTGTTTTCGACCCTCGTGAGTCCT
GGGACGATGACcaatttacatgtttttttataagcataaaaaattc
Run BLAST on NCBI

transcript from alignment at sc0000005:1369793..1379647-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000884 ID=TCONS_00000884|Name=TCONS_00000884|organism=Clytia hemisphaerica|type=transcript|length=9855bp|location=Sequence derived from alignment at sc0000005:1369793..1379647- (Clytia hemisphaerica)
TCCTTATCTTCATAGTTTCAGAAAGGTGTATATCTTTAACAATTATGATT TATAGAACAGATAAGAAATTTTTTTAATAGAAAGTTAAAAGAGGAACTGA AAAGGAAATCAAAAGGGGGACATTACCCTCTGAAAAGCCCTGGACGCGAG CAATTAAGCCACCAAAGATGGAAAAAATTGATATCTTTCATCCTTGAAAA GACTTTTCGAAATCTTGTGATAAAGAAGTATTCACAGTCGTTGGTCAATT TTTACTGGCGCATTCAAACTTCAAGATTTCCTAAATCGAAGTGAAGTCTA GTAATATACAAAATCGCACGTGCTTATCATGCTTGTTTTTTATATGATGG TATTGTGTGCGGCTATGTCAACGAATCGTCATTTTTTCGCTCATTCGTAT GATAATAACCCATATCCTGGCTTCAATCTGGGTATGTTTGGCAATCGTGG ATATTATTTTAATCTAGGTCCGTTGTAGTCATTCATTGCTTCGTTCATTT TTTAACCTCGTTGCCTCTCTCAAACTGTTTCATATATATACCAGCCAGTC TGTTTACCATAAGTGTTAAATCATCTGGCTTTTTCATATGGAAACCATAT CAGTATGATTTAAACTGAGTTTGTTTGTGGGTGGTTTCCACCTGGTAGCA AGAAAAGTGCACTCTAATGAGAGCTGGAATATCCGATTCTTTGCTTACTT TCGGCTAGTACGATTTTTTGAATCTGTCGGTAAATATTACCTTCAATCAA ACTTAATTGAACAACTCGTACCAGTGTTCGGAAATTCCTTGCTAATACAC CTTTTCGACCGTAGCCACCAATTGCCGCGTGGGCATTTTTTTTTTGTCCG TTAATCACCCTAAAACCGTCCCAGTCTTTNTCCGATTCTTTGCTTACTTT CGGCTAGTACGATTTTTTGAATCTGTCGGTAAATGTTACCTTCAATCAAA CTTAAGTGAATAACTCGTACCAGTGTTCGGAAATTCCTTGCTAATACACC TTTTCGACCGTAGCCACCAATTGCCGCGTGGGCATTTTTTTTTGTCCGCT TTACCACCCTAAAACCGTTCCAGTCTTTTTTTTGCACCTATAGGCAATAG AAAAAAGTCTAAAAAAGCATTAGACTAGCAAACTAGTCTGTTAATTAATC ATATCAGAGGGGGGGACATAAAGGCGGCGGGCGTTTGCTAGAATAGGAGC TGCGTAGGAGAGCGAGCAAAAGTTAGTGAGAGGCTGCTGATTAATAGGCA CGTACCTGACCGCGCGACTACGGTCGAAAAGGTGTATCAAACTTATGTGT CCTTTCCCATCCGTCATCTTTATAGATTTGATATTTTATAAAGATGATCA TTTCTCCCTATATTGTTGTCACAAATCGAACAGTTTGGTGCATCCAGACT TTCAAGCTCTTTCTCAGCCAAAACCATAAGATTTAACATTAAATTATATC GTTGTCGATTTGATCATAGACTTCACAGCCGTGATTTATTCAAACCCCTG TTATTTTCATTTTTTAGCCTATGAAAGTTTGGACGAAGGTGAACAGAGGC TTTTGAAATATCTGAAGAATTTTAGCGTGAACTCGAGGCCAGTCAATATC TCATCAACAGCTGTATACGTTAATGTTACCATGGAAATTGTTCGACTCGA TGCCGTGGTAGGTTTTACTCATATAGCCCGGTTTTTTTATTAGTTATCGG GTGTGTAAAATCCTGCTTTGGGCGAGGTTTTATCGATTTGGAAAGGAGCG GAAAATGACATTCGGTCTCCACATGACGTTTTTTCGGTCAATGAAATTGC AAGTAACTTGACTGTCGGATAAGCTTCATATTTTCTGCAAGGCTGACGTA TAACCGGATAAGATTTACATATTTTCTCTAAAGTCTACTTATAGTGTAAA AGCTTTTACCCCCAACTAAGAGGTCTTAATAAACATTCGGTTGTCTGGTG ATTGTATATTGATGGTTGTCTATAGTTAGGGACTGTACACCCTGGTAGAG GAGCAGATTATTTTCGTCTTTTTTAAATCACTTATTGGTTTCCTTACGAC TTTATTAAAAGCAAAGACTATTCGATTCTTAGTTTCCATCTGCTTTGACT ACCCTTACTAGTAATATAGATATTGGGTGTAACAATATGGTCGAATATAT TCGTATACCGGCGCCGTCTCTAGTTTAAGAATCAGTTCTTTATCTCGTCT AGATTTTTATTTCTAAAGATCCTCATCTTATTGTCCCCCATATGAACCCT TCAAATTATTTCATTTTCTTTTCAAATATTCGTAGATTATTTTATCTTAG GTTTTCTTCCTTTATTTTCTTATAGAGTGAAAAGGGACAGTCTGTTCGGA TGAAATTACATATTAATTATGTAAGTAATGAAACATTTTGTGTCTAACTT TTTTATCCCTAAACTAACCCTCCTTATCTGATCTCTAAGACTGAGAGTAC ACTATCCAGTTTTATCATCTCTACCATTGTTGCCGGCACCATGAAGTCAT ATAGGGCCAGATAGGCAAACTTTAAGCTTTCCCAGTAGAGTAAAAACAAA AGATTGTGCCCTTTTTGTATCGGTTACCGGTAATCTTTTTCTTATTTTCA GCTTTGGAGGAACCCATATTTAGTATGGAATCCGCTTAACTATAAAGGTG TTTCCGAAGTCATTTTACCCGAAGGTGAAATCTGGATACCGCCCATACGC CTCTTCAATGAGTAAGCACATTTTTCATCACCCTAAAACGCCCTGAAATA TTAAAAATCGAAATTGAGAATGAACTTTATTTGGTAGTCCAATTCAGTTA AATTGCGCCCCTGTTGCCAACTGTCTTTTTTTCCCCTCTTTGTAATTATT TTCCCTGAAAATGTTCCTGGAAGCTCAACTTACATCATTTTAGGGGCCTC GAATTCATCCAAGTTTTTTTTCTGTAGGATTTCCTACAAAAAACTAAAAG TCCCAAGACATTTTGACGTTCAACAAACAGCCGCTTTCAACTTTATCTAC CGTCTTTATTGTTCGAAATCTCTTGCACTGCGATCCTTTTGCCACCTTTC CTCTTCTTTTCCTCTTTCTTCAAACTCGCCCTTTTTTACCCACAGTTTTA ATTTATTTTAAAGAAAGAAATGTTGTAAATGCCTAATGGGGCATTATTCT TTTTCGCCGTAATGAAACCAACTGCACCTAAGATAGTGATTCCACTGAAG TACAGAAAACTAGTAAAGAATCTCAATTAGTATTATTGCATTAATTTTCA AAAGATTAACTTTTGTGTTTTTGCGAATTTCGGCGAAATTGCCGACTCAG GGAATTAAATCCACGCATTCTGTAACTCTTTTTTTTCGAGGGAAAATAAC ACTCGAAATCTTCTTTACGGAAAATTGGGATCTTTTTTAGCTGATTTTTA GTCCAGAAATTTTAGGCATTACTAACGGGCAAAATAATCTTTCTCGTTAA AATCATCAAGACAATCCCTAAAAATGATGCTGAAAAATATTTCTCTTTGA ATTTCCTGACTGACTTAGAGAAGTCTCTAAATACGGGAATATTGCTTTCT TTTAAAAAGAAAAACTGTTTTTATAATGACTCTCTTGGTTAGGGGTTAGT TCCAAGAATCTTTCTTAGCTTTTATCCAACAAGACTAGAAAAGAAAAAAT AATATTTAAACAGCGGTTTTGATCTGAATATTCTTTCCCAAAAAATTTGT TCTATATTTAGGGTACTATTAGGCAGGTGCCTCAAAAGAAATATGTAGAT GTTAATTTTTTATTCTCGCCCCCTCTTTTTCATATCATTTCTTCCACATT TACTTTTCACTTAAAAATATATTTGGAAAAAGTCATATCAGTACGAAAAG ATTAATTTTATACATTTAGAATGCGTACACTTTACTTTCCGAAAAAAAAA CCCATGGGGCCTAAAAATAGAACAAAAGATACAATGCTAGTAAAACACCC AAAAGCCTGGAGCTATCCTATTATGTAGATTTTCACATCCTCGAATTAAA AAACACTTTCAAAATATTATAAACCTTTTTTACCCTGGTGATTTTTAGAA AACTAAAACTTTGTACCTTTCCTATCTTCCAAGCTTTTCAATTCTTTCAT GCAGAGCGAGCAAAACACAAGGTGAATACAATGAGGACAATCACGCGCGG ACCGTGCTTCTAACGAATGATGGCAACTGTTCACTAACCTATGCCCAGTT CTTCAAATCCACATGCGAAATTGATGTCAGTGATTTTCCATTTGACCAGC AATATTGCGATATGACGTTTGGTAGTTGGAGTATGGATGAACGGTTGCTA CAACTGAGAGCTGTCAAGGAAGAAGCTATATCTGAGCAATTGTACAAGGA AAATGGTGAATGGCATTTAACTGAAGCCACATTGAAGACCCATGATGTAC GTTTTCCTTGATCATATTTTTAGTTTTAGTTGAATTTCGGTTTCTGGAAA GAGTACCACTTCCAGACTAGAATCCAGTTGTATTCTTAGAATTAAGAGTA GATGTACAATCAAATTGTAAGACAAAGTAGAATACAAGCTTCACCCCCTC CCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNGTCCCCCCCGTTTATTGAAATTTCAAAAA TTTTCCAACCCCCCCGTTTATTCCAACCCCCCGTTTATTTGGCACCTAAG AGTAAGTCCATGATTGTATAAACGTCATCGATCAAAGGTGTAACCTTTTG TTTTGGTGCTTTATAAATTTTTACGATTAAATCTTAAACCTGCTAGCCTA GAAGAGGACTAGTAAGTACTCTTAGAATGAAAATAAGAATTGTATTCTGA GGGAATTCTTAGTTTCAATTACTATCAACCAGACAGATCTTCCTCGATTT TAATAAATCATAGTAAAGATATTCTTTTTTTATGCTGACAGAATAGAGTT AACAAAAGAATTTCTCAAAATTTGTCCTATCACGTGACGAAAGTAACTTC TTTTGTTTAAAGATAAAGTAGTGTGTCTTTTGTTTTTAAATCAGAAAATT CAATGGGATTGGGGAAGATAGCACGATATTTTGCAGTGAGGATTTGTTTA TTTGATTATTTTCAGTGGGGACAAAAATTGGACGATGATTTTCCACCGGG GACGATATTTTGGCAAAATTTTTCTTTTTCTGTGAGAAGGGGGTGTCTTC AAATCAAGGTAGTTTGAACTGTAAGAAAAATTTTCCTTTTATAGGTCAGA TATCCGATTCACCGTCACAAACACAGCACCATCAAACTCTCCATACTCAT AAAGCGAAAGTACATCTTTTTCATCATGAATTTGGTGGTACCATGTGCTC TCATTGCATGCATGATTTTCTTGGTGTTTGTACTACCAGCCAAATCAGGA GAAAGAATCTCTCTTGGTATTACTGTCATGTTATCTATGGCTATCTTTCA AGAATTGTCGTCAGAGAAATTGCCAAGTAGTTCTGATAACTATCCGTTAC TTGGTATGTATTACTACAAAACTTTGAAATATCTTTCCAACTAGTTTTGA TAGATTTTCAATTTTGTGCTCGCTGAAAAAACTGACTGCTAGTAGAATTT CTAACAATTTTTTTAAAGGTTGGAAATTAGGAGGACAAAAATATAGCGTT TTAAAAGCGTATGAGAACCACTTTTCACAGAAAAAGAACTTCTACCTAAA TCTTCACTCTTAATTAAAGAGTATGTCAGACATACAAGAATCACACATGG CAATAACCTTTCTGTTATCAAAATTCATTACATNTTCTGAGGGAATTCTT AGTTTCAATTACTATCAACCAGACAGATCTTCCTCGATTTTAATAAATCA TAGTAAAGATATTCTTTTTTTATGCTGACAGAATAGAGTTAACAAAAGAA TTTCTCAAAATTTGTCCTATCACGTGACGAAAGTAACTTCTTTTGTTTAA AGATAAAGTAGTGTGTCTTTTGTTTTTAAATCAGAAAATTCAATGGGATT GGGGAAGATAGCACGATATTTTGCAGTGAGGATTTGTTTATTTGATTATT TTCAGTGGGGACAAAAATTGGACGATGATTTTCCACCGGGGACGATATTT TGGCAAAATTTTTCTTTTTCTGTGAGAAGGGGGTGTCTTCAAATCAAGGT AGTTTGAACTGTAAGAAAAATTTTCCTTTTATAGGTCAGATATCCGATTC ACCGTCACAAACACAGCACCATCAAACTCTCCATACTCATAAAGCGAAAG TACATCTTTTTCATCATGAATTTGGTGGTACCATGTGCTCTCATTGCATG CATGATTTTCTTGGTGTTTGTACTACCAGCCAAATCAGGAGAAAGAATCT CTCTTGGTATTACTGTCATGTTATCTATGGCTATCTTTCAAGAATTGTCG TCAGAGAAATTGCCAAGTAGTTCTGATAACTATCCGTTACTTGGTATGTA TTACTACAAAACTTTGAAATATCTTTCCAACTAGTTTTGATAGATTTTCA ATTTTGTGCTCGCTGAAAAAACTGACTGCTAGTAGAATTTCTAACAATTT TTTTAAAGGTTGGAAATTAGGAGGACAAAAATATAGCGTTTTAAAAGCGT ATGAGAACCACTTTTCACAGAAAAAGAACTTCTACCTAAATCTTCACTCT TAATTAAAGAGTATGTCAGACATACAAGAATCACACATGGCAATAACCTT TCTGTTATCAAAATTCATTACATTATGAAATTCCTGATCGAACTTGATCC ACATATTTCTTTTTATTTTCAGGTGTTTATTACACGACTTCAATGTTTGA AATTGGTATTGCCCTGGTCATGAACTGCTTCATTCTTAATGTTTACTATC GCAACTATGAAATGCAGCCGTGGATGCGTCGATTGTTATTCGATAAACTC GCTCGACTCGTTCGAATCGATATCCCACATACTCGAACGCAGCATTACAT TGATCGAATGTCGACTGGTCAGTTCCGAGAATTGAATCCATTGGCTGAAA CCACCCTCAATAATACGGCGCACAATGCTCACAATATTGACGGTGAATCG GCACTTGGTAACGGGAACGGAGAAATGTCATATTTTCCAAAATCGACGCT CCATCGGGAAGACACACAGACTATTCAACGGAAAACCAAGAAGTTTTCTG TCAACCAAAACGGCAGCAGTAGCGATTTGACGTACACCAAATCGAATTTG TCGGCAAAAATTTCACTCTCTTTGTCATCTGATCCAAGTACGCGTATCGA AGAGCGAAAACTCTTAGGTGAGGACTGGAAAACAGCGGCTAGAATTCTAG ATCGCTGTATGTTAGCTATAGCGATTAGCGTTGGAGTTATCTCAGCACTT ACCATTTTTATGCAAGCGGCAAGGTTTCGTGAGATGTTTATTCCTTGAGA ATGCTCTCACTGCTTTGCTTACACTCAACACAAGTAAGTGCTTGCCATCT GTTGTTGCTATGGTAAATTTTATGATGTTCAAGGAGGAGTTATGGAGAAA GAAAGATGGTAGCACCATTACGTATTGCTAAGGTTGGTAACCCTTGGTTA CAGGAGACCTCGTTTCATGGGTTGTATAAATGACACAGATACAATATCTA TAAAAGCGAAAATTTGTTTCTACCGCAAAATAAAATGACTGAGTTGAAAT GGTTTAGATAATGAGCTTATTAAACAAACAAAGCTAACTTATTATTAATA ATGCTTAGCTGATAGAAAGAGGAAAGTTTGTATTTACTAAAATCACTTTC AAATCAAGGCCGCTTTTTACATTACGTGCTTGATGCAAAAACATAAAGAA TGGCTTTGGCGAAACAATCTTGGCCCAAACATACAATCAAAGTAAAAGCG TCTCTTTGCNAATAATTAACATAATATATGCATGGATCGTGCATCGTGCA TCGTGAATCGTTGGATCGCGCATCGTAAATAGACGATATCGCGTTTAGAT AAATGCAATGCATTCTGGTTTCTCGGGGACTCTCAAAGGAATTATAATGT CGATTATATAATAATCTGGAATAGATTATAATTCCCTTGAGGGTCCCCGA GAAACCAGAATGCATTGCATTTATCTAAACGCGATATCGTCTATTACTCT GGTACATCTTTTTGTATTTTTCGTGTTGAGGACGGCAGCCTTGAGAAATG AGTACCATTTAGAAAAGTCAAGTAAAGGAATTGTCACTTGAAGTTTTCAA ATTCGCCGTAATTAGATTATACATTATATCTGGAAAAAGAACTTGATACA GTTTTTGGGTCCCGAGTTAAATTCGTCATAAGAAAAACTCTACCGTGATA AAAAACTTATTTGGAACAATAATTTCTTCATAGTACAGTTAAACATTTTG TATGACTTCAATTTTCAATTCTTTTACTGGACATAGATATGCATTGCAAA AACAAGTCAGGCTCGGATACAGAGGGAGGCTATAACCAATGGAGGAGAGT GCACTTTATCATCGTATTACCTTATATGGAAACTAATTACTCTCCACGAA TAAGATAGCCTACCTCCTGTATCCGACACTGNATGACTTCAATTTTCAAT TCCTTTACTGGACATAGATATGCATTGCAAAAACAAGTCTTTTTTCAGTT GATTTTAAATTTATACGATTTGATACATAACATATTATTCTATATGATAC GGTAGTCGTATTGGTCGGAAAGTTTTTGGAATTCCTCACAAAAATTTGAT AAATTAAAGGTTATTTTTGCCTTTTCGTATCAGTAAGCAAATCAATGAAA ACTGCAATTGCAAACTGGCTGCAATTTGGACGTAGTTATCACACTCCCGA CAGCTTAAATTTATAATATAAATAAACAAATTTTTAATTAACTGGAATTT GGATTTCTAAGTTTTAGTACCAGATATGAAATCCAAATGCTCGACTAGAT TGCAAATCTGTAAGAATTCATGCGACAGATATATTACGACTTTAAATTCG TGACTTAAAAAAGACATAATTTAAATTAGCACTATTTATTTATTTATTTA TTGAACATTTGTCAATATTTTGCTTTAATTTATTGTTTTTATAGTAATAA GTGTCGATTCTTCATAGTTTTGCAATCCTCAATATTTGTTTTCGACCCTC GTGAGTCCTGGGACGATGACCAATTTACATGTTTTTTTATAAGCATAAAA AATTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000521XLOC_000521Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000884-exon-sc0000005-1575043694:1379181..1379647TCONS_00000884-exon-sc0000005-1575043694:1379181..1379647Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1575043694:1377991..1378130TCONS_00000884-exon-sc0000005-1575043694:1377991..1378130Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1575043694:1377278..1377322TCONS_00000884-exon-sc0000005-1575043694:1377278..1377322Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1575043694:1376937..1377046TCONS_00000884-exon-sc0000005-1575043694:1376937..1377046Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1575043694:1375252..1375543TCONS_00000884-exon-sc0000005-1575043694:1375252..1375543Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1575043694:1372505..1372763TCONS_00000884-exon-sc0000005-1575043694:1372505..1372763Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1575043694:1369793..1372175TCONS_00000884-exon-sc0000005-1575043694:1369793..1372175Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1510915933:1379181..1379647TCONS_00000884-exon-sc0000005-1510915933:1379181..1379647Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1510915933:1377991..1378130TCONS_00000884-exon-sc0000005-1510915933:1377991..1378130Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1510915933:1377278..1377322TCONS_00000884-exon-sc0000005-1510915933:1377278..1377322Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1510915933:1376937..1377046TCONS_00000884-exon-sc0000005-1510915933:1376937..1377046Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1510915933:1375252..1375543TCONS_00000884-exon-sc0000005-1510915933:1375252..1375543Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1510915933:1372505..1372763TCONS_00000884-exon-sc0000005-1510915933:1372505..1372763Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1510915933:1369793..1372175TCONS_00000884-exon-sc0000005-1510915933:1369793..1372175Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1491911889:1379181..1379647TCONS_00000884-exon-sc0000005-1491911889:1379181..1379647Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1491911889:1377991..1378130TCONS_00000884-exon-sc0000005-1491911889:1377991..1378130Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1491911889:1377278..1377322TCONS_00000884-exon-sc0000005-1491911889:1377278..1377322Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1491911889:1376937..1377046TCONS_00000884-exon-sc0000005-1491911889:1376937..1377046Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1491911889:1375252..1375543TCONS_00000884-exon-sc0000005-1491911889:1375252..1375543Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1491911889:1372505..1372763TCONS_00000884-exon-sc0000005-1491911889:1372505..1372763Clytia hemisphaericaexon
TCONS_00000884-exon-sc0000005-1491911889:1369793..1372175TCONS_00000884-exon-sc0000005-1491911889:1369793..1372175Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:1369793..1379647 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
7.50627e-10 0 0 0 0 0 0.0290724 3.78152e-08 0.147909 5.40243e-10 3.87029e-10 0 6.88498e-05 0 0 0 0 0 0.908048 0.0001651 0.00162481 0 8.97868e-09 0.0354925 0.000102956 2.50867e-09 0 0 0 0
Blast
BLAST of TCONS_00000884 vs. Swiss-Prot (Human)
Match: ACHA7 (Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens GN=CHRNA7 PE=1 SV=5)

HSP 1 Score: 207.608 bits (527), Expect = 6.183e-57
Identity = 144/498 (28.92%), Postives = 245/498 (49.20%), Query Frame = 2
Query:  485 EGEQRLLKYL-KNFSVNSRPVNISSTAVYVNVTMEIVRLDAVSEKGQSVRMKLHINYLWRNPYLVWNPLNYKGVSEVILPEGEIWIPPIRLFNEASKTQGEYNEDNHARTVLLTNDGNCSLTYAQFFKSTCEIDVSDFPFDQQYCDMTFGSWSMDERLLQLRAVKEEAISEQLYKENGEWHLTEATLKTHDVRYPIHRHKHSTIKLSILIKRKYIFFIMNLVVPCALIACMIFLVFVLPAKSGERISLGITVMLSMAIFQELSSEKLPSSSDNYPLLGVYYTTSMFEIGIALVMNCFILNVYYRNYE---MQPWMRRLLFDKLARLVRIDIP-----HTRTQHYIDRMSTG--QFRELNPXXXXXXXXXXXXXXXIDGESAL-----GNGNGEMSYFPKSTLH-REDTQTIQRKTKKFSVNQNGSSSDLTYTKSNLSAKISLSLSSDPSTRIEERKLLGEDWKTAARILDR-CMLAIAISVGVISALTIFMQAARFRE 1924
            E +++L K L KN++   RPV   S  + V  ++ ++++  V EK Q +   + +   W + YL WN   Y GV  V  P+G+IW P I L+N A +    ++   H   VL+ + G+C       FKS+C IDV  FPFD Q+C + FGSWS     L L+ ++E  IS   Y  NGEW L     K  +  Y   +  +  +  ++ ++R+ +++ +NL++PC LI+ +  LVF+LPA SGE+ISLGITV+LS+ +F  L +E +P++SD+ PL+  Y+ ++M  +G+++V+   +L  ++ + +   M  W R +L +  A  +R+  P         QH   R S    +   + P   +  N        +DG   +     G   G M+  P    H     Q  +       + +     ++ Y  +    +             +E + +  +WK AA ++DR C++A ++   +I  + I M A  F E
Sbjct:   24 EFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE---RFDATFHT-NVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQ-MQEADISG--YIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILE-----EVRYIANRFRCQ-------------DESEAVCSEWKFAACVVDRLCLMAFSV-FTIICTIGILMSAPNFVE 495          
The following BLAST results are available for this feature:
BLAST of TCONS_00000884 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ACHA76.183e-5728.92Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top